data_4PKE # _entry.id 4PKE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4PKE pdb_00004pke 10.2210/pdb4pke/pdb WWPDB D_1000201559 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-10-08 2 'Structure model' 1 1 2014-10-22 3 'Structure model' 1 2 2014-10-29 4 'Structure model' 1 3 2014-11-05 5 'Structure model' 1 4 2016-07-27 6 'Structure model' 1 5 2017-09-13 7 'Structure model' 1 6 2019-11-20 8 'Structure model' 1 7 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Database references' 5 5 'Structure model' 'Data collection' 6 6 'Structure model' 'Author supporting evidence' 7 6 'Structure model' 'Derived calculations' 8 7 'Structure model' 'Author supporting evidence' 9 8 'Structure model' 'Data collection' 10 8 'Structure model' 'Database references' 11 8 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 6 'Structure model' pdbx_audit_support 2 6 'Structure model' pdbx_struct_oper_list 3 7 'Structure model' pdbx_audit_support 4 8 'Structure model' chem_comp_atom 5 8 'Structure model' chem_comp_bond 6 8 'Structure model' database_2 7 8 'Structure model' pdbx_struct_conn_angle 8 8 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 6 'Structure model' '_pdbx_audit_support.funding_organization' 2 6 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 7 'Structure model' '_pdbx_audit_support.funding_organization' 4 8 'Structure model' '_database_2.pdbx_DOI' 5 8 'Structure model' '_database_2.pdbx_database_accession' 6 8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 8 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 8 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 12 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 8 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 8 'Structure model' '_pdbx_struct_conn_angle.value' 18 8 'Structure model' '_struct_conn.pdbx_dist_value' 19 8 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 8 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 8 'Structure model' '_struct_conn.ptnr1_label_asym_id' 22 8 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 8 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 8 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 8 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 8 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 8 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 8 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 8 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 8 'Structure model' '_struct_conn.ptnr2_symmetry' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4PKE _pdbx_database_status.recvd_initial_deposition_date 2014-05-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 4PKX _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kamajaya, A.' 1 'Kaiser, J.' 2 'Lee, J.' 3 'Reid, M.' 4 'Rees, D.C.' 5 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 0969-2126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 22 _citation.language ? _citation.page_first 1520 _citation.page_last 1527 _citation.title 'The Structure of a Conserved Piezo Channel Domain Reveals a Topologically Distinct beta Sandwich Fold.' _citation.year 2014 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2014.08.009 _citation.pdbx_database_id_PubMed 25242456 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kamajaya, A.' 1 ? primary 'Kaiser, J.T.' 2 ? primary 'Lee, J.' 3 ? primary 'Reid, M.' 4 ? primary 'Rees, D.C.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein C10C5.1, isoform i' 32927.004 1 ? ? 'UNP residues 1327-1608' ? 2 non-polymer syn 'PLATINUM (II) ION' 195.078 5 ? ? ? ? 3 water nat water 18.015 7 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYL KGYTYEDILIVRFRPESEIYWPISQDSRNAMIDKLSRNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAK IQSALRGDPGHPILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFDSLTLNLEQGKSQNEK MWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYL KGYTYEDILIVRFRPESEIYWPISQDSRNAMIDKLSRNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAK IQSALRGDPGHPILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFDSLTLNLEQGKSQNEK MWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PLATINUM (II) ION' PT 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LEU n 1 4 LEU n 1 5 ASN n 1 6 GLN n 1 7 ILE n 1 8 GLY n 1 9 THR n 1 10 ILE n 1 11 SER n 1 12 MET n 1 13 PRO n 1 14 GLU n 1 15 LYS n 1 16 VAL n 1 17 THR n 1 18 LEU n 1 19 ARG n 1 20 ILE n 1 21 SER n 1 22 ILE n 1 23 GLU n 1 24 GLY n 1 25 TYR n 1 26 PRO n 1 27 PRO n 1 28 LEU n 1 29 TYR n 1 30 GLU n 1 31 MET n 1 32 GLU n 1 33 ALA n 1 34 GLN n 1 35 GLY n 1 36 SER n 1 37 ASN n 1 38 HIS n 1 39 ASP n 1 40 ASN n 1 41 ALA n 1 42 GLU n 1 43 LEU n 1 44 GLY n 1 45 MET n 1 46 ILE n 1 47 LYS n 1 48 PRO n 1 49 ASP n 1 50 GLN n 1 51 LEU n 1 52 ALA n 1 53 SER n 1 54 LEU n 1 55 ASN n 1 56 GLN n 1 57 ALA n 1 58 LEU n 1 59 THR n 1 60 ASP n 1 61 SER n 1 62 TYR n 1 63 THR n 1 64 THR n 1 65 ARG n 1 66 ASP n 1 67 THR n 1 68 ASN n 1 69 SER n 1 70 ILE n 1 71 LEU n 1 72 ARG n 1 73 SER n 1 74 ARG n 1 75 MET n 1 76 SER n 1 77 VAL n 1 78 SER n 1 79 TYR n 1 80 LEU n 1 81 LYS n 1 82 GLY n 1 83 TYR n 1 84 THR n 1 85 TYR n 1 86 GLU n 1 87 ASP n 1 88 ILE n 1 89 LEU n 1 90 ILE n 1 91 VAL n 1 92 ARG n 1 93 PHE n 1 94 ARG n 1 95 PRO n 1 96 GLU n 1 97 SER n 1 98 GLU n 1 99 ILE n 1 100 TYR n 1 101 TRP n 1 102 PRO n 1 103 ILE n 1 104 SER n 1 105 GLN n 1 106 ASP n 1 107 SER n 1 108 ARG n 1 109 ASN n 1 110 ALA n 1 111 MET n 1 112 ILE n 1 113 ASP n 1 114 LYS n 1 115 LEU n 1 116 SER n 1 117 ARG n 1 118 ASN n 1 119 THR n 1 120 SER n 1 121 VAL n 1 122 ASN n 1 123 PHE n 1 124 GLU n 1 125 VAL n 1 126 SER n 1 127 LEU n 1 128 GLU n 1 129 PHE n 1 130 THR n 1 131 ARG n 1 132 PRO n 1 133 TYR n 1 134 ASP n 1 135 PRO n 1 136 ASN n 1 137 GLU n 1 138 ASN n 1 139 ALA n 1 140 ALA n 1 141 LEU n 1 142 LYS n 1 143 HIS n 1 144 SER n 1 145 LYS n 1 146 SER n 1 147 TRP n 1 148 LEU n 1 149 VAL n 1 150 PRO n 1 151 ILE n 1 152 SER n 1 153 LEU n 1 154 ASP n 1 155 MET n 1 156 THR n 1 157 ILE n 1 158 ARG n 1 159 ALA n 1 160 LYS n 1 161 ILE n 1 162 GLN n 1 163 SER n 1 164 ALA n 1 165 LEU n 1 166 ARG n 1 167 GLY n 1 168 ASP n 1 169 PRO n 1 170 GLY n 1 171 HIS n 1 172 PRO n 1 173 ILE n 1 174 LEU n 1 175 ILE n 1 176 PRO n 1 177 GLN n 1 178 SER n 1 179 ILE n 1 180 PRO n 1 181 ALA n 1 182 PHE n 1 183 ILE n 1 184 GLN n 1 185 VAL n 1 186 PRO n 1 187 ASN n 1 188 GLN n 1 189 GLY n 1 190 GLU n 1 191 LEU n 1 192 THR n 1 193 LEU n 1 194 PRO n 1 195 THR n 1 196 SER n 1 197 ILE n 1 198 GLY n 1 199 ASN n 1 200 THR n 1 201 ILE n 1 202 ILE n 1 203 ASN n 1 204 ASP n 1 205 GLY n 1 206 ASN n 1 207 PRO n 1 208 ARG n 1 209 ILE n 1 210 ASN n 1 211 THR n 1 212 THR n 1 213 GLY n 1 214 MET n 1 215 GLU n 1 216 LYS n 1 217 SER n 1 218 ASP n 1 219 GLU n 1 220 ALA n 1 221 ARG n 1 222 ALA n 1 223 TRP n 1 224 PHE n 1 225 ASP n 1 226 SER n 1 227 LEU n 1 228 THR n 1 229 LEU n 1 230 ASN n 1 231 LEU n 1 232 GLU n 1 233 GLN n 1 234 GLY n 1 235 LYS n 1 236 SER n 1 237 GLN n 1 238 ASN n 1 239 GLU n 1 240 LYS n 1 241 MET n 1 242 TRP n 1 243 ILE n 1 244 ALA n 1 245 THR n 1 246 SER n 1 247 GLU n 1 248 HIS n 1 249 PRO n 1 250 GLY n 1 251 ASP n 1 252 GLN n 1 253 ASN n 1 254 ALA n 1 255 LYS n 1 256 LEU n 1 257 TRP n 1 258 ILE n 1 259 LYS n 1 260 THR n 1 261 ALA n 1 262 ASN n 1 263 THR n 1 264 THR n 1 265 TYR n 1 266 SER n 1 267 GLY n 1 268 ARG n 1 269 PRO n 1 270 TYR n 1 271 LEU n 1 272 GLN n 1 273 VAL n 1 274 VAL n 1 275 GLY n 1 276 PHE n 1 277 ILE n 1 278 ASP n 1 279 ARG n 1 280 ALA n 1 281 PHE n 1 282 PRO n 1 283 SER n 1 284 LEU n 1 285 GLU n 1 286 HIS n 1 287 HIS n 1 288 HIS n 1 289 HIS n 1 290 HIS n 1 291 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 291 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'C10C5.1, CELE_C10C5.1, T20D3.11' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Caenorhabditis elegans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6239 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PT non-polymer . 'PLATINUM (II) ION' ? 'Pt 2' 195.078 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 LEU 4 4 ? ? ? A . n A 1 5 ASN 5 5 ? ? ? A . n A 1 6 GLN 6 6 ? ? ? A . n A 1 7 ILE 7 7 ? ? ? A . n A 1 8 GLY 8 8 ? ? ? A . n A 1 9 THR 9 9 ? ? ? A . n A 1 10 ILE 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 MET 12 12 ? ? ? A . n A 1 13 PRO 13 13 ? ? ? A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 GLY 35 35 ? ? ? A . n A 1 36 SER 36 36 ? ? ? A . n A 1 37 ASN 37 37 ? ? ? A . n A 1 38 HIS 38 38 ? ? ? A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ASP 60 60 ? ? ? A . n A 1 61 SER 61 61 ? ? ? A . n A 1 62 TYR 62 62 ? ? ? A . n A 1 63 THR 63 63 ? ? ? A . n A 1 64 THR 64 64 ? ? ? A . n A 1 65 ARG 65 65 ? ? ? A . n A 1 66 ASP 66 66 ? ? ? A . n A 1 67 THR 67 67 ? ? ? A . n A 1 68 ASN 68 68 ? ? ? A . n A 1 69 SER 69 69 ? ? ? A . n A 1 70 ILE 70 70 ? ? ? A . n A 1 71 LEU 71 71 ? ? ? A . n A 1 72 ARG 72 72 ? ? ? A . n A 1 73 SER 73 73 ? ? ? A . n A 1 74 ARG 74 74 ? ? ? A . n A 1 75 MET 75 75 ? ? ? A . n A 1 76 SER 76 76 ? ? ? A . n A 1 77 VAL 77 77 ? ? ? A . n A 1 78 SER 78 78 ? ? ? A . n A 1 79 TYR 79 79 ? ? ? A . n A 1 80 LEU 80 80 ? ? ? A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 TRP 101 101 101 TRP TRP A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 THR 130 130 ? ? ? A . n A 1 131 ARG 131 131 ? ? ? A . n A 1 132 PRO 132 132 ? ? ? A . n A 1 133 TYR 133 133 ? ? ? A . n A 1 134 ASP 134 134 ? ? ? A . n A 1 135 PRO 135 135 ? ? ? A . n A 1 136 ASN 136 136 ? ? ? A . n A 1 137 GLU 137 137 ? ? ? A . n A 1 138 ASN 138 138 ? ? ? A . n A 1 139 ALA 139 139 ? ? ? A . n A 1 140 ALA 140 140 ? ? ? A . n A 1 141 LEU 141 141 ? ? ? A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 TRP 147 147 147 TRP TRP A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 MET 155 155 155 MET MET A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 ILE 157 157 157 ILE ILE A . n A 1 158 ARG 158 158 158 ARG ARG A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 GLN 162 162 162 GLN GLN A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 HIS 171 171 171 HIS HIS A . n A 1 172 PRO 172 172 172 PRO PRO A . n A 1 173 ILE 173 173 173 ILE ILE A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 GLN 177 177 177 GLN GLN A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 PRO 180 180 180 PRO PRO A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 PHE 182 182 182 PHE PHE A . n A 1 183 ILE 183 183 183 ILE ILE A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 PRO 186 186 186 PRO PRO A . n A 1 187 ASN 187 187 187 ASN ASN A . n A 1 188 GLN 188 188 188 GLN GLN A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 THR 192 192 192 THR THR A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 PRO 194 194 194 PRO PRO A . n A 1 195 THR 195 195 195 THR THR A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 GLY 198 198 198 GLY GLY A . n A 1 199 ASN 199 199 199 ASN ASN A . n A 1 200 THR 200 200 200 THR THR A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 ILE 202 202 202 ILE ILE A . n A 1 203 ASN 203 203 ? ? ? A . n A 1 204 ASP 204 204 ? ? ? A . n A 1 205 GLY 205 205 ? ? ? A . n A 1 206 ASN 206 206 ? ? ? A . n A 1 207 PRO 207 207 ? ? ? A . n A 1 208 ARG 208 208 ? ? ? A . n A 1 209 ILE 209 209 ? ? ? A . n A 1 210 ASN 210 210 ? ? ? A . n A 1 211 THR 211 211 ? ? ? A . n A 1 212 THR 212 212 ? ? ? A . n A 1 213 GLY 213 213 ? ? ? A . n A 1 214 MET 214 214 ? ? ? A . n A 1 215 GLU 215 215 ? ? ? A . n A 1 216 LYS 216 216 ? ? ? A . n A 1 217 SER 217 217 ? ? ? A . n A 1 218 ASP 218 218 ? ? ? A . n A 1 219 GLU 219 219 ? ? ? A . n A 1 220 ALA 220 220 220 ALA ALA A . n A 1 221 ARG 221 221 221 ARG ARG A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 TRP 223 223 223 TRP TRP A . n A 1 224 PHE 224 224 224 PHE PHE A . n A 1 225 ASP 225 225 225 ASP ASP A . n A 1 226 SER 226 226 226 SER SER A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 THR 228 228 228 THR THR A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 ASN 230 230 230 ASN ASN A . n A 1 231 LEU 231 231 231 LEU LEU A . n A 1 232 GLU 232 232 232 GLU GLU A . n A 1 233 GLN 233 233 233 GLN GLN A . n A 1 234 GLY 234 234 234 GLY GLY A . n A 1 235 LYS 235 235 235 LYS LYS A . n A 1 236 SER 236 236 236 SER SER A . n A 1 237 GLN 237 237 237 GLN GLN A . n A 1 238 ASN 238 238 238 ASN ASN A . n A 1 239 GLU 239 239 239 GLU GLU A . n A 1 240 LYS 240 240 240 LYS LYS A . n A 1 241 MET 241 241 241 MET MET A . n A 1 242 TRP 242 242 242 TRP TRP A . n A 1 243 ILE 243 243 243 ILE ILE A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 THR 245 245 245 THR THR A . n A 1 246 SER 246 246 246 SER SER A . n A 1 247 GLU 247 247 247 GLU GLU A . n A 1 248 HIS 248 248 248 HIS HIS A . n A 1 249 PRO 249 249 249 PRO PRO A . n A 1 250 GLY 250 250 250 GLY GLY A . n A 1 251 ASP 251 251 251 ASP ASP A . n A 1 252 GLN 252 252 252 GLN GLN A . n A 1 253 ASN 253 253 253 ASN ASN A . n A 1 254 ALA 254 254 254 ALA ALA A . n A 1 255 LYS 255 255 255 LYS LYS A . n A 1 256 LEU 256 256 256 LEU LEU A . n A 1 257 TRP 257 257 257 TRP TRP A . n A 1 258 ILE 258 258 258 ILE ILE A . n A 1 259 LYS 259 259 259 LYS LYS A . n A 1 260 THR 260 260 260 THR THR A . n A 1 261 ALA 261 261 261 ALA ALA A . n A 1 262 ASN 262 262 262 ASN ASN A . n A 1 263 THR 263 263 263 THR THR A . n A 1 264 THR 264 264 264 THR THR A . n A 1 265 TYR 265 265 265 TYR TYR A . n A 1 266 SER 266 266 266 SER SER A . n A 1 267 GLY 267 267 267 GLY GLY A . n A 1 268 ARG 268 268 268 ARG ARG A . n A 1 269 PRO 269 269 269 PRO PRO A . n A 1 270 TYR 270 270 270 TYR TYR A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 GLN 272 272 272 GLN GLN A . n A 1 273 VAL 273 273 273 VAL VAL A . n A 1 274 VAL 274 274 274 VAL VAL A . n A 1 275 GLY 275 275 275 GLY GLY A . n A 1 276 PHE 276 276 276 PHE PHE A . n A 1 277 ILE 277 277 277 ILE ILE A . n A 1 278 ASP 278 278 278 ASP ASP A . n A 1 279 ARG 279 279 ? ? ? A . n A 1 280 ALA 280 280 ? ? ? A . n A 1 281 PHE 281 281 ? ? ? A . n A 1 282 PRO 282 282 ? ? ? A . n A 1 283 SER 283 283 ? ? ? A . n A 1 284 LEU 284 284 ? ? ? A . n A 1 285 GLU 285 285 ? ? ? A . n A 1 286 HIS 286 286 ? ? ? A . n A 1 287 HIS 287 287 ? ? ? A . n A 1 288 HIS 288 288 ? ? ? A . n A 1 289 HIS 289 289 ? ? ? A . n A 1 290 HIS 290 290 ? ? ? A . n A 1 291 HIS 291 291 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PT 1 301 301 PT PT A . C 2 PT 1 302 302 PT PT A . D 2 PT 1 303 303 PT PT A . E 2 PT 1 304 304 PT PT A . F 2 PT 1 305 305 PT PT A . G 3 HOH 1 401 401 HOH HOH A . G 3 HOH 2 402 402 HOH HOH A . G 3 HOH 3 403 403 HOH HOH A . G 3 HOH 4 404 404 HOH HOH A . G 3 HOH 5 405 405 HOH HOH A . G 3 HOH 6 406 406 HOH HOH A . G 3 HOH 7 407 407 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A TYR 83 ? CG ? A TYR 83 CG 2 1 Y 1 A TYR 83 ? CD1 ? A TYR 83 CD1 3 1 Y 1 A TYR 83 ? CD2 ? A TYR 83 CD2 4 1 Y 1 A TYR 83 ? CE1 ? A TYR 83 CE1 5 1 Y 1 A TYR 83 ? CE2 ? A TYR 83 CE2 6 1 Y 1 A TYR 83 ? CZ ? A TYR 83 CZ 7 1 Y 1 A TYR 83 ? OH ? A TYR 83 OH 8 1 Y 1 A LYS 235 ? CG ? A LYS 235 CG 9 1 Y 1 A LYS 235 ? CD ? A LYS 235 CD 10 1 Y 1 A LYS 235 ? CE ? A LYS 235 CE 11 1 Y 1 A LYS 235 ? NZ ? A LYS 235 NZ # _software.citation_id ? _software.classification refinement _software.compiler_name ? _software.compiler_version ? _software.contact_author ? _software.contact_author_email ? _software.date ? _software.description ? _software.dependencies ? _software.hardware ? _software.language ? _software.location ? _software.mods ? _software.name PHENIX _software.os ? _software.os_version ? _software.type ? _software.version '(PHENIX.REFINE: 1.8.2_1309)' _software.pdbx_ordinal 1 # _cell.entry_id 4PKE _cell.length_a 72.588 _cell.length_b 72.588 _cell.length_c 241.551 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 18 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4PKE _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4PKE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.951 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 33.86 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M phosphate-citrate buffer pH 4.0, 26% PEG1000, and 0.2 M Li2SO4' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-05-23 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0716 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0716 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL12-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4PKE _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 33.09 _reflns.d_resolution_high 2.450 _reflns.number_obs 9377 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.09300 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 17.7000 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 10.10 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.45 _reflns_shell.d_res_low 2.57 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.81000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.000 _reflns_shell.pdbx_redundancy 10.60 _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_all ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4PKE _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 8841 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 33.09 _refine.ls_d_res_high 2.50 _refine.ls_percent_reflns_obs 99.9 _refine.ls_R_factor_obs 0.229 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.228 _refine.ls_R_factor_R_free 0.238 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.740 _refine.ls_number_reflns_R_free 419 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.300 _refine.pdbx_overall_phase_error 33.030 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1669 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 7 _refine_hist.number_atoms_total 1681 _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 33.09 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.006 ? ? 1703 'X-RAY DIFFRACTION' ? f_angle_d 1.229 ? ? 2311 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 17.387 ? ? 635 'X-RAY DIFFRACTION' ? f_chiral_restr 0.086 ? ? 262 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 296 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 2.5000 2.8616 2743 0.2356 100.00 0.3269 . . 142 . . . . 'X-RAY DIFFRACTION' . 2.8616 3.6044 2773 0.2657 100.00 0.2810 . . 137 . . . . 'X-RAY DIFFRACTION' . 3.6044 31.1711 2906 0.2142 100.00 0.2137 . . 140 . . . . # _struct.entry_id 4PKE _struct.title 'The structure of a conserved Piezo channel domain reveals a novel beta sandwich fold' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4PKE _struct_keywords.text 'mechanosensitive, channel, piezo, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 3 ? # _struct_ref.db_code O01260_CAEEL _struct_ref.db_name UNP _struct_ref.details ? _struct_ref.entity_id 1 _struct_ref.id 1 _struct_ref.seq_align ? _struct_ref.seq_dif ? _struct_ref.pdbx_db_accession O01260 _struct_ref.pdbx_seq_one_letter_code ;SLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYLK GYTYEDILIVRFRPESEIYWPISQDSRNAMIDKLSRNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKI QSALRGDPGHPILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFDSLTLNLEQGKSQNEKM WIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPS ; _struct_ref.pdbx_align_begin 1327 _struct_ref.pdbx_align_end ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4PKE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 283 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O01260 _struct_ref_seq.db_align_beg 1327 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1608 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 283 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4PKE MET A 1 ? UNP O01260 ? ? 'initiating methionine' 1 1 1 4PKE LEU A 284 ? UNP O01260 ? ? 'expression tag' 284 2 1 4PKE GLU A 285 ? UNP O01260 ? ? 'expression tag' 285 3 1 4PKE HIS A 286 ? UNP O01260 ? ? 'expression tag' 286 4 1 4PKE HIS A 287 ? UNP O01260 ? ? 'expression tag' 287 5 1 4PKE HIS A 288 ? UNP O01260 ? ? 'expression tag' 288 6 1 4PKE HIS A 289 ? UNP O01260 ? ? 'expression tag' 289 7 1 4PKE HIS A 290 ? UNP O01260 ? ? 'expression tag' 290 8 1 4PKE HIS A 291 ? UNP O01260 ? ? 'expression tag' 291 9 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA hexameric 6 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 70 ? 1 MORE -8 ? 1 'SSA (A^2)' 10690 ? 2 'ABSA (A^2)' 8960 ? 2 MORE -534 ? 2 'SSA (A^2)' 58250 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F,G 2 1,2,3,4,5,6 A,B,C,D,E,F,G # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_765 -y+2,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 108.8820000000 0.8660254038 -0.5000000000 0.0000000000 62.8630520099 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_675 -x+y+1,-x+2,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 125.7261040198 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 241.5510000000 5 'crystal symmetry operation' 5_676 x-y+1,-y+2,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 125.7261040198 0.0000000000 0.0000000000 -1.0000000000 241.5510000000 6 'crystal symmetry operation' 6_766 -x+2,-x+y+1,-z+1 -0.5000000000 -0.8660254038 0.0000000000 108.8820000000 -0.8660254038 0.5000000000 0.0000000000 62.8630520099 0.0000000000 0.0000000000 -1.0000000000 241.5510000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 49 ? THR A 59 ? ASP A 49 THR A 59 1 ? 11 HELX_P HELX_P2 AA2 THR A 84 ? GLU A 86 ? THR A 84 GLU A 86 5 ? 3 HELX_P HELX_P3 AA3 SER A 104 ? ARG A 117 ? SER A 104 ARG A 117 1 ? 14 HELX_P HELX_P4 AA4 ASP A 154 ? GLY A 167 ? ASP A 154 GLY A 167 1 ? 14 HELX_P HELX_P5 AA5 PRO A 194 ? ILE A 202 ? PRO A 194 ILE A 202 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A LEU 43 O ? ? ? 1_555 E PT . PT ? ? A LEU 43 A PT 304 1_555 ? ? ? ? ? ? ? 2.766 ? ? metalc2 metalc ? ? A MET 155 SD ? ? ? 1_555 C PT . PT ? ? A MET 155 A PT 302 6_766 ? ? ? ? ? ? ? 2.076 ? ? metalc3 metalc ? ? A LYS 160 NZ ? ? ? 1_555 C PT . PT ? ? A LYS 160 A PT 302 1_555 ? ? ? ? ? ? ? 2.062 ? ? metalc4 metalc ? ? A HIS 171 NE2 ? ? ? 1_555 C PT . PT ? ? A HIS 171 A PT 302 1_555 ? ? ? ? ? ? ? 2.236 ? ? metalc5 metalc ? ? A GLU 232 OE1 ? ? ? 1_555 B PT . PT ? ? A GLU 232 A PT 301 1_555 ? ? ? ? ? ? ? 1.959 ? ? metalc6 metalc ? ? A GLU 232 OE2 ? ? ? 1_555 B PT . PT ? ? A GLU 232 A PT 301 1_555 ? ? ? ? ? ? ? 2.085 ? ? metalc7 metalc ? ? B PT . PT ? ? ? 1_555 G HOH . O ? ? A PT 301 A HOH 401 1_555 ? ? ? ? ? ? ? 1.966 ? ? metalc8 metalc ? ? B PT . PT ? ? ? 1_555 G HOH . O ? ? A PT 301 A HOH 405 2_655 ? ? ? ? ? ? ? 2.319 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SD ? A MET 155 ? A MET 155 ? 1_555 PT ? C PT . ? A PT 302 ? 6_766 NZ ? A LYS 160 ? A LYS 160 ? 1_555 99.8 ? 2 SD ? A MET 155 ? A MET 155 ? 1_555 PT ? C PT . ? A PT 302 ? 6_766 NE2 ? A HIS 171 ? A HIS 171 ? 1_555 99.6 ? 3 NZ ? A LYS 160 ? A LYS 160 ? 1_555 PT ? C PT . ? A PT 302 ? 6_766 NE2 ? A HIS 171 ? A HIS 171 ? 1_555 13.3 ? 4 OE1 ? A GLU 232 ? A GLU 232 ? 1_555 PT ? B PT . ? A PT 301 ? 1_555 OE2 ? A GLU 232 ? A GLU 232 ? 1_555 66.1 ? 5 OE1 ? A GLU 232 ? A GLU 232 ? 1_555 PT ? B PT . ? A PT 301 ? 1_555 O ? G HOH . ? A HOH 401 ? 1_555 71.7 ? 6 OE2 ? A GLU 232 ? A GLU 232 ? 1_555 PT ? B PT . ? A PT 301 ? 1_555 O ? G HOH . ? A HOH 401 ? 1_555 126.7 ? 7 OE1 ? A GLU 232 ? A GLU 232 ? 1_555 PT ? B PT . ? A PT 301 ? 1_555 O ? G HOH . ? A HOH 405 ? 2_655 137.8 ? 8 OE2 ? A GLU 232 ? A GLU 232 ? 1_555 PT ? B PT . ? A PT 301 ? 1_555 O ? G HOH . ? A HOH 405 ? 2_655 123.8 ? 9 O ? G HOH . ? A HOH 401 ? 1_555 PT ? B PT . ? A PT 301 ? 1_555 O ? G HOH . ? A HOH 405 ? 2_655 72.0 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASP 39 A . ? ASP 39 A ASN 40 A ? ASN 40 A 1 9.38 2 ASN 40 A . ? ASN 40 A ALA 41 A ? ALA 41 A 1 -13.43 3 GLU 128 A . ? GLU 128 A PHE 129 A ? PHE 129 A 1 -6.23 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 29 ? ALA A 33 ? TYR A 29 ALA A 33 AA1 2 VAL A 16 ? ILE A 22 ? VAL A 16 ILE A 22 AA1 3 VAL A 121 ? GLU A 128 ? VAL A 121 GLU A 128 AA1 4 HIS A 143 ? PRO A 150 ? HIS A 143 PRO A 150 AA2 1 ILE A 88 ? PHE A 93 ? ILE A 88 PHE A 93 AA2 2 LEU A 271 ? ILE A 277 ? LEU A 271 ILE A 277 AA2 3 PHE A 182 ? VAL A 185 ? PHE A 182 VAL A 185 AA3 1 ILE A 173 ? ILE A 179 ? ILE A 173 ILE A 179 AA3 2 ASP A 225 ? LEU A 231 ? ASP A 225 LEU A 231 AA3 3 TRP A 242 ? GLU A 247 ? TRP A 242 GLU A 247 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ALA A 33 ? O ALA A 33 N VAL A 16 ? N VAL A 16 AA1 2 3 N SER A 21 ? N SER A 21 O PHE A 123 ? O PHE A 123 AA1 3 4 N GLU A 128 ? N GLU A 128 O HIS A 143 ? O HIS A 143 AA2 1 2 N PHE A 93 ? N PHE A 93 O LEU A 271 ? O LEU A 271 AA2 2 3 O PHE A 276 ? O PHE A 276 N VAL A 185 ? N VAL A 185 AA3 1 2 N ILE A 179 ? N ILE A 179 O ASP A 225 ? O ASP A 225 AA3 2 3 N SER A 226 ? N SER A 226 O GLU A 247 ? O GLU A 247 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A PT 301 ? 4 'binding site for residue PT A 301' AC2 Software A PT 302 ? 3 'binding site for residue PT A 302' AC3 Software A PT 303 ? 5 'binding site for residue PT A 303' AC4 Software A PT 304 ? 3 'binding site for residue PT A 304' AC5 Software A PT 305 ? 1 'binding site for residue PT A 305' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 232 ? GLU A 232 . ? 1_555 ? 2 AC1 4 MET A 241 ? MET A 241 . ? 1_555 ? 3 AC1 4 HOH G . ? HOH A 401 . ? 1_555 ? 4 AC1 4 HOH G . ? HOH A 405 . ? 2_655 ? 5 AC2 3 MET A 155 ? MET A 155 . ? 6_766 ? 6 AC2 3 LYS A 160 ? LYS A 160 . ? 1_555 ? 7 AC2 3 HIS A 171 ? HIS A 171 . ? 1_555 ? 8 AC3 5 LEU A 43 ? LEU A 43 . ? 1_555 ? 9 AC3 5 GLY A 44 ? GLY A 44 . ? 1_555 ? 10 AC3 5 MET A 45 ? MET A 45 . ? 1_555 ? 11 AC3 5 THR A 59 ? THR A 59 . ? 3_565 ? 12 AC3 5 PT E . ? PT A 304 . ? 1_555 ? 13 AC4 3 LEU A 43 ? LEU A 43 . ? 1_555 ? 14 AC4 3 MET A 45 ? MET A 45 . ? 1_555 ? 15 AC4 3 PT D . ? PT A 303 . ? 1_555 ? 16 AC5 1 ARG A 268 ? ARG A 268 . ? 4_556 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 117 ? ? -98.89 -108.01 2 1 THR A 119 ? ? 62.75 69.97 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A LEU 4 ? A LEU 4 5 1 Y 1 A ASN 5 ? A ASN 5 6 1 Y 1 A GLN 6 ? A GLN 6 7 1 Y 1 A ILE 7 ? A ILE 7 8 1 Y 1 A GLY 8 ? A GLY 8 9 1 Y 1 A THR 9 ? A THR 9 10 1 Y 1 A ILE 10 ? A ILE 10 11 1 Y 1 A SER 11 ? A SER 11 12 1 Y 1 A MET 12 ? A MET 12 13 1 Y 1 A PRO 13 ? A PRO 13 14 1 Y 1 A GLY 35 ? A GLY 35 15 1 Y 1 A SER 36 ? A SER 36 16 1 Y 1 A ASN 37 ? A ASN 37 17 1 Y 1 A HIS 38 ? A HIS 38 18 1 Y 1 A ASP 60 ? A ASP 60 19 1 Y 1 A SER 61 ? A SER 61 20 1 Y 1 A TYR 62 ? A TYR 62 21 1 Y 1 A THR 63 ? A THR 63 22 1 Y 1 A THR 64 ? A THR 64 23 1 Y 1 A ARG 65 ? A ARG 65 24 1 Y 1 A ASP 66 ? A ASP 66 25 1 Y 1 A THR 67 ? A THR 67 26 1 Y 1 A ASN 68 ? A ASN 68 27 1 Y 1 A SER 69 ? A SER 69 28 1 Y 1 A ILE 70 ? A ILE 70 29 1 Y 1 A LEU 71 ? A LEU 71 30 1 Y 1 A ARG 72 ? A ARG 72 31 1 Y 1 A SER 73 ? A SER 73 32 1 Y 1 A ARG 74 ? A ARG 74 33 1 Y 1 A MET 75 ? A MET 75 34 1 Y 1 A SER 76 ? A SER 76 35 1 Y 1 A VAL 77 ? A VAL 77 36 1 Y 1 A SER 78 ? A SER 78 37 1 Y 1 A TYR 79 ? A TYR 79 38 1 Y 1 A LEU 80 ? A LEU 80 39 1 Y 1 A THR 130 ? A THR 130 40 1 Y 1 A ARG 131 ? A ARG 131 41 1 Y 1 A PRO 132 ? A PRO 132 42 1 Y 1 A TYR 133 ? A TYR 133 43 1 Y 1 A ASP 134 ? A ASP 134 44 1 Y 1 A PRO 135 ? A PRO 135 45 1 Y 1 A ASN 136 ? A ASN 136 46 1 Y 1 A GLU 137 ? A GLU 137 47 1 Y 1 A ASN 138 ? A ASN 138 48 1 Y 1 A ALA 139 ? A ALA 139 49 1 Y 1 A ALA 140 ? A ALA 140 50 1 Y 1 A LEU 141 ? A LEU 141 51 1 Y 1 A ASN 203 ? A ASN 203 52 1 Y 1 A ASP 204 ? A ASP 204 53 1 Y 1 A GLY 205 ? A GLY 205 54 1 Y 1 A ASN 206 ? A ASN 206 55 1 Y 1 A PRO 207 ? A PRO 207 56 1 Y 1 A ARG 208 ? A ARG 208 57 1 Y 1 A ILE 209 ? A ILE 209 58 1 Y 1 A ASN 210 ? A ASN 210 59 1 Y 1 A THR 211 ? A THR 211 60 1 Y 1 A THR 212 ? A THR 212 61 1 Y 1 A GLY 213 ? A GLY 213 62 1 Y 1 A MET 214 ? A MET 214 63 1 Y 1 A GLU 215 ? A GLU 215 64 1 Y 1 A LYS 216 ? A LYS 216 65 1 Y 1 A SER 217 ? A SER 217 66 1 Y 1 A ASP 218 ? A ASP 218 67 1 Y 1 A GLU 219 ? A GLU 219 68 1 Y 1 A ARG 279 ? A ARG 279 69 1 Y 1 A ALA 280 ? A ALA 280 70 1 Y 1 A PHE 281 ? A PHE 281 71 1 Y 1 A PRO 282 ? A PRO 282 72 1 Y 1 A SER 283 ? A SER 283 73 1 Y 1 A LEU 284 ? A LEU 284 74 1 Y 1 A GLU 285 ? A GLU 285 75 1 Y 1 A HIS 286 ? A HIS 286 76 1 Y 1 A HIS 287 ? A HIS 287 77 1 Y 1 A HIS 288 ? A HIS 288 78 1 Y 1 A HIS 289 ? A HIS 289 79 1 Y 1 A HIS 290 ? A HIS 290 80 1 Y 1 A HIS 291 ? A HIS 291 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 PT PT PT N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TRP N N N N 308 TRP CA C N S 309 TRP C C N N 310 TRP O O N N 311 TRP CB C N N 312 TRP CG C Y N 313 TRP CD1 C Y N 314 TRP CD2 C Y N 315 TRP NE1 N Y N 316 TRP CE2 C Y N 317 TRP CE3 C Y N 318 TRP CZ2 C Y N 319 TRP CZ3 C Y N 320 TRP CH2 C Y N 321 TRP OXT O N N 322 TRP H H N N 323 TRP H2 H N N 324 TRP HA H N N 325 TRP HB2 H N N 326 TRP HB3 H N N 327 TRP HD1 H N N 328 TRP HE1 H N N 329 TRP HE3 H N N 330 TRP HZ2 H N N 331 TRP HZ3 H N N 332 TRP HH2 H N N 333 TRP HXT H N N 334 TYR N N N N 335 TYR CA C N S 336 TYR C C N N 337 TYR O O N N 338 TYR CB C N N 339 TYR CG C Y N 340 TYR CD1 C Y N 341 TYR CD2 C Y N 342 TYR CE1 C Y N 343 TYR CE2 C Y N 344 TYR CZ C Y N 345 TYR OH O N N 346 TYR OXT O N N 347 TYR H H N N 348 TYR H2 H N N 349 TYR HA H N N 350 TYR HB2 H N N 351 TYR HB3 H N N 352 TYR HD1 H N N 353 TYR HD2 H N N 354 TYR HE1 H N N 355 TYR HE2 H N N 356 TYR HH H N N 357 TYR HXT H N N 358 VAL N N N N 359 VAL CA C N S 360 VAL C C N N 361 VAL O O N N 362 VAL CB C N N 363 VAL CG1 C N N 364 VAL CG2 C N N 365 VAL OXT O N N 366 VAL H H N N 367 VAL H2 H N N 368 VAL HA H N N 369 VAL HB H N N 370 VAL HG11 H N N 371 VAL HG12 H N N 372 VAL HG13 H N N 373 VAL HG21 H N N 374 VAL HG22 H N N 375 VAL HG23 H N N 376 VAL HXT H N N 377 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.funding_organization 'Howard Hughes Medical Institute (HHMI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 4PKE _atom_sites.fract_transf_matrix[1][1] 0.013776 _atom_sites.fract_transf_matrix[1][2] 0.007954 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015908 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004140 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol _atom_type.analytical_mass_percent _atom_type.description _atom_type.number_in_cell _atom_type.oxidation_number _atom_type.pdbx_scat_Cromer_Mann_a5 _atom_type.pdbx_scat_Cromer_Mann_b5 _atom_type.radius_bond _atom_type.radius_contact _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_dispersion_imag _atom_type.scat_dispersion_real _atom_type.scat_dispersion_source _atom_type.scat_length_neutron _atom_type.scat_source _atom_type.scat_versus_stol_list C ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? N ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? O ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? PT ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? S ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_