data_4TL0 # _entry.id 4TL0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4TL0 pdb_00004tl0 10.2210/pdb4tl0/pdb WWPDB D_1000201794 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4TL0 _pdbx_database_status.recvd_initial_deposition_date 2014-05-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Temmerman, K.' 1 'Simon, B.' 2 'Wilmanns, M.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of death-associated protein kinase 1 with a crucial phosphomimicking mutation' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Temmerman, K.' 1 ? primary 'Simon, B.' 2 ? primary 'Wilmanns, M.' 3 ? # _cell.length_a 50.340 _cell.length_b 77.794 _cell.length_c 110.123 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 4TL0 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4TL0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Death-associated protein kinase 1' 38650.289 1 2.7.11.1 S289E 'UNP residues 1-334' ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 non-polymer syn 'AMMONIUM ION' 18.038 3 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 5 water nat water 18.015 34 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DAP kinase 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPMTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEIQHPNVIT LHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIK IIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFED EYFSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKAEAVNMEKFKKFAARKKWKQSVRLISLCQRL SRSFLSRSNMSVARSD ; _entity_poly.pdbx_seq_one_letter_code_can ;GPMTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEIQHPNVIT LHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIK IIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFED EYFSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKAEAVNMEKFKKFAARKKWKQSVRLISLCQRL SRSFLSRSNMSVARSD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 MET n 1 4 THR n 1 5 VAL n 1 6 PHE n 1 7 ARG n 1 8 GLN n 1 9 GLU n 1 10 ASN n 1 11 VAL n 1 12 ASP n 1 13 ASP n 1 14 TYR n 1 15 TYR n 1 16 ASP n 1 17 THR n 1 18 GLY n 1 19 GLU n 1 20 GLU n 1 21 LEU n 1 22 GLY n 1 23 SER n 1 24 GLY n 1 25 GLN n 1 26 PHE n 1 27 ALA n 1 28 VAL n 1 29 VAL n 1 30 LYS n 1 31 LYS n 1 32 CYS n 1 33 ARG n 1 34 GLU n 1 35 LYS n 1 36 SER n 1 37 THR n 1 38 GLY n 1 39 LEU n 1 40 GLN n 1 41 TYR n 1 42 ALA n 1 43 ALA n 1 44 LYS n 1 45 PHE n 1 46 ILE n 1 47 LYS n 1 48 LYS n 1 49 ARG n 1 50 ARG n 1 51 THR n 1 52 LYS n 1 53 SER n 1 54 SER n 1 55 ARG n 1 56 ARG n 1 57 GLY n 1 58 VAL n 1 59 SER n 1 60 ARG n 1 61 GLU n 1 62 ASP n 1 63 ILE n 1 64 GLU n 1 65 ARG n 1 66 GLU n 1 67 VAL n 1 68 SER n 1 69 ILE n 1 70 LEU n 1 71 LYS n 1 72 GLU n 1 73 ILE n 1 74 GLN n 1 75 HIS n 1 76 PRO n 1 77 ASN n 1 78 VAL n 1 79 ILE n 1 80 THR n 1 81 LEU n 1 82 HIS n 1 83 GLU n 1 84 VAL n 1 85 TYR n 1 86 GLU n 1 87 ASN n 1 88 LYS n 1 89 THR n 1 90 ASP n 1 91 VAL n 1 92 ILE n 1 93 LEU n 1 94 ILE n 1 95 LEU n 1 96 GLU n 1 97 LEU n 1 98 VAL n 1 99 ALA n 1 100 GLY n 1 101 GLY n 1 102 GLU n 1 103 LEU n 1 104 PHE n 1 105 ASP n 1 106 PHE n 1 107 LEU n 1 108 ALA n 1 109 GLU n 1 110 LYS n 1 111 GLU n 1 112 SER n 1 113 LEU n 1 114 THR n 1 115 GLU n 1 116 GLU n 1 117 GLU n 1 118 ALA n 1 119 THR n 1 120 GLU n 1 121 PHE n 1 122 LEU n 1 123 LYS n 1 124 GLN n 1 125 ILE n 1 126 LEU n 1 127 ASN n 1 128 GLY n 1 129 VAL n 1 130 TYR n 1 131 TYR n 1 132 LEU n 1 133 HIS n 1 134 SER n 1 135 LEU n 1 136 GLN n 1 137 ILE n 1 138 ALA n 1 139 HIS n 1 140 PHE n 1 141 ASP n 1 142 LEU n 1 143 LYS n 1 144 PRO n 1 145 GLU n 1 146 ASN n 1 147 ILE n 1 148 MET n 1 149 LEU n 1 150 LEU n 1 151 ASP n 1 152 ARG n 1 153 ASN n 1 154 VAL n 1 155 PRO n 1 156 LYS n 1 157 PRO n 1 158 ARG n 1 159 ILE n 1 160 LYS n 1 161 ILE n 1 162 ILE n 1 163 ASP n 1 164 PHE n 1 165 GLY n 1 166 LEU n 1 167 ALA n 1 168 HIS n 1 169 LYS n 1 170 ILE n 1 171 ASP n 1 172 PHE n 1 173 GLY n 1 174 ASN n 1 175 GLU n 1 176 PHE n 1 177 LYS n 1 178 ASN n 1 179 ILE n 1 180 PHE n 1 181 GLY n 1 182 THR n 1 183 PRO n 1 184 GLU n 1 185 PHE n 1 186 VAL n 1 187 ALA n 1 188 PRO n 1 189 GLU n 1 190 ILE n 1 191 VAL n 1 192 ASN n 1 193 TYR n 1 194 GLU n 1 195 PRO n 1 196 LEU n 1 197 GLY n 1 198 LEU n 1 199 GLU n 1 200 ALA n 1 201 ASP n 1 202 MET n 1 203 TRP n 1 204 SER n 1 205 ILE n 1 206 GLY n 1 207 VAL n 1 208 ILE n 1 209 THR n 1 210 TYR n 1 211 ILE n 1 212 LEU n 1 213 LEU n 1 214 SER n 1 215 GLY n 1 216 ALA n 1 217 SER n 1 218 PRO n 1 219 PHE n 1 220 LEU n 1 221 GLY n 1 222 ASP n 1 223 THR n 1 224 LYS n 1 225 GLN n 1 226 GLU n 1 227 THR n 1 228 LEU n 1 229 ALA n 1 230 ASN n 1 231 VAL n 1 232 SER n 1 233 ALA n 1 234 VAL n 1 235 ASN n 1 236 TYR n 1 237 GLU n 1 238 PHE n 1 239 GLU n 1 240 ASP n 1 241 GLU n 1 242 TYR n 1 243 PHE n 1 244 SER n 1 245 ASN n 1 246 THR n 1 247 SER n 1 248 ALA n 1 249 LEU n 1 250 ALA n 1 251 LYS n 1 252 ASP n 1 253 PHE n 1 254 ILE n 1 255 ARG n 1 256 ARG n 1 257 LEU n 1 258 LEU n 1 259 VAL n 1 260 LYS n 1 261 ASP n 1 262 PRO n 1 263 LYS n 1 264 LYS n 1 265 ARG n 1 266 MET n 1 267 THR n 1 268 ILE n 1 269 GLN n 1 270 ASP n 1 271 SER n 1 272 LEU n 1 273 GLN n 1 274 HIS n 1 275 PRO n 1 276 TRP n 1 277 ILE n 1 278 LYS n 1 279 PRO n 1 280 LYS n 1 281 ASP n 1 282 THR n 1 283 GLN n 1 284 GLN n 1 285 ALA n 1 286 LEU n 1 287 SER n 1 288 ARG n 1 289 LYS n 1 290 ALA n 1 291 GLU n 1 292 ALA n 1 293 VAL n 1 294 ASN n 1 295 MET n 1 296 GLU n 1 297 LYS n 1 298 PHE n 1 299 LYS n 1 300 LYS n 1 301 PHE n 1 302 ALA n 1 303 ALA n 1 304 ARG n 1 305 LYS n 1 306 LYS n 1 307 TRP n 1 308 LYS n 1 309 GLN n 1 310 SER n 1 311 VAL n 1 312 ARG n 1 313 LEU n 1 314 ILE n 1 315 SER n 1 316 LEU n 1 317 CYS n 1 318 GLN n 1 319 ARG n 1 320 LEU n 1 321 SER n 1 322 ARG n 1 323 SER n 1 324 PHE n 1 325 LEU n 1 326 SER n 1 327 ARG n 1 328 SER n 1 329 ASN n 1 330 MET n 1 331 SER n 1 332 VAL n 1 333 ALA n 1 334 ARG n 1 335 SER n 1 336 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 336 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'DAPK1, DAPK' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DAPK1_HUMAN _struct_ref.pdbx_db_accession P53355 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEIQHPNVITLH EVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKII DFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEY FSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFAARKKWKQSVRLISLCQRLSR SFLSRSNMSVARSD ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4TL0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 336 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P53355 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 334 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 334 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4TL0 GLY A 1 ? UNP P53355 ? ? 'expression tag' -1 1 1 4TL0 PRO A 2 ? UNP P53355 ? ? 'expression tag' 0 2 1 4TL0 GLU A 291 ? UNP P53355 SER 289 'engineered mutation' 289 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 NH4 non-polymer . 'AMMONIUM ION' ? 'H4 N 1' 18.038 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4TL0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.79 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.15 ammonium sulfate, 0.1M TRIS, pH 8.0, 15%(w/v) PEG 4000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-12-15 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.07106 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P13 (MX1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.07106 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P13 (MX1)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL c/o DESY' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4TL0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.700 _reflns.d_resolution_low 63.539 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 12440 _reflns.number_obs 12440 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.800 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.184 _reflns.pdbx_netI_over_av_sigmaI 2.744 _reflns.pdbx_netI_over_sigmaI 11.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.191 _reflns.pdbx_Rpim_I_all 0.053 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 159710 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.700 2.850 ? 0.600 22870 ? ? 1758 ? 99.900 ? ? ? ? 0.836 ? ? ? ? ? ? ? ? 13.000 0.836 ? ? 5.500 ? 0.239 0 1 1 ? ? 2.850 3.020 ? 1.100 22602 ? ? 1695 ? 99.900 ? ? ? ? 0.490 ? ? ? ? ? ? ? ? 13.300 0.490 ? ? 7.200 ? 0.138 0 2 1 ? ? 3.020 3.230 ? 1.600 20576 ? ? 1587 ? 100.000 ? ? ? ? 0.355 ? ? ? ? ? ? ? ? 13.000 0.355 ? ? 8.600 ? 0.102 0 3 1 ? ? 3.230 3.490 ? 2.200 18601 ? ? 1473 ? 99.800 ? ? ? ? 0.257 ? ? ? ? ? ? ? ? 12.600 0.257 ? ? 10.400 ? 0.075 0 4 1 ? ? 3.490 3.820 ? 2.500 18448 ? ? 1382 ? 100.000 ? ? ? ? 0.203 ? ? ? ? ? ? ? ? 13.300 0.203 ? ? 13.100 ? 0.058 0 5 1 ? ? 3.820 4.270 ? 3.300 15986 ? ? 1254 ? 100.000 ? ? ? ? 0.162 ? ? ? ? ? ? ? ? 12.700 0.162 ? ? 15.000 ? 0.047 0 6 1 ? ? 4.270 4.930 ? 3.800 14175 ? ? 1113 ? 99.900 ? ? ? ? 0.133 ? ? ? ? ? ? ? ? 12.700 0.133 ? ? 16.500 ? 0.039 0 7 1 ? ? 4.930 6.040 ? 4.900 12325 ? ? 962 ? 100.000 ? ? ? ? 0.110 ? ? ? ? ? ? ? ? 12.800 0.110 ? ? 15.400 ? 0.032 0 8 1 ? ? 6.040 8.540 ? 8.600 9178 ? ? 765 ? 99.900 ? ? ? ? 0.077 ? ? ? ? ? ? ? ? 12.000 0.077 ? ? 15.400 ? 0.023 0 9 1 ? ? 8.540 77.794 ? 9.200 4949 ? ? 451 ? 98.400 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? 11.000 0.065 ? ? 16.300 ? 0.021 0 10 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 164.490 _refine.B_iso_mean 45.7100 _refine.B_iso_min 10.440 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4TL0 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7000 _refine.ls_d_res_low 63.5390 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12337 _refine.ls_number_reflns_R_free 599 _refine.ls_number_reflns_R_work 11738 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.3000 _refine.ls_percent_reflns_R_free 4.8600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1703 _refine.ls_R_factor_R_free 0.2178 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1678 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 2W4K' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.7400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.8584 # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.7000 _refine_hist.d_res_low 63.5390 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 34 _refine_hist.number_atoms_total 2455 _refine_hist.pdbx_number_residues_total 300 _refine_hist.pdbx_B_iso_mean_ligand 52.21 _refine_hist.pdbx_B_iso_mean_solvent 39.65 _refine_hist.pdbx_number_atoms_protein 2401 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 2459 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.697 ? 3317 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.029 ? 368 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 428 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.282 ? 921 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error 'X-RAY DIFFRACTION' 2.700 2.9718 3034 . 149 2885 100.0000 . . . 0.2489 . 0.1862 . . . . . . 4 . 'X-RAY DIFFRACTION' 2.9718 3.4018 3031 . 143 2888 100.0000 . . . 0.2523 . 0.1878 . . . . . . 4 . 'X-RAY DIFFRACTION' 3.4018 4.2858 3061 . 158 2903 99.0000 . . . 0.2407 . 0.1581 . . . . . . 4 . 'X-RAY DIFFRACTION' 4.2858 63.5564 3211 . 149 3062 99.0000 . . . 0.1743 . 0.1607 . . . . . . 4 . # _struct.entry_id 4TL0 _struct.title 'Crystal structure of death-associated protein kinase 1 with a crucial phosphomimicking mutation' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4TL0 _struct_keywords.text 'kinase, death-associated, Calmodulin binding, activation mutant, phosphomimicking mutant, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 4 ? H N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 10 ? TYR A 14 ? ASN A 8 TYR A 12 1 ? 5 HELX_P HELX_P2 AA2 SER A 59 ? ILE A 73 ? SER A 57 ILE A 71 1 ? 15 HELX_P HELX_P3 AA3 GLU A 102 ? LEU A 107 ? GLU A 100 LEU A 105 1 ? 6 HELX_P HELX_P4 AA4 ALA A 108 ? LYS A 110 ? ALA A 106 LYS A 108 5 ? 3 HELX_P HELX_P5 AA5 GLU A 115 ? LEU A 135 ? GLU A 113 LEU A 133 1 ? 21 HELX_P HELX_P6 AA6 LYS A 143 ? GLU A 145 ? LYS A 141 GLU A 143 5 ? 3 HELX_P HELX_P7 AA7 ALA A 187 ? ASN A 192 ? ALA A 185 ASN A 190 1 ? 6 HELX_P HELX_P8 AA8 LEU A 198 ? GLY A 215 ? LEU A 196 GLY A 213 1 ? 18 HELX_P HELX_P9 AA9 THR A 223 ? VAL A 234 ? THR A 221 VAL A 232 1 ? 12 HELX_P HELX_P10 AB1 SER A 247 ? ARG A 256 ? SER A 245 ARG A 254 1 ? 10 HELX_P HELX_P11 AB2 ASP A 261 ? ARG A 265 ? ASP A 259 ARG A 263 5 ? 5 HELX_P HELX_P12 AB3 THR A 267 ? LEU A 272 ? THR A 265 LEU A 270 1 ? 6 HELX_P HELX_P13 AB4 GLN A 283 ? GLU A 291 ? GLN A 281 GLU A 289 1 ? 9 HELX_P HELX_P14 AB5 ASN A 294 ? ALA A 303 ? ASN A 292 ALA A 301 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 66 OE2 ? ? ? 1_555 B MG . MG ? ? A GLU 64 A MG 401 1_555 ? ? ? ? ? ? ? 2.686 ? ? metalc2 metalc ? ? B MG . MG ? ? ? 1_555 H HOH . O ? ? A MG 401 A HOH 526 1_555 ? ? ? ? ? ? ? 2.487 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 15 ? SER A 23 ? TYR A 13 SER A 21 AA1 2 ALA A 27 ? GLU A 34 ? ALA A 25 GLU A 32 AA1 3 GLN A 40 ? LYS A 47 ? GLN A 38 LYS A 45 AA1 4 ASP A 90 ? GLU A 96 ? ASP A 88 GLU A 94 AA1 5 LEU A 81 ? GLU A 86 ? LEU A 79 GLU A 84 AA2 1 LEU A 113 ? THR A 114 ? LEU A 111 THR A 112 AA2 2 ALA A 292 ? VAL A 293 ? ALA A 290 VAL A 291 AA3 1 ILE A 137 ? ALA A 138 ? ILE A 135 ALA A 136 AA3 2 HIS A 168 ? LYS A 169 ? HIS A 166 LYS A 167 AA4 1 ILE A 147 ? LEU A 149 ? ILE A 145 LEU A 147 AA4 2 ILE A 159 ? ILE A 161 ? ILE A 157 ILE A 159 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 18 ? N GLY A 16 O LYS A 31 ? O LYS A 29 AA1 2 3 N LYS A 30 ? N LYS A 28 O ALA A 43 ? O ALA A 41 AA1 3 4 N ALA A 42 ? N ALA A 40 O LEU A 95 ? O LEU A 93 AA1 4 5 O ILE A 92 ? O ILE A 90 N TYR A 85 ? N TYR A 83 AA2 1 2 N LEU A 113 ? N LEU A 111 O VAL A 293 ? O VAL A 291 AA3 1 2 N ALA A 138 ? N ALA A 136 O HIS A 168 ? O HIS A 166 AA4 1 2 N MET A 148 ? N MET A 146 O LYS A 160 ? O LYS A 158 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 401 ? 5 'binding site for residue MG A 401' AC2 Software A NH4 402 ? 1 'binding site for residue NH4 A 402' AC3 Software A NH4 403 ? 2 'binding site for residue NH4 A 403' AC4 Software A GOL 405 ? 6 'binding site for residue GOL A 405' AC5 Software A GOL 406 ? 7 'binding site for residue GOL A 406' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 LYS A 44 ? LYS A 42 . ? 1_555 ? 2 AC1 5 GLU A 66 ? GLU A 64 . ? 1_555 ? 3 AC1 5 ASP A 163 ? ASP A 161 . ? 1_555 ? 4 AC1 5 PHE A 164 ? PHE A 162 . ? 1_555 ? 5 AC1 5 HOH H . ? HOH A 526 . ? 1_555 ? 6 AC2 1 GLU A 175 ? GLU A 173 . ? 1_555 ? 7 AC3 2 THR A 51 ? THR A 49 . ? 3_654 ? 8 AC3 2 ASN A 235 ? ASN A 233 . ? 1_555 ? 9 AC4 6 GLN A 40 ? GLN A 38 . ? 1_555 ? 10 AC4 6 TYR A 41 ? TYR A 39 . ? 1_555 ? 11 AC4 6 GLU A 96 ? GLU A 94 . ? 1_555 ? 12 AC4 6 LEU A 97 ? LEU A 95 . ? 1_555 ? 13 AC4 6 SER A 134 ? SER A 132 . ? 4_445 ? 14 AC4 6 HOH H . ? HOH A 523 . ? 1_555 ? 15 AC5 7 HIS A 133 ? HIS A 131 . ? 1_555 ? 16 AC5 7 LEU A 198 ? LEU A 196 . ? 1_555 ? 17 AC5 7 GLU A 199 ? GLU A 197 . ? 1_555 ? 18 AC5 7 MET A 202 ? MET A 200 . ? 1_555 ? 19 AC5 7 THR A 267 ? THR A 265 . ? 1_555 ? 20 AC5 7 ILE A 268 ? ILE A 266 . ? 1_555 ? 21 AC5 7 GLN A 269 ? GLN A 267 . ? 1_555 ? # _atom_sites.entry_id 4TL0 _atom_sites.fract_transf_matrix[1][1] 0.019865 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012854 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009081 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 PRO 2 0 ? ? ? A . n A 1 3 MET 3 1 ? ? ? A . n A 1 4 THR 4 2 2 THR THR A . n A 1 5 VAL 5 3 3 VAL VAL A . n A 1 6 PHE 6 4 4 PHE PHE A . n A 1 7 ARG 7 5 5 ARG ARG A . n A 1 8 GLN 8 6 6 GLN GLN A . n A 1 9 GLU 9 7 7 GLU GLU A . n A 1 10 ASN 10 8 8 ASN ASN A . n A 1 11 VAL 11 9 9 VAL VAL A . n A 1 12 ASP 12 10 10 ASP ASP A . n A 1 13 ASP 13 11 11 ASP ASP A . n A 1 14 TYR 14 12 12 TYR TYR A . n A 1 15 TYR 15 13 13 TYR TYR A . n A 1 16 ASP 16 14 14 ASP ASP A . n A 1 17 THR 17 15 15 THR THR A . n A 1 18 GLY 18 16 16 GLY GLY A . n A 1 19 GLU 19 17 17 GLU GLU A . n A 1 20 GLU 20 18 18 GLU GLU A . n A 1 21 LEU 21 19 19 LEU LEU A . n A 1 22 GLY 22 20 20 GLY GLY A . n A 1 23 SER 23 21 21 SER SER A . n A 1 24 GLY 24 22 22 GLY GLY A . n A 1 25 GLN 25 23 23 GLN GLN A . n A 1 26 PHE 26 24 24 PHE PHE A . n A 1 27 ALA 27 25 25 ALA ALA A . n A 1 28 VAL 28 26 26 VAL VAL A . n A 1 29 VAL 29 27 27 VAL VAL A . n A 1 30 LYS 30 28 28 LYS LYS A . n A 1 31 LYS 31 29 29 LYS LYS A . n A 1 32 CYS 32 30 30 CYS CYS A . n A 1 33 ARG 33 31 31 ARG ARG A . n A 1 34 GLU 34 32 32 GLU GLU A . n A 1 35 LYS 35 33 33 LYS LYS A . n A 1 36 SER 36 34 34 SER SER A . n A 1 37 THR 37 35 35 THR THR A . n A 1 38 GLY 38 36 36 GLY GLY A . n A 1 39 LEU 39 37 37 LEU LEU A . n A 1 40 GLN 40 38 38 GLN GLN A . n A 1 41 TYR 41 39 39 TYR TYR A . n A 1 42 ALA 42 40 40 ALA ALA A . n A 1 43 ALA 43 41 41 ALA ALA A . n A 1 44 LYS 44 42 42 LYS LYS A . n A 1 45 PHE 45 43 43 PHE PHE A . n A 1 46 ILE 46 44 44 ILE ILE A . n A 1 47 LYS 47 45 45 LYS LYS A . n A 1 48 LYS 48 46 46 LYS LYS A . n A 1 49 ARG 49 47 47 ARG ARG A . n A 1 50 ARG 50 48 48 ARG ARG A . n A 1 51 THR 51 49 49 THR THR A . n A 1 52 LYS 52 50 50 LYS LYS A . n A 1 53 SER 53 51 51 SER SER A . n A 1 54 SER 54 52 52 SER SER A . n A 1 55 ARG 55 53 53 ARG ARG A . n A 1 56 ARG 56 54 54 ARG ARG A . n A 1 57 GLY 57 55 55 GLY GLY A . n A 1 58 VAL 58 56 56 VAL VAL A . n A 1 59 SER 59 57 57 SER SER A . n A 1 60 ARG 60 58 58 ARG ARG A . n A 1 61 GLU 61 59 59 GLU GLU A . n A 1 62 ASP 62 60 60 ASP ASP A . n A 1 63 ILE 63 61 61 ILE ILE A . n A 1 64 GLU 64 62 62 GLU GLU A . n A 1 65 ARG 65 63 63 ARG ARG A . n A 1 66 GLU 66 64 64 GLU GLU A . n A 1 67 VAL 67 65 65 VAL VAL A . n A 1 68 SER 68 66 66 SER SER A . n A 1 69 ILE 69 67 67 ILE ILE A . n A 1 70 LEU 70 68 68 LEU LEU A . n A 1 71 LYS 71 69 69 LYS LYS A . n A 1 72 GLU 72 70 70 GLU GLU A . n A 1 73 ILE 73 71 71 ILE ILE A . n A 1 74 GLN 74 72 72 GLN GLN A . n A 1 75 HIS 75 73 73 HIS HIS A . n A 1 76 PRO 76 74 74 PRO PRO A . n A 1 77 ASN 77 75 75 ASN ASN A . n A 1 78 VAL 78 76 76 VAL VAL A . n A 1 79 ILE 79 77 77 ILE ILE A . n A 1 80 THR 80 78 78 THR THR A . n A 1 81 LEU 81 79 79 LEU LEU A . n A 1 82 HIS 82 80 80 HIS HIS A . n A 1 83 GLU 83 81 81 GLU GLU A . n A 1 84 VAL 84 82 82 VAL VAL A . n A 1 85 TYR 85 83 83 TYR TYR A . n A 1 86 GLU 86 84 84 GLU GLU A . n A 1 87 ASN 87 85 85 ASN ASN A . n A 1 88 LYS 88 86 86 LYS LYS A . n A 1 89 THR 89 87 87 THR THR A . n A 1 90 ASP 90 88 88 ASP ASP A . n A 1 91 VAL 91 89 89 VAL VAL A . n A 1 92 ILE 92 90 90 ILE ILE A . n A 1 93 LEU 93 91 91 LEU LEU A . n A 1 94 ILE 94 92 92 ILE ILE A . n A 1 95 LEU 95 93 93 LEU LEU A . n A 1 96 GLU 96 94 94 GLU GLU A . n A 1 97 LEU 97 95 95 LEU LEU A . n A 1 98 VAL 98 96 96 VAL VAL A . n A 1 99 ALA 99 97 97 ALA ALA A . n A 1 100 GLY 100 98 98 GLY GLY A . n A 1 101 GLY 101 99 99 GLY GLY A . n A 1 102 GLU 102 100 100 GLU GLU A . n A 1 103 LEU 103 101 101 LEU LEU A . n A 1 104 PHE 104 102 102 PHE PHE A . n A 1 105 ASP 105 103 103 ASP ASP A . n A 1 106 PHE 106 104 104 PHE PHE A . n A 1 107 LEU 107 105 105 LEU LEU A . n A 1 108 ALA 108 106 106 ALA ALA A . n A 1 109 GLU 109 107 107 GLU GLU A . n A 1 110 LYS 110 108 108 LYS LYS A . n A 1 111 GLU 111 109 109 GLU GLU A . n A 1 112 SER 112 110 110 SER SER A . n A 1 113 LEU 113 111 111 LEU LEU A . n A 1 114 THR 114 112 112 THR THR A . n A 1 115 GLU 115 113 113 GLU GLU A . n A 1 116 GLU 116 114 114 GLU GLU A . n A 1 117 GLU 117 115 115 GLU GLU A . n A 1 118 ALA 118 116 116 ALA ALA A . n A 1 119 THR 119 117 117 THR THR A . n A 1 120 GLU 120 118 118 GLU GLU A . n A 1 121 PHE 121 119 119 PHE PHE A . n A 1 122 LEU 122 120 120 LEU LEU A . n A 1 123 LYS 123 121 121 LYS LYS A . n A 1 124 GLN 124 122 122 GLN GLN A . n A 1 125 ILE 125 123 123 ILE ILE A . n A 1 126 LEU 126 124 124 LEU LEU A . n A 1 127 ASN 127 125 125 ASN ASN A . n A 1 128 GLY 128 126 126 GLY GLY A . n A 1 129 VAL 129 127 127 VAL VAL A . n A 1 130 TYR 130 128 128 TYR TYR A . n A 1 131 TYR 131 129 129 TYR TYR A . n A 1 132 LEU 132 130 130 LEU LEU A . n A 1 133 HIS 133 131 131 HIS HIS A . n A 1 134 SER 134 132 132 SER SER A . n A 1 135 LEU 135 133 133 LEU LEU A . n A 1 136 GLN 136 134 134 GLN GLN A . n A 1 137 ILE 137 135 135 ILE ILE A . n A 1 138 ALA 138 136 136 ALA ALA A . n A 1 139 HIS 139 137 137 HIS HIS A . n A 1 140 PHE 140 138 138 PHE PHE A . n A 1 141 ASP 141 139 139 ASP ASP A . n A 1 142 LEU 142 140 140 LEU LEU A . n A 1 143 LYS 143 141 141 LYS LYS A . n A 1 144 PRO 144 142 142 PRO PRO A . n A 1 145 GLU 145 143 143 GLU GLU A . n A 1 146 ASN 146 144 144 ASN ASN A . n A 1 147 ILE 147 145 145 ILE ILE A . n A 1 148 MET 148 146 146 MET MET A . n A 1 149 LEU 149 147 147 LEU LEU A . n A 1 150 LEU 150 148 148 LEU LEU A . n A 1 151 ASP 151 149 149 ASP ASP A . n A 1 152 ARG 152 150 150 ARG ARG A . n A 1 153 ASN 153 151 151 ASN ASN A . n A 1 154 VAL 154 152 152 VAL VAL A . n A 1 155 PRO 155 153 153 PRO PRO A . n A 1 156 LYS 156 154 154 LYS LYS A . n A 1 157 PRO 157 155 155 PRO PRO A . n A 1 158 ARG 158 156 156 ARG ARG A . n A 1 159 ILE 159 157 157 ILE ILE A . n A 1 160 LYS 160 158 158 LYS LYS A . n A 1 161 ILE 161 159 159 ILE ILE A . n A 1 162 ILE 162 160 160 ILE ILE A . n A 1 163 ASP 163 161 161 ASP ASP A . n A 1 164 PHE 164 162 162 PHE PHE A . n A 1 165 GLY 165 163 163 GLY GLY A . n A 1 166 LEU 166 164 164 LEU LEU A . n A 1 167 ALA 167 165 165 ALA ALA A . n A 1 168 HIS 168 166 166 HIS HIS A . n A 1 169 LYS 169 167 167 LYS LYS A . n A 1 170 ILE 170 168 168 ILE ILE A . n A 1 171 ASP 171 169 169 ASP ASP A . n A 1 172 PHE 172 170 170 PHE PHE A . n A 1 173 GLY 173 171 171 GLY GLY A . n A 1 174 ASN 174 172 172 ASN ASN A . n A 1 175 GLU 175 173 173 GLU GLU A . n A 1 176 PHE 176 174 174 PHE PHE A . n A 1 177 LYS 177 175 175 LYS LYS A . n A 1 178 ASN 178 176 176 ASN ASN A . n A 1 179 ILE 179 177 177 ILE ILE A . n A 1 180 PHE 180 178 178 PHE PHE A . n A 1 181 GLY 181 179 179 GLY GLY A . n A 1 182 THR 182 180 180 THR THR A . n A 1 183 PRO 183 181 181 PRO PRO A . n A 1 184 GLU 184 182 182 GLU GLU A . n A 1 185 PHE 185 183 183 PHE PHE A . n A 1 186 VAL 186 184 184 VAL VAL A . n A 1 187 ALA 187 185 185 ALA ALA A . n A 1 188 PRO 188 186 186 PRO PRO A . n A 1 189 GLU 189 187 187 GLU GLU A . n A 1 190 ILE 190 188 188 ILE ILE A . n A 1 191 VAL 191 189 189 VAL VAL A . n A 1 192 ASN 192 190 190 ASN ASN A . n A 1 193 TYR 193 191 191 TYR TYR A . n A 1 194 GLU 194 192 192 GLU GLU A . n A 1 195 PRO 195 193 193 PRO PRO A . n A 1 196 LEU 196 194 194 LEU LEU A . n A 1 197 GLY 197 195 195 GLY GLY A . n A 1 198 LEU 198 196 196 LEU LEU A . n A 1 199 GLU 199 197 197 GLU GLU A . n A 1 200 ALA 200 198 198 ALA ALA A . n A 1 201 ASP 201 199 199 ASP ASP A . n A 1 202 MET 202 200 200 MET MET A . n A 1 203 TRP 203 201 201 TRP TRP A . n A 1 204 SER 204 202 202 SER SER A . n A 1 205 ILE 205 203 203 ILE ILE A . n A 1 206 GLY 206 204 204 GLY GLY A . n A 1 207 VAL 207 205 205 VAL VAL A . n A 1 208 ILE 208 206 206 ILE ILE A . n A 1 209 THR 209 207 207 THR THR A . n A 1 210 TYR 210 208 208 TYR TYR A . n A 1 211 ILE 211 209 209 ILE ILE A . n A 1 212 LEU 212 210 210 LEU LEU A . n A 1 213 LEU 213 211 211 LEU LEU A . n A 1 214 SER 214 212 212 SER SER A . n A 1 215 GLY 215 213 213 GLY GLY A . n A 1 216 ALA 216 214 214 ALA ALA A . n A 1 217 SER 217 215 215 SER SER A . n A 1 218 PRO 218 216 216 PRO PRO A . n A 1 219 PHE 219 217 217 PHE PHE A . n A 1 220 LEU 220 218 218 LEU LEU A . n A 1 221 GLY 221 219 219 GLY GLY A . n A 1 222 ASP 222 220 220 ASP ASP A . n A 1 223 THR 223 221 221 THR THR A . n A 1 224 LYS 224 222 222 LYS LYS A . n A 1 225 GLN 225 223 223 GLN GLN A . n A 1 226 GLU 226 224 224 GLU GLU A . n A 1 227 THR 227 225 225 THR THR A . n A 1 228 LEU 228 226 226 LEU LEU A . n A 1 229 ALA 229 227 227 ALA ALA A . n A 1 230 ASN 230 228 228 ASN ASN A . n A 1 231 VAL 231 229 229 VAL VAL A . n A 1 232 SER 232 230 230 SER SER A . n A 1 233 ALA 233 231 231 ALA ALA A . n A 1 234 VAL 234 232 232 VAL VAL A . n A 1 235 ASN 235 233 233 ASN ASN A . n A 1 236 TYR 236 234 234 TYR TYR A . n A 1 237 GLU 237 235 235 GLU GLU A . n A 1 238 PHE 238 236 236 PHE PHE A . n A 1 239 GLU 239 237 237 GLU GLU A . n A 1 240 ASP 240 238 238 ASP ASP A . n A 1 241 GLU 241 239 239 GLU GLU A . n A 1 242 TYR 242 240 240 TYR TYR A . n A 1 243 PHE 243 241 241 PHE PHE A . n A 1 244 SER 244 242 242 SER SER A . n A 1 245 ASN 245 243 243 ASN ASN A . n A 1 246 THR 246 244 244 THR THR A . n A 1 247 SER 247 245 245 SER SER A . n A 1 248 ALA 248 246 246 ALA ALA A . n A 1 249 LEU 249 247 247 LEU LEU A . n A 1 250 ALA 250 248 248 ALA ALA A . n A 1 251 LYS 251 249 249 LYS LYS A . n A 1 252 ASP 252 250 250 ASP ASP A . n A 1 253 PHE 253 251 251 PHE PHE A . n A 1 254 ILE 254 252 252 ILE ILE A . n A 1 255 ARG 255 253 253 ARG ARG A . n A 1 256 ARG 256 254 254 ARG ARG A . n A 1 257 LEU 257 255 255 LEU LEU A . n A 1 258 LEU 258 256 256 LEU LEU A . n A 1 259 VAL 259 257 257 VAL VAL A . n A 1 260 LYS 260 258 258 LYS LYS A . n A 1 261 ASP 261 259 259 ASP ASP A . n A 1 262 PRO 262 260 260 PRO PRO A . n A 1 263 LYS 263 261 261 LYS LYS A . n A 1 264 LYS 264 262 262 LYS LYS A . n A 1 265 ARG 265 263 263 ARG ARG A . n A 1 266 MET 266 264 264 MET MET A . n A 1 267 THR 267 265 265 THR THR A . n A 1 268 ILE 268 266 266 ILE ILE A . n A 1 269 GLN 269 267 267 GLN GLN A . n A 1 270 ASP 270 268 268 ASP ASP A . n A 1 271 SER 271 269 269 SER SER A . n A 1 272 LEU 272 270 270 LEU LEU A . n A 1 273 GLN 273 271 271 GLN GLN A . n A 1 274 HIS 274 272 272 HIS HIS A . n A 1 275 PRO 275 273 273 PRO PRO A . n A 1 276 TRP 276 274 274 TRP TRP A . n A 1 277 ILE 277 275 275 ILE ILE A . n A 1 278 LYS 278 276 276 LYS LYS A . n A 1 279 PRO 279 277 277 PRO PRO A . n A 1 280 LYS 280 278 278 LYS LYS A . n A 1 281 ASP 281 279 279 ASP ASP A . n A 1 282 THR 282 280 280 THR THR A . n A 1 283 GLN 283 281 281 GLN GLN A . n A 1 284 GLN 284 282 282 GLN GLN A . n A 1 285 ALA 285 283 283 ALA ALA A . n A 1 286 LEU 286 284 284 LEU LEU A . n A 1 287 SER 287 285 285 SER SER A . n A 1 288 ARG 288 286 286 ARG ARG A . n A 1 289 LYS 289 287 287 LYS LYS A . n A 1 290 ALA 290 288 288 ALA ALA A . n A 1 291 GLU 291 289 289 GLU GLU A . n A 1 292 ALA 292 290 290 ALA ALA A . n A 1 293 VAL 293 291 291 VAL VAL A . n A 1 294 ASN 294 292 292 ASN ASN A . n A 1 295 MET 295 293 293 MET MET A . n A 1 296 GLU 296 294 294 GLU GLU A . n A 1 297 LYS 297 295 295 LYS LYS A . n A 1 298 PHE 298 296 296 PHE PHE A . n A 1 299 LYS 299 297 297 LYS LYS A . n A 1 300 LYS 300 298 298 LYS LYS A . n A 1 301 PHE 301 299 299 PHE PHE A . n A 1 302 ALA 302 300 300 ALA ALA A . n A 1 303 ALA 303 301 301 ALA ALA A . n A 1 304 ARG 304 302 ? ? ? A . n A 1 305 LYS 305 303 ? ? ? A . n A 1 306 LYS 306 304 ? ? ? A . n A 1 307 TRP 307 305 ? ? ? A . n A 1 308 LYS 308 306 ? ? ? A . n A 1 309 GLN 309 307 ? ? ? A . n A 1 310 SER 310 308 ? ? ? A . n A 1 311 VAL 311 309 ? ? ? A . n A 1 312 ARG 312 310 ? ? ? A . n A 1 313 LEU 313 311 ? ? ? A . n A 1 314 ILE 314 312 ? ? ? A . n A 1 315 SER 315 313 ? ? ? A . n A 1 316 LEU 316 314 ? ? ? A . n A 1 317 CYS 317 315 ? ? ? A . n A 1 318 GLN 318 316 ? ? ? A . n A 1 319 ARG 319 317 ? ? ? A . n A 1 320 LEU 320 318 ? ? ? A . n A 1 321 SER 321 319 ? ? ? A . n A 1 322 ARG 322 320 ? ? ? A . n A 1 323 SER 323 321 ? ? ? A . n A 1 324 PHE 324 322 ? ? ? A . n A 1 325 LEU 325 323 ? ? ? A . n A 1 326 SER 326 324 ? ? ? A . n A 1 327 ARG 327 325 ? ? ? A . n A 1 328 SER 328 326 ? ? ? A . n A 1 329 ASN 329 327 ? ? ? A . n A 1 330 MET 330 328 ? ? ? A . n A 1 331 SER 331 329 ? ? ? A . n A 1 332 VAL 332 330 ? ? ? A . n A 1 333 ALA 333 331 ? ? ? A . n A 1 334 ARG 334 332 ? ? ? A . n A 1 335 SER 335 333 ? ? ? A . n A 1 336 ASP 336 334 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 401 1 MG MG A . C 3 NH4 1 402 1 NH4 NH4 A . D 3 NH4 1 403 4 NH4 NH4 A . E 3 NH4 1 404 5 NH4 NH4 A . F 4 GOL 1 405 1 GOL GOL A . G 4 GOL 1 406 2 GOL GOL A . H 5 HOH 1 501 12 HOH HOH A . H 5 HOH 2 502 35 HOH HOH A . H 5 HOH 3 503 28 HOH HOH A . H 5 HOH 4 504 1 HOH HOH A . H 5 HOH 5 505 2 HOH HOH A . H 5 HOH 6 506 3 HOH HOH A . H 5 HOH 7 507 4 HOH HOH A . H 5 HOH 8 508 5 HOH HOH A . H 5 HOH 9 509 6 HOH HOH A . H 5 HOH 10 510 7 HOH HOH A . H 5 HOH 11 511 8 HOH HOH A . H 5 HOH 12 512 9 HOH HOH A . H 5 HOH 13 513 10 HOH HOH A . H 5 HOH 14 514 11 HOH HOH A . H 5 HOH 15 515 13 HOH HOH A . H 5 HOH 16 516 14 HOH HOH A . H 5 HOH 17 517 15 HOH HOH A . H 5 HOH 18 518 16 HOH HOH A . H 5 HOH 19 519 17 HOH HOH A . H 5 HOH 20 520 18 HOH HOH A . H 5 HOH 21 521 19 HOH HOH A . H 5 HOH 22 522 20 HOH HOH A . H 5 HOH 23 523 21 HOH HOH A . H 5 HOH 24 524 22 HOH HOH A . H 5 HOH 25 525 23 HOH HOH A . H 5 HOH 26 526 24 HOH HOH A . H 5 HOH 27 527 26 HOH HOH A . H 5 HOH 28 528 27 HOH HOH A . H 5 HOH 29 529 30 HOH HOH A . H 5 HOH 30 530 31 HOH HOH A . H 5 HOH 31 531 32 HOH HOH A . H 5 HOH 32 532 33 HOH HOH A . H 5 HOH 33 533 34 HOH HOH A . H 5 HOH 34 534 36 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id OE2 _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id GLU _pdbx_struct_conn_angle.ptnr1_label_seq_id 66 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id GLU _pdbx_struct_conn_angle.ptnr1_auth_seq_id 64 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id MG _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id B _pdbx_struct_conn_angle.ptnr2_label_comp_id MG _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id MG _pdbx_struct_conn_angle.ptnr2_auth_seq_id 401 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id O _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id H _pdbx_struct_conn_angle.ptnr3_label_comp_id HOH _pdbx_struct_conn_angle.ptnr3_label_seq_id . _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id HOH _pdbx_struct_conn_angle.ptnr3_auth_seq_id 526 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 142.0 _pdbx_struct_conn_angle.value_esd ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-06-10 2 'Structure model' 1 1 2017-11-22 3 'Structure model' 1 2 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' Other 5 2 'Structure model' 'Refinement description' 6 2 'Structure model' 'Source and taxonomy' 7 3 'Structure model' 'Data collection' 8 3 'Structure model' 'Database references' 9 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' diffrn_source 3 2 'Structure model' entity_src_gen 4 2 'Structure model' pdbx_database_status 5 2 'Structure model' pdbx_struct_oper_list 6 2 'Structure model' software 7 3 'Structure model' chem_comp_atom 8 3 'Structure model' chem_comp_bond 9 3 'Structure model' database_2 10 3 'Structure model' pdbx_initial_refinement_model 11 3 'Structure model' refine_hist # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_id_CSD' 2 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 3 2 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 4 2 'Structure model' '_pdbx_database_status.pdb_format_compatible' 5 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_database_2.pdbx_database_accession' 8 3 'Structure model' '_refine_hist.pdbx_number_atoms_nucleic_acid' 9 3 'Structure model' '_refine_hist.pdbx_number_atoms_protein' # _pdbx_phasing_MR.entry_id 4TL0 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 63.540 _pdbx_phasing_MR.d_res_low_rotation 3.060 _pdbx_phasing_MR.d_res_high_translation ? _pdbx_phasing_MR.d_res_low_translation ? _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.20 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? 11.0.05 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.14 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.8.4_1496)' 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 507 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 534 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.05 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 48 ? ? 64.78 -44.20 2 1 ASN A 85 ? ? -125.50 -159.51 3 1 ASP A 139 ? ? -153.17 41.04 4 1 ASN A 151 ? ? -107.44 63.42 5 1 ASP A 161 ? ? 60.49 86.95 6 1 THR A 280 ? ? 51.18 -132.07 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 109 ? CG ? A GLU 111 CG 2 1 Y 1 A GLU 109 ? CD ? A GLU 111 CD 3 1 Y 1 A GLU 109 ? OE1 ? A GLU 111 OE1 4 1 Y 1 A GLU 109 ? OE2 ? A GLU 111 OE2 5 1 Y 1 A ASP 279 ? CG ? A ASP 281 CG 6 1 Y 1 A ASP 279 ? OD1 ? A ASP 281 OD1 7 1 Y 1 A ASP 279 ? OD2 ? A ASP 281 OD2 8 1 Y 1 A THR 280 ? OG1 ? A THR 282 OG1 9 1 Y 1 A THR 280 ? CG2 ? A THR 282 CG2 10 1 Y 1 A GLN 281 ? CG ? A GLN 283 CG 11 1 Y 1 A GLN 281 ? CD ? A GLN 283 CD 12 1 Y 1 A GLN 281 ? OE1 ? A GLN 283 OE1 13 1 Y 1 A GLN 281 ? NE2 ? A GLN 283 NE2 14 1 Y 1 A LEU 284 ? CG ? A LEU 286 CG 15 1 Y 1 A LEU 284 ? CD1 ? A LEU 286 CD1 16 1 Y 1 A LEU 284 ? CD2 ? A LEU 286 CD2 17 1 Y 1 A LYS 287 ? CG ? A LYS 289 CG 18 1 Y 1 A LYS 287 ? CD ? A LYS 289 CD 19 1 Y 1 A LYS 287 ? CE ? A LYS 289 CE 20 1 Y 1 A LYS 287 ? NZ ? A LYS 289 NZ 21 1 Y 1 A LYS 295 ? CG ? A LYS 297 CG 22 1 Y 1 A LYS 295 ? CD ? A LYS 297 CD 23 1 Y 1 A LYS 295 ? CE ? A LYS 297 CE 24 1 Y 1 A LYS 295 ? NZ ? A LYS 297 NZ 25 1 Y 1 A LYS 298 ? CG ? A LYS 300 CG 26 1 Y 1 A LYS 298 ? CD ? A LYS 300 CD 27 1 Y 1 A LYS 298 ? CE ? A LYS 300 CE 28 1 Y 1 A LYS 298 ? NZ ? A LYS 300 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A PRO 0 ? A PRO 2 3 1 Y 1 A MET 1 ? A MET 3 4 1 Y 1 A ARG 302 ? A ARG 304 5 1 Y 1 A LYS 303 ? A LYS 305 6 1 Y 1 A LYS 304 ? A LYS 306 7 1 Y 1 A TRP 305 ? A TRP 307 8 1 Y 1 A LYS 306 ? A LYS 308 9 1 Y 1 A GLN 307 ? A GLN 309 10 1 Y 1 A SER 308 ? A SER 310 11 1 Y 1 A VAL 309 ? A VAL 311 12 1 Y 1 A ARG 310 ? A ARG 312 13 1 Y 1 A LEU 311 ? A LEU 313 14 1 Y 1 A ILE 312 ? A ILE 314 15 1 Y 1 A SER 313 ? A SER 315 16 1 Y 1 A LEU 314 ? A LEU 316 17 1 Y 1 A CYS 315 ? A CYS 317 18 1 Y 1 A GLN 316 ? A GLN 318 19 1 Y 1 A ARG 317 ? A ARG 319 20 1 Y 1 A LEU 318 ? A LEU 320 21 1 Y 1 A SER 319 ? A SER 321 22 1 Y 1 A ARG 320 ? A ARG 322 23 1 Y 1 A SER 321 ? A SER 323 24 1 Y 1 A PHE 322 ? A PHE 324 25 1 Y 1 A LEU 323 ? A LEU 325 26 1 Y 1 A SER 324 ? A SER 326 27 1 Y 1 A ARG 325 ? A ARG 327 28 1 Y 1 A SER 326 ? A SER 328 29 1 Y 1 A ASN 327 ? A ASN 329 30 1 Y 1 A MET 328 ? A MET 330 31 1 Y 1 A SER 329 ? A SER 331 32 1 Y 1 A VAL 330 ? A VAL 332 33 1 Y 1 A ALA 331 ? A ALA 333 34 1 Y 1 A ARG 332 ? A ARG 334 35 1 Y 1 A SER 333 ? A SER 335 36 1 Y 1 A ASP 334 ? A ASP 336 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MET N N N N 244 MET CA C N S 245 MET C C N N 246 MET O O N N 247 MET CB C N N 248 MET CG C N N 249 MET SD S N N 250 MET CE C N N 251 MET OXT O N N 252 MET H H N N 253 MET H2 H N N 254 MET HA H N N 255 MET HB2 H N N 256 MET HB3 H N N 257 MET HG2 H N N 258 MET HG3 H N N 259 MET HE1 H N N 260 MET HE2 H N N 261 MET HE3 H N N 262 MET HXT H N N 263 MG MG MG N N 264 NH4 N N N N 265 NH4 HN1 H N N 266 NH4 HN2 H N N 267 NH4 HN3 H N N 268 NH4 HN4 H N N 269 PHE N N N N 270 PHE CA C N S 271 PHE C C N N 272 PHE O O N N 273 PHE CB C N N 274 PHE CG C Y N 275 PHE CD1 C Y N 276 PHE CD2 C Y N 277 PHE CE1 C Y N 278 PHE CE2 C Y N 279 PHE CZ C Y N 280 PHE OXT O N N 281 PHE H H N N 282 PHE H2 H N N 283 PHE HA H N N 284 PHE HB2 H N N 285 PHE HB3 H N N 286 PHE HD1 H N N 287 PHE HD2 H N N 288 PHE HE1 H N N 289 PHE HE2 H N N 290 PHE HZ H N N 291 PHE HXT H N N 292 PRO N N N N 293 PRO CA C N S 294 PRO C C N N 295 PRO O O N N 296 PRO CB C N N 297 PRO CG C N N 298 PRO CD C N N 299 PRO OXT O N N 300 PRO H H N N 301 PRO HA H N N 302 PRO HB2 H N N 303 PRO HB3 H N N 304 PRO HG2 H N N 305 PRO HG3 H N N 306 PRO HD2 H N N 307 PRO HD3 H N N 308 PRO HXT H N N 309 SER N N N N 310 SER CA C N S 311 SER C C N N 312 SER O O N N 313 SER CB C N N 314 SER OG O N N 315 SER OXT O N N 316 SER H H N N 317 SER H2 H N N 318 SER HA H N N 319 SER HB2 H N N 320 SER HB3 H N N 321 SER HG H N N 322 SER HXT H N N 323 THR N N N N 324 THR CA C N S 325 THR C C N N 326 THR O O N N 327 THR CB C N R 328 THR OG1 O N N 329 THR CG2 C N N 330 THR OXT O N N 331 THR H H N N 332 THR H2 H N N 333 THR HA H N N 334 THR HB H N N 335 THR HG1 H N N 336 THR HG21 H N N 337 THR HG22 H N N 338 THR HG23 H N N 339 THR HXT H N N 340 TRP N N N N 341 TRP CA C N S 342 TRP C C N N 343 TRP O O N N 344 TRP CB C N N 345 TRP CG C Y N 346 TRP CD1 C Y N 347 TRP CD2 C Y N 348 TRP NE1 N Y N 349 TRP CE2 C Y N 350 TRP CE3 C Y N 351 TRP CZ2 C Y N 352 TRP CZ3 C Y N 353 TRP CH2 C Y N 354 TRP OXT O N N 355 TRP H H N N 356 TRP H2 H N N 357 TRP HA H N N 358 TRP HB2 H N N 359 TRP HB3 H N N 360 TRP HD1 H N N 361 TRP HE1 H N N 362 TRP HE3 H N N 363 TRP HZ2 H N N 364 TRP HZ3 H N N 365 TRP HH2 H N N 366 TRP HXT H N N 367 TYR N N N N 368 TYR CA C N S 369 TYR C C N N 370 TYR O O N N 371 TYR CB C N N 372 TYR CG C Y N 373 TYR CD1 C Y N 374 TYR CD2 C Y N 375 TYR CE1 C Y N 376 TYR CE2 C Y N 377 TYR CZ C Y N 378 TYR OH O N N 379 TYR OXT O N N 380 TYR H H N N 381 TYR H2 H N N 382 TYR HA H N N 383 TYR HB2 H N N 384 TYR HB3 H N N 385 TYR HD1 H N N 386 TYR HD2 H N N 387 TYR HE1 H N N 388 TYR HE2 H N N 389 TYR HH H N N 390 TYR HXT H N N 391 VAL N N N N 392 VAL CA C N S 393 VAL C C N N 394 VAL O O N N 395 VAL CB C N N 396 VAL CG1 C N N 397 VAL CG2 C N N 398 VAL OXT O N N 399 VAL H H N N 400 VAL H2 H N N 401 VAL HA H N N 402 VAL HB H N N 403 VAL HG11 H N N 404 VAL HG12 H N N 405 VAL HG13 H N N 406 VAL HG21 H N N 407 VAL HG22 H N N 408 VAL HG23 H N N 409 VAL HXT H N N 410 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MET N CA sing N N 231 MET N H sing N N 232 MET N H2 sing N N 233 MET CA C sing N N 234 MET CA CB sing N N 235 MET CA HA sing N N 236 MET C O doub N N 237 MET C OXT sing N N 238 MET CB CG sing N N 239 MET CB HB2 sing N N 240 MET CB HB3 sing N N 241 MET CG SD sing N N 242 MET CG HG2 sing N N 243 MET CG HG3 sing N N 244 MET SD CE sing N N 245 MET CE HE1 sing N N 246 MET CE HE2 sing N N 247 MET CE HE3 sing N N 248 MET OXT HXT sing N N 249 NH4 N HN1 sing N N 250 NH4 N HN2 sing N N 251 NH4 N HN3 sing N N 252 NH4 N HN4 sing N N 253 PHE N CA sing N N 254 PHE N H sing N N 255 PHE N H2 sing N N 256 PHE CA C sing N N 257 PHE CA CB sing N N 258 PHE CA HA sing N N 259 PHE C O doub N N 260 PHE C OXT sing N N 261 PHE CB CG sing N N 262 PHE CB HB2 sing N N 263 PHE CB HB3 sing N N 264 PHE CG CD1 doub Y N 265 PHE CG CD2 sing Y N 266 PHE CD1 CE1 sing Y N 267 PHE CD1 HD1 sing N N 268 PHE CD2 CE2 doub Y N 269 PHE CD2 HD2 sing N N 270 PHE CE1 CZ doub Y N 271 PHE CE1 HE1 sing N N 272 PHE CE2 CZ sing Y N 273 PHE CE2 HE2 sing N N 274 PHE CZ HZ sing N N 275 PHE OXT HXT sing N N 276 PRO N CA sing N N 277 PRO N CD sing N N 278 PRO N H sing N N 279 PRO CA C sing N N 280 PRO CA CB sing N N 281 PRO CA HA sing N N 282 PRO C O doub N N 283 PRO C OXT sing N N 284 PRO CB CG sing N N 285 PRO CB HB2 sing N N 286 PRO CB HB3 sing N N 287 PRO CG CD sing N N 288 PRO CG HG2 sing N N 289 PRO CG HG3 sing N N 290 PRO CD HD2 sing N N 291 PRO CD HD3 sing N N 292 PRO OXT HXT sing N N 293 SER N CA sing N N 294 SER N H sing N N 295 SER N H2 sing N N 296 SER CA C sing N N 297 SER CA CB sing N N 298 SER CA HA sing N N 299 SER C O doub N N 300 SER C OXT sing N N 301 SER CB OG sing N N 302 SER CB HB2 sing N N 303 SER CB HB3 sing N N 304 SER OG HG sing N N 305 SER OXT HXT sing N N 306 THR N CA sing N N 307 THR N H sing N N 308 THR N H2 sing N N 309 THR CA C sing N N 310 THR CA CB sing N N 311 THR CA HA sing N N 312 THR C O doub N N 313 THR C OXT sing N N 314 THR CB OG1 sing N N 315 THR CB CG2 sing N N 316 THR CB HB sing N N 317 THR OG1 HG1 sing N N 318 THR CG2 HG21 sing N N 319 THR CG2 HG22 sing N N 320 THR CG2 HG23 sing N N 321 THR OXT HXT sing N N 322 TRP N CA sing N N 323 TRP N H sing N N 324 TRP N H2 sing N N 325 TRP CA C sing N N 326 TRP CA CB sing N N 327 TRP CA HA sing N N 328 TRP C O doub N N 329 TRP C OXT sing N N 330 TRP CB CG sing N N 331 TRP CB HB2 sing N N 332 TRP CB HB3 sing N N 333 TRP CG CD1 doub Y N 334 TRP CG CD2 sing Y N 335 TRP CD1 NE1 sing Y N 336 TRP CD1 HD1 sing N N 337 TRP CD2 CE2 doub Y N 338 TRP CD2 CE3 sing Y N 339 TRP NE1 CE2 sing Y N 340 TRP NE1 HE1 sing N N 341 TRP CE2 CZ2 sing Y N 342 TRP CE3 CZ3 doub Y N 343 TRP CE3 HE3 sing N N 344 TRP CZ2 CH2 doub Y N 345 TRP CZ2 HZ2 sing N N 346 TRP CZ3 CH2 sing Y N 347 TRP CZ3 HZ3 sing N N 348 TRP CH2 HH2 sing N N 349 TRP OXT HXT sing N N 350 TYR N CA sing N N 351 TYR N H sing N N 352 TYR N H2 sing N N 353 TYR CA C sing N N 354 TYR CA CB sing N N 355 TYR CA HA sing N N 356 TYR C O doub N N 357 TYR C OXT sing N N 358 TYR CB CG sing N N 359 TYR CB HB2 sing N N 360 TYR CB HB3 sing N N 361 TYR CG CD1 doub Y N 362 TYR CG CD2 sing Y N 363 TYR CD1 CE1 sing Y N 364 TYR CD1 HD1 sing N N 365 TYR CD2 CE2 doub Y N 366 TYR CD2 HD2 sing N N 367 TYR CE1 CZ doub Y N 368 TYR CE1 HE1 sing N N 369 TYR CE2 CZ sing Y N 370 TYR CE2 HE2 sing N N 371 TYR CZ OH sing N N 372 TYR OH HH sing N N 373 TYR OXT HXT sing N N 374 VAL N CA sing N N 375 VAL N H sing N N 376 VAL N H2 sing N N 377 VAL CA C sing N N 378 VAL CA CB sing N N 379 VAL CA HA sing N N 380 VAL C O doub N N 381 VAL C OXT sing N N 382 VAL CB CG1 sing N N 383 VAL CB CG2 sing N N 384 VAL CB HB sing N N 385 VAL CG1 HG11 sing N N 386 VAL CG1 HG12 sing N N 387 VAL CG1 HG13 sing N N 388 VAL CG2 HG21 sing N N 389 VAL CG2 HG22 sing N N 390 VAL CG2 HG23 sing N N 391 VAL OXT HXT sing N N 392 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 'AMMONIUM ION' NH4 4 GLYCEROL GOL 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2W4K _pdbx_initial_refinement_model.details 'PDB entry 2W4K' #