data_4TQ5 # _entry.id 4TQ5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4TQ5 pdb_00004tq5 10.2210/pdb4tq5/pdb WWPDB D_1000202044 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-07-16 2 'Structure model' 1 1 2014-08-06 3 'Structure model' 1 2 2017-09-06 4 'Structure model' 1 3 2019-12-25 5 'Structure model' 1 4 2020-07-29 6 'Structure model' 1 5 2023-12-27 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' Other 5 3 'Structure model' 'Source and taxonomy' 6 3 'Structure model' 'Structure summary' 7 4 'Structure model' 'Author supporting evidence' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Derived calculations' 10 5 'Structure model' 'Refinement description' 11 5 'Structure model' 'Structure summary' 12 6 'Structure model' 'Data collection' 13 6 'Structure model' 'Database references' 14 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' entity 2 3 'Structure model' entity_src_gen 3 3 'Structure model' pdbx_audit_support 4 3 'Structure model' pdbx_database_status 5 3 'Structure model' pdbx_struct_assembly 6 3 'Structure model' pdbx_struct_assembly_prop 7 3 'Structure model' pdbx_struct_oper_list 8 4 'Structure model' pdbx_audit_support 9 5 'Structure model' chem_comp 10 5 'Structure model' diffrn_radiation_wavelength 11 5 'Structure model' entity 12 5 'Structure model' pdbx_chem_comp_identifier 13 5 'Structure model' pdbx_entity_nonpoly 14 5 'Structure model' refine_hist 15 5 'Structure model' struct_site 16 5 'Structure model' struct_site_gen 17 6 'Structure model' chem_comp 18 6 'Structure model' chem_comp_atom 19 6 'Structure model' chem_comp_bond 20 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_entity.pdbx_description' 2 3 'Structure model' '_entity.src_method' 3 3 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 4 3 'Structure model' '_pdbx_audit_support.funding_organization' 5 3 'Structure model' '_pdbx_database_status.pdb_format_compatible' 6 3 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 7 3 'Structure model' '_pdbx_struct_assembly_prop.type' 8 3 'Structure model' '_pdbx_struct_assembly_prop.value' 9 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 10 4 'Structure model' '_pdbx_audit_support.funding_organization' 11 5 'Structure model' '_chem_comp.mon_nstd_flag' 12 5 'Structure model' '_chem_comp.name' 13 5 'Structure model' '_chem_comp.type' 14 5 'Structure model' '_entity.pdbx_description' 15 5 'Structure model' '_pdbx_entity_nonpoly.name' 16 5 'Structure model' '_refine_hist.d_res_high' 17 5 'Structure model' '_refine_hist.pdbx_number_atoms_nucleic_acid' 18 5 'Structure model' '_refine_hist.pdbx_number_atoms_protein' 19 6 'Structure model' '_chem_comp.pdbx_synonyms' 20 6 'Structure model' '_database_2.pdbx_DOI' 21 6 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4TQ5 _pdbx_database_status.recvd_initial_deposition_date 2014-06-10 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified NYCOMPS-GO.13398 TargetTrack . unspecified 4TQ3 PDB . unspecified 4TQ4 PDB . unspecified 4TQ6 PDB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Huang, H.' 1 'Levin, E.J.' 2 'Bai, Y.' 3 'Zhou, M.' 4 'New York Consortium on Membrane Protein Structure (NYCOMPS)' 5 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Plos Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1545-7885 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first e1001911 _citation.page_last e1001911 _citation.title 'Structure of a Membrane-Embedded Prenyltransferase Homologous to UBIAD1.' _citation.year 2014 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.pbio.1001911 _citation.pdbx_database_id_PubMed 25051182 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huang, H.' 1 ? primary 'Levin, E.J.' 2 ? primary 'Liu, S.' 3 ? primary 'Bai, Y.' 4 ? primary 'Lockless, S.W.' 5 ? primary 'Zhou, M.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man prenyltransferase 33674.551 1 ? ? ? ? 2 non-polymer man 'octyl beta-D-glucopyranoside' 292.369 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)DSSLANINQIDVPSKYLRLLRPVAWLCFLLPYAVGFGFGITPNASLQHAVLGLLSFAFW(MSE)AFSFTINALYD RDVDRLHDGRVKDLNLS(MSE)QPLVTGEISVREAWLYCIAFLALSLATAAAINEKFFLA(MSE)LGANIIGYVYSAPPR FKAWPV(MSE)DVICNALAAVLAFYAGLSIGGAEVPIAIYPAAFFLAATFYIPTAVSDYEFDKKAGLKNTPVFFGPERAL KSLYPLSAITVILWAYVFL(MSE)AERIEIKVISPLIIAYTLIYTFIINSRWDGEKLNVSPNLILTPFGIISALFIAYGF AVISVLG ; _entity_poly.pdbx_seq_one_letter_code_can ;MDSSLANINQIDVPSKYLRLLRPVAWLCFLLPYAVGFGFGITPNASLQHAVLGLLSFAFWMAFSFTINALYDRDVDRLHD GRVKDLNLSMQPLVTGEISVREAWLYCIAFLALSLATAAAINEKFFLAMLGANIIGYVYSAPPRFKAWPVMDVICNALAA VLAFYAGLSIGGAEVPIAIYPAAFFLAATFYIPTAVSDYEFDKKAGLKNTPVFFGPERALKSLYPLSAITVILWAYVFLM AERIEIKVISPLIIAYTLIYTFIINSRWDGEKLNVSPNLILTPFGIISALFIAYGFAVISVLG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'octyl beta-D-glucopyranoside' _pdbx_entity_nonpoly.comp_id BOG # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ASP n 1 3 SER n 1 4 SER n 1 5 LEU n 1 6 ALA n 1 7 ASN n 1 8 ILE n 1 9 ASN n 1 10 GLN n 1 11 ILE n 1 12 ASP n 1 13 VAL n 1 14 PRO n 1 15 SER n 1 16 LYS n 1 17 TYR n 1 18 LEU n 1 19 ARG n 1 20 LEU n 1 21 LEU n 1 22 ARG n 1 23 PRO n 1 24 VAL n 1 25 ALA n 1 26 TRP n 1 27 LEU n 1 28 CYS n 1 29 PHE n 1 30 LEU n 1 31 LEU n 1 32 PRO n 1 33 TYR n 1 34 ALA n 1 35 VAL n 1 36 GLY n 1 37 PHE n 1 38 GLY n 1 39 PHE n 1 40 GLY n 1 41 ILE n 1 42 THR n 1 43 PRO n 1 44 ASN n 1 45 ALA n 1 46 SER n 1 47 LEU n 1 48 GLN n 1 49 HIS n 1 50 ALA n 1 51 VAL n 1 52 LEU n 1 53 GLY n 1 54 LEU n 1 55 LEU n 1 56 SER n 1 57 PHE n 1 58 ALA n 1 59 PHE n 1 60 TRP n 1 61 MSE n 1 62 ALA n 1 63 PHE n 1 64 SER n 1 65 PHE n 1 66 THR n 1 67 ILE n 1 68 ASN n 1 69 ALA n 1 70 LEU n 1 71 TYR n 1 72 ASP n 1 73 ARG n 1 74 ASP n 1 75 VAL n 1 76 ASP n 1 77 ARG n 1 78 LEU n 1 79 HIS n 1 80 ASP n 1 81 GLY n 1 82 ARG n 1 83 VAL n 1 84 LYS n 1 85 ASP n 1 86 LEU n 1 87 ASN n 1 88 LEU n 1 89 SER n 1 90 MSE n 1 91 GLN n 1 92 PRO n 1 93 LEU n 1 94 VAL n 1 95 THR n 1 96 GLY n 1 97 GLU n 1 98 ILE n 1 99 SER n 1 100 VAL n 1 101 ARG n 1 102 GLU n 1 103 ALA n 1 104 TRP n 1 105 LEU n 1 106 TYR n 1 107 CYS n 1 108 ILE n 1 109 ALA n 1 110 PHE n 1 111 LEU n 1 112 ALA n 1 113 LEU n 1 114 SER n 1 115 LEU n 1 116 ALA n 1 117 THR n 1 118 ALA n 1 119 ALA n 1 120 ALA n 1 121 ILE n 1 122 ASN n 1 123 GLU n 1 124 LYS n 1 125 PHE n 1 126 PHE n 1 127 LEU n 1 128 ALA n 1 129 MSE n 1 130 LEU n 1 131 GLY n 1 132 ALA n 1 133 ASN n 1 134 ILE n 1 135 ILE n 1 136 GLY n 1 137 TYR n 1 138 VAL n 1 139 TYR n 1 140 SER n 1 141 ALA n 1 142 PRO n 1 143 PRO n 1 144 ARG n 1 145 PHE n 1 146 LYS n 1 147 ALA n 1 148 TRP n 1 149 PRO n 1 150 VAL n 1 151 MSE n 1 152 ASP n 1 153 VAL n 1 154 ILE n 1 155 CYS n 1 156 ASN n 1 157 ALA n 1 158 LEU n 1 159 ALA n 1 160 ALA n 1 161 VAL n 1 162 LEU n 1 163 ALA n 1 164 PHE n 1 165 TYR n 1 166 ALA n 1 167 GLY n 1 168 LEU n 1 169 SER n 1 170 ILE n 1 171 GLY n 1 172 GLY n 1 173 ALA n 1 174 GLU n 1 175 VAL n 1 176 PRO n 1 177 ILE n 1 178 ALA n 1 179 ILE n 1 180 TYR n 1 181 PRO n 1 182 ALA n 1 183 ALA n 1 184 PHE n 1 185 PHE n 1 186 LEU n 1 187 ALA n 1 188 ALA n 1 189 THR n 1 190 PHE n 1 191 TYR n 1 192 ILE n 1 193 PRO n 1 194 THR n 1 195 ALA n 1 196 VAL n 1 197 SER n 1 198 ASP n 1 199 TYR n 1 200 GLU n 1 201 PHE n 1 202 ASP n 1 203 LYS n 1 204 LYS n 1 205 ALA n 1 206 GLY n 1 207 LEU n 1 208 LYS n 1 209 ASN n 1 210 THR n 1 211 PRO n 1 212 VAL n 1 213 PHE n 1 214 PHE n 1 215 GLY n 1 216 PRO n 1 217 GLU n 1 218 ARG n 1 219 ALA n 1 220 LEU n 1 221 LYS n 1 222 SER n 1 223 LEU n 1 224 TYR n 1 225 PRO n 1 226 LEU n 1 227 SER n 1 228 ALA n 1 229 ILE n 1 230 THR n 1 231 VAL n 1 232 ILE n 1 233 LEU n 1 234 TRP n 1 235 ALA n 1 236 TYR n 1 237 VAL n 1 238 PHE n 1 239 LEU n 1 240 MSE n 1 241 ALA n 1 242 GLU n 1 243 ARG n 1 244 ILE n 1 245 GLU n 1 246 ILE n 1 247 LYS n 1 248 VAL n 1 249 ILE n 1 250 SER n 1 251 PRO n 1 252 LEU n 1 253 ILE n 1 254 ILE n 1 255 ALA n 1 256 TYR n 1 257 THR n 1 258 LEU n 1 259 ILE n 1 260 TYR n 1 261 THR n 1 262 PHE n 1 263 ILE n 1 264 ILE n 1 265 ASN n 1 266 SER n 1 267 ARG n 1 268 TRP n 1 269 ASP n 1 270 GLY n 1 271 GLU n 1 272 LYS n 1 273 LEU n 1 274 ASN n 1 275 VAL n 1 276 SER n 1 277 PRO n 1 278 ASN n 1 279 LEU n 1 280 ILE n 1 281 LEU n 1 282 THR n 1 283 PRO n 1 284 PHE n 1 285 GLY n 1 286 ILE n 1 287 ILE n 1 288 SER n 1 289 ALA n 1 290 LEU n 1 291 PHE n 1 292 ILE n 1 293 ALA n 1 294 TYR n 1 295 GLY n 1 296 PHE n 1 297 ALA n 1 298 VAL n 1 299 ILE n 1 300 SER n 1 301 VAL n 1 302 LEU n 1 303 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 303 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene AF_1648 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Archaeoglobus fulgidus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224325 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BOG D-saccharide n 'octyl beta-D-glucopyranoside' 'Beta-Octylglucoside; octyl beta-D-glucoside; octyl D-glucoside; octyl glucoside' 'C14 H28 O6' 292.369 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_chem_comp_identifier.comp_id BOG _pdbx_chem_comp_identifier.type 'IUPAC CARBOHYDRATE SYMBOL' _pdbx_chem_comp_identifier.program PDB-CARE _pdbx_chem_comp_identifier.program_version 1.0 _pdbx_chem_comp_identifier.identifier b-octylglucoside # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 LEU 5 5 ? ? ? A . n A 1 6 ALA 6 6 ? ? ? A . n A 1 7 ASN 7 7 ? ? ? A . n A 1 8 ILE 8 8 ? ? ? A . n A 1 9 ASN 9 9 ? ? ? A . n A 1 10 GLN 10 10 ? ? ? A . n A 1 11 ILE 11 11 ? ? ? A . n A 1 12 ASP 12 12 ? ? ? A . n A 1 13 VAL 13 13 ? ? ? A . n A 1 14 PRO 14 14 ? ? ? A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 TRP 60 60 60 TRP TRP A . n A 1 61 MSE 61 61 61 MSE MSE A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 ASP 74 74 ? ? ? A . n A 1 75 VAL 75 75 ? ? ? A . n A 1 76 ASP 76 76 ? ? ? A . n A 1 77 ARG 77 77 ? ? ? A . n A 1 78 LEU 78 78 ? ? ? A . n A 1 79 HIS 79 79 ? ? ? A . n A 1 80 ASP 80 80 ? ? ? A . n A 1 81 GLY 81 81 ? ? ? A . n A 1 82 ARG 82 82 ? ? ? A . n A 1 83 VAL 83 83 ? ? ? A . n A 1 84 LYS 84 84 ? ? ? A . n A 1 85 ASP 85 85 ? ? ? A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 MSE 90 90 90 MSE MSE A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 TRP 104 104 104 TRP TRP A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 CYS 107 107 107 CYS CYS A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 MSE 129 129 129 MSE MSE A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 PRO 142 142 142 PRO PRO A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 PHE 145 145 145 PHE PHE A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 TRP 148 148 148 TRP TRP A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 MSE 151 151 151 MSE MSE A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 CYS 155 155 155 CYS CYS A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 PHE 164 164 164 PHE PHE A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 ILE 177 177 177 ILE ILE A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 TYR 180 180 180 TYR TYR A . n A 1 181 PRO 181 181 181 PRO PRO A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 PHE 184 184 184 PHE PHE A . n A 1 185 PHE 185 185 185 PHE PHE A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 THR 189 189 189 THR THR A . n A 1 190 PHE 190 190 190 PHE PHE A . n A 1 191 TYR 191 191 191 TYR TYR A . n A 1 192 ILE 192 192 192 ILE ILE A . n A 1 193 PRO 193 193 193 PRO PRO A . n A 1 194 THR 194 194 194 THR THR A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 ASP 198 198 198 ASP ASP A . n A 1 199 TYR 199 199 199 TYR TYR A . n A 1 200 GLU 200 200 200 GLU GLU A . n A 1 201 PHE 201 201 201 PHE PHE A . n A 1 202 ASP 202 202 202 ASP ASP A . n A 1 203 LYS 203 203 203 LYS LYS A . n A 1 204 LYS 204 204 204 LYS LYS A . n A 1 205 ALA 205 205 205 ALA ALA A . n A 1 206 GLY 206 206 206 GLY GLY A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 LYS 208 208 208 LYS LYS A . n A 1 209 ASN 209 209 209 ASN ASN A . n A 1 210 THR 210 210 210 THR THR A . n A 1 211 PRO 211 211 211 PRO PRO A . n A 1 212 VAL 212 212 212 VAL VAL A . n A 1 213 PHE 213 213 213 PHE PHE A . n A 1 214 PHE 214 214 214 PHE PHE A . n A 1 215 GLY 215 215 215 GLY GLY A . n A 1 216 PRO 216 216 216 PRO PRO A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 ARG 218 218 218 ARG ARG A . n A 1 219 ALA 219 219 219 ALA ALA A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 LYS 221 221 221 LYS LYS A . n A 1 222 SER 222 222 222 SER SER A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 TYR 224 224 224 TYR TYR A . n A 1 225 PRO 225 225 225 PRO PRO A . n A 1 226 LEU 226 226 226 LEU LEU A . n A 1 227 SER 227 227 227 SER SER A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 ILE 229 229 229 ILE ILE A . n A 1 230 THR 230 230 230 THR THR A . n A 1 231 VAL 231 231 231 VAL VAL A . n A 1 232 ILE 232 232 232 ILE ILE A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 TRP 234 234 234 TRP TRP A . n A 1 235 ALA 235 235 235 ALA ALA A . n A 1 236 TYR 236 236 236 TYR TYR A . n A 1 237 VAL 237 237 237 VAL VAL A . n A 1 238 PHE 238 238 238 PHE PHE A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 MSE 240 240 240 MSE MSE A . n A 1 241 ALA 241 241 241 ALA ALA A . n A 1 242 GLU 242 242 242 GLU GLU A . n A 1 243 ARG 243 243 243 ARG ARG A . n A 1 244 ILE 244 244 244 ILE ILE A . n A 1 245 GLU 245 245 245 GLU GLU A . n A 1 246 ILE 246 246 246 ILE ILE A . n A 1 247 LYS 247 247 247 LYS LYS A . n A 1 248 VAL 248 248 248 VAL VAL A . n A 1 249 ILE 249 249 249 ILE ILE A . n A 1 250 SER 250 250 250 SER SER A . n A 1 251 PRO 251 251 251 PRO PRO A . n A 1 252 LEU 252 252 252 LEU LEU A . n A 1 253 ILE 253 253 253 ILE ILE A . n A 1 254 ILE 254 254 254 ILE ILE A . n A 1 255 ALA 255 255 255 ALA ALA A . n A 1 256 TYR 256 256 256 TYR TYR A . n A 1 257 THR 257 257 257 THR THR A . n A 1 258 LEU 258 258 258 LEU LEU A . n A 1 259 ILE 259 259 259 ILE ILE A . n A 1 260 TYR 260 260 260 TYR TYR A . n A 1 261 THR 261 261 261 THR THR A . n A 1 262 PHE 262 262 262 PHE PHE A . n A 1 263 ILE 263 263 263 ILE ILE A . n A 1 264 ILE 264 264 264 ILE ILE A . n A 1 265 ASN 265 265 265 ASN ASN A . n A 1 266 SER 266 266 266 SER SER A . n A 1 267 ARG 267 267 267 ARG ARG A . n A 1 268 TRP 268 268 268 TRP TRP A . n A 1 269 ASP 269 269 269 ASP ASP A . n A 1 270 GLY 270 270 270 GLY GLY A . n A 1 271 GLU 271 271 271 GLU GLU A . n A 1 272 LYS 272 272 272 LYS LYS A . n A 1 273 LEU 273 273 273 LEU LEU A . n A 1 274 ASN 274 274 274 ASN ASN A . n A 1 275 VAL 275 275 275 VAL VAL A . n A 1 276 SER 276 276 276 SER SER A . n A 1 277 PRO 277 277 277 PRO PRO A . n A 1 278 ASN 278 278 278 ASN ASN A . n A 1 279 LEU 279 279 279 LEU LEU A . n A 1 280 ILE 280 280 280 ILE ILE A . n A 1 281 LEU 281 281 281 LEU LEU A . n A 1 282 THR 282 282 282 THR THR A . n A 1 283 PRO 283 283 283 PRO PRO A . n A 1 284 PHE 284 284 284 PHE PHE A . n A 1 285 GLY 285 285 285 GLY GLY A . n A 1 286 ILE 286 286 286 ILE ILE A . n A 1 287 ILE 287 287 287 ILE ILE A . n A 1 288 SER 288 288 288 SER SER A . n A 1 289 ALA 289 289 289 ALA ALA A . n A 1 290 LEU 290 290 290 LEU LEU A . n A 1 291 PHE 291 291 291 PHE PHE A . n A 1 292 ILE 292 292 292 ILE ILE A . n A 1 293 ALA 293 293 293 ALA ALA A . n A 1 294 TYR 294 294 294 TYR TYR A . n A 1 295 GLY 295 295 295 GLY GLY A . n A 1 296 PHE 296 296 296 PHE PHE A . n A 1 297 ALA 297 297 297 ALA ALA A . n A 1 298 VAL 298 298 298 VAL VAL A . n A 1 299 ILE 299 299 299 ILE ILE A . n A 1 300 SER 300 300 300 SER SER A . n A 1 301 VAL 301 301 301 VAL VAL A . n A 1 302 LEU 302 302 ? ? ? A . n A 1 303 GLY 303 303 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id BOG _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 401 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id BOG _pdbx_nonpoly_scheme.auth_mon_id BOG _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.14 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.8.4_1496)' 4 # _cell.length_a 61.922 _cell.length_b 61.922 _cell.length_c 248.752 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 4TQ5 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4TQ5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 151 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 1 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4TQ5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.12 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 70.16 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '12.5% PEG 20000, 100 mM MES' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-07-14 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97800 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97800 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X29A _diffrn_source.pdbx_synchrotron_site NSLS # _reflns.B_iso_Wilson_estimate 88.160 _reflns.entry_id 4TQ5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.200 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9401 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 21.000 _reflns.pdbx_Rmerge_I_obs 0.128 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 27.727 _reflns.pdbx_netI_over_sigmaI 4.900 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.874 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 197115 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 3.200 3.260 ? ? ? ? ? 467 ? 98.700 ? ? ? ? ? ? ? ? ? ? ? ? ? 15.900 ? 0.737 ? ? ? ? 0 1 1 ? ? 3.260 3.310 ? ? ? ? ? 439 ? 100.000 ? ? ? ? 0.953 ? ? ? ? ? ? ? ? 17.800 ? 0.756 ? ? ? ? 0 2 1 ? ? 3.310 3.380 ? ? ? ? ? 464 ? 100.000 ? ? ? ? 0.962 ? ? ? ? ? ? ? ? 18.900 ? 0.747 ? ? ? ? 0 3 1 ? ? 3.380 3.450 ? ? ? ? ? 482 ? 100.000 ? ? ? ? 0.835 ? ? ? ? ? ? ? ? 20.500 ? 0.742 ? ? ? ? 0 4 1 ? ? 3.450 3.520 ? ? ? ? ? 437 ? 100.000 ? ? ? ? 0.578 ? ? ? ? ? ? ? ? 21.600 ? 0.765 ? ? ? ? 0 5 1 ? ? 3.520 3.600 ? ? ? ? ? 481 ? 100.000 ? ? ? ? 0.585 ? ? ? ? ? ? ? ? 22.300 ? 0.748 ? ? ? ? 0 6 1 ? ? 3.600 3.690 ? ? ? ? ? 458 ? 100.000 ? ? ? ? 0.434 ? ? ? ? ? ? ? ? 22.200 ? 0.801 ? ? ? ? 0 7 1 ? ? 3.690 3.790 ? ? ? ? ? 453 ? 100.000 ? ? ? ? 0.407 ? ? ? ? ? ? ? ? 22.100 ? 0.787 ? ? ? ? 0 8 1 ? ? 3.790 3.910 ? ? ? ? ? 482 ? 100.000 ? ? ? ? 0.295 ? ? ? ? ? ? ? ? 21.800 ? 0.803 ? ? ? ? 0 9 1 ? ? 3.910 4.030 ? ? ? ? ? 446 ? 100.000 ? ? ? ? 0.237 ? ? ? ? ? ? ? ? 22.400 ? 0.816 ? ? ? ? 0 10 1 ? ? 4.030 4.180 ? ? ? ? ? 467 ? 100.000 ? ? ? ? 0.173 ? ? ? ? ? ? ? ? 22.200 ? 0.840 ? ? ? ? 0 11 1 ? ? 4.180 4.340 ? ? ? ? ? 468 ? 100.000 ? ? ? ? 0.136 ? ? ? ? ? ? ? ? 22.000 ? 0.822 ? ? ? ? 0 12 1 ? ? 4.340 4.540 ? ? ? ? ? 467 ? 100.000 ? ? ? ? 0.130 ? ? ? ? ? ? ? ? 21.800 ? 0.893 ? ? ? ? 0 13 1 ? ? 4.540 4.780 ? ? ? ? ? 477 ? 100.000 ? ? ? ? 0.128 ? ? ? ? ? ? ? ? 22.100 ? 0.928 ? ? ? ? 0 14 1 ? ? 4.780 5.080 ? ? ? ? ? 472 ? 100.000 ? ? ? ? 0.125 ? ? ? ? ? ? ? ? 21.600 ? 1.022 ? ? ? ? 0 15 1 ? ? 5.080 5.470 ? ? ? ? ? 463 ? 100.000 ? ? ? ? 0.135 ? ? ? ? ? ? ? ? 21.600 ? 1.003 ? ? ? ? 0 16 1 ? ? 5.470 6.020 ? ? ? ? ? 476 ? 100.000 ? ? ? ? 0.132 ? ? ? ? ? ? ? ? 21.500 ? 0.986 ? ? ? ? 0 17 1 ? ? 6.020 6.890 ? ? ? ? ? 493 ? 100.000 ? ? ? ? 0.094 ? ? ? ? ? ? ? ? 21.000 ? 0.998 ? ? ? ? 0 18 1 ? ? 6.890 8.670 ? ? ? ? ? 482 ? 100.000 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 20.400 ? 1.102 ? ? ? ? 0 19 1 ? ? 8.670 50.000 ? ? ? ? ? 527 ? 100.000 ? ? ? ? 0.030 ? ? ? ? ? ? ? ? 19.600 ? 1.102 ? ? ? ? 0 20 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 169.770 _refine.B_iso_mean 95.7800 _refine.B_iso_min 61.170 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4TQ5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.2023 _refine.ls_d_res_low 49.2440 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17481 _refine.ls_number_reflns_R_free 1715 _refine.ls_number_reflns_R_work 15766 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.3700 _refine.ls_percent_reflns_R_free 9.8100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2548 _refine.ls_R_factor_R_free 0.2886 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2512 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.300 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details Random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 36.2300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.6879 # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 3.2023 _refine_hist.d_res_low 49.2440 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2169 _refine_hist.pdbx_number_residues_total 275 _refine_hist.pdbx_B_iso_mean_ligand 108.62 _refine_hist.pdbx_number_atoms_protein 2149 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 2234 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.952 ? 3051 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.033 ? 357 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 368 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.776 ? 770 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error 'X-RAY DIFFRACTION' 3.2023 3.2965 1422 . 141 1281 98.0000 . . . 0.4662 . 0.3938 . . . . . . 12 . 'X-RAY DIFFRACTION' 3.2965 3.4028 1475 . 142 1333 99.0000 . . . 0.4240 . 0.3212 . . . . . . 12 . 'X-RAY DIFFRACTION' 3.4028 3.5244 1423 . 140 1283 99.0000 . . . 0.3347 . 0.2932 . . . . . . 12 . 'X-RAY DIFFRACTION' 3.5244 3.6655 1492 . 154 1338 99.0000 . . . 0.3331 . 0.2960 . . . . . . 12 . 'X-RAY DIFFRACTION' 3.6655 3.8323 1457 . 140 1317 100.0000 . . . 0.3087 . 0.2378 . . . . . . 12 . 'X-RAY DIFFRACTION' 3.8323 4.0342 1436 . 142 1294 100.0000 . . . 0.3325 . 0.2326 . . . . . . 12 . 'X-RAY DIFFRACTION' 4.0342 4.2868 1474 . 148 1326 99.0000 . . . 0.3242 . 0.2439 . . . . . . 12 . 'X-RAY DIFFRACTION' 4.2868 4.6176 1428 . 146 1282 100.0000 . . . 0.2733 . 0.2255 . . . . . . 12 . 'X-RAY DIFFRACTION' 4.6176 5.0819 1503 . 138 1365 100.0000 . . . 0.2629 . 0.2072 . . . . . . 12 . 'X-RAY DIFFRACTION' 5.0819 5.8162 1436 . 141 1295 100.0000 . . . 0.2572 . 0.2500 . . . . . . 12 . 'X-RAY DIFFRACTION' 5.8162 7.3240 1470 . 138 1332 100.0000 . . . 0.2580 . 0.2530 . . . . . . 12 . 'X-RAY DIFFRACTION' 7.3240 49.2496 1465 . 145 1320 99.0000 . . . 0.2447 . 0.2473 . . . . . . 12 . # _struct.entry_id 4TQ5 _struct.title 'Structure of a UbiA homolog from Archaeoglobus fulgidus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4TQ5 _struct_keywords.text ;prenyltransferase, transferase, membrane protein, Structural Genomics, New York Consortium on Membrane Protein Structure, NYCOMPS, PSI-Biology ; _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O28625_ARCFU _struct_ref.pdbx_db_accession O28625 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDSSLANINQIDVPSKYLRLLRPVAWLCFLLPYAVGFGFGITPNASLQHAVLGLLSFAFWMAFSFTINALYDRDVDRLHD GRVKDLNLSMQPLVTGEISVREAWLYCIAFLALSLATAAAINEKFFLAMLGANIIGYVYSAPPRFKAWPVMDVICNALAA VLAFYAGLSIGGAEVPIAIYPAAFFLAATFYIPTAVSDYEFDKKAGLKNTPVFFGPERALKSLYPLSAITVILWAYVFLM AERIEIKVISPLIIAYTLIYTFIINSRWDGEKLNVSPNLILTPFGIISALFIAYGFAVISVLG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4TQ5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 303 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O28625 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 303 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 303 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 13500 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 22 ? ALA A 25 ? ARG A 22 ALA A 25 5 ? 4 HELX_P HELX_P2 AA2 TRP A 26 ? GLY A 40 ? TRP A 26 GLY A 40 1 ? 15 HELX_P HELX_P3 AA3 SER A 46 ? ASP A 72 ? SER A 46 ASP A 72 1 ? 27 HELX_P HELX_P4 AA4 GLN A 91 ? GLY A 96 ? GLN A 91 GLY A 96 1 ? 6 HELX_P HELX_P5 AA5 SER A 99 ? ALA A 120 ? SER A 99 ALA A 120 1 ? 22 HELX_P HELX_P6 AA6 ASN A 122 ? ALA A 141 ? ASN A 122 ALA A 141 1 ? 20 HELX_P HELX_P7 AA7 ARG A 144 ? TRP A 148 ? ARG A 144 TRP A 148 5 ? 5 HELX_P HELX_P8 AA8 VAL A 150 ? GLY A 172 ? VAL A 150 GLY A 172 1 ? 23 HELX_P HELX_P9 AA9 ALA A 178 ? ASP A 198 ? ALA A 178 ASP A 198 1 ? 21 HELX_P HELX_P10 AB1 ASP A 198 ? ALA A 205 ? ASP A 198 ALA A 205 1 ? 8 HELX_P HELX_P11 AB2 ASN A 209 ? PHE A 214 ? ASN A 209 PHE A 214 1 ? 6 HELX_P HELX_P12 AB3 GLY A 215 ? LYS A 221 ? GLY A 215 LYS A 221 1 ? 7 HELX_P HELX_P13 AB4 SER A 222 ? ALA A 241 ? SER A 222 ALA A 241 1 ? 20 HELX_P HELX_P14 AB5 ARG A 243 ? ARG A 267 ? ARG A 243 ARG A 267 1 ? 25 HELX_P HELX_P15 AB6 PRO A 277 ? VAL A 301 ? PRO A 277 VAL A 301 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A TRP 60 C ? ? ? 1_555 A MSE 61 N ? ? A TRP 60 A MSE 61 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale both ? A MSE 61 C ? ? ? 1_555 A ALA 62 N ? ? A MSE 61 A ALA 62 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale3 covale both ? A SER 89 C ? ? ? 1_555 A MSE 90 N ? ? A SER 89 A MSE 90 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale4 covale both ? A MSE 90 C ? ? ? 1_555 A GLN 91 N ? ? A MSE 90 A GLN 91 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale5 covale both ? A ALA 128 C ? ? ? 1_555 A MSE 129 N ? ? A ALA 128 A MSE 129 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale6 covale both ? A MSE 129 C ? ? ? 1_555 A LEU 130 N ? ? A MSE 129 A LEU 130 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale7 covale both ? A VAL 150 C ? ? ? 1_555 A MSE 151 N ? ? A VAL 150 A MSE 151 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale8 covale both ? A MSE 151 C ? ? ? 1_555 A ASP 152 N ? ? A MSE 151 A ASP 152 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale9 covale both ? A LEU 239 C ? ? ? 1_555 A MSE 240 N ? ? A LEU 239 A MSE 240 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale10 covale both ? A MSE 240 C ? ? ? 1_555 A ALA 241 N ? ? A MSE 240 A ALA 241 1_555 ? ? ? ? ? ? ? 1.329 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PRO _struct_mon_prot_cis.label_seq_id 142 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PRO _struct_mon_prot_cis.auth_seq_id 142 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 143 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 143 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 8.21 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ILE 246 ? ? OG A SER 250 ? ? 2.12 2 1 O A PRO 149 ? ? OG1 A THR 210 ? ? 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 39 ? ? -63.83 -75.40 2 1 ILE A 121 ? ? -87.44 -81.04 3 1 ARG A 144 ? ? 68.00 71.40 4 1 PRO A 149 ? ? -51.75 -71.31 5 1 ASP A 198 ? ? -95.61 39.06 6 1 LEU A 207 ? ? 60.36 -48.32 7 1 ASN A 209 ? ? -84.03 -158.37 8 1 LEU A 273 ? ? -62.03 66.14 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name PSI:Biology _pdbx_SG_project.full_name_of_center 'New York Consortium on Membrane Protein Structure' _pdbx_SG_project.initial_of_center NYCOMPS # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 61 A MSE 61 ? MET 'modified residue' 2 A MSE 90 A MSE 90 ? MET 'modified residue' 3 A MSE 129 A MSE 129 ? MET 'modified residue' 4 A MSE 151 A MSE 151 ? MET 'modified residue' 5 A MSE 240 A MSE 240 ? MET 'modified residue' # _diffrn_reflns.diffrn_id 1 _diffrn_reflns.pdbx_d_res_high 3.200 _diffrn_reflns.pdbx_d_res_low 50.000 _diffrn_reflns.pdbx_number_obs 9401 _diffrn_reflns.pdbx_Rmerge_I_obs 0.128 _diffrn_reflns.pdbx_Rsym_value ? _diffrn_reflns.pdbx_chi_squared 0.87 _diffrn_reflns.pdbx_redundancy 21.00 _diffrn_reflns.pdbx_rejects ? _diffrn_reflns.pdbx_percent_possible_obs 99.90 _diffrn_reflns.pdbx_observed_criterion ? _diffrn_reflns.number 197115 _diffrn_reflns.limit_h_max ? _diffrn_reflns.limit_h_min ? _diffrn_reflns.limit_k_max ? _diffrn_reflns.limit_k_min ? _diffrn_reflns.limit_l_max ? _diffrn_reflns.limit_l_min ? # loop_ _pdbx_diffrn_reflns_shell.diffrn_id _pdbx_diffrn_reflns_shell.d_res_high _pdbx_diffrn_reflns_shell.d_res_low _pdbx_diffrn_reflns_shell.number_obs _pdbx_diffrn_reflns_shell.rejects _pdbx_diffrn_reflns_shell.Rmerge_I_obs _pdbx_diffrn_reflns_shell.Rsym_value _pdbx_diffrn_reflns_shell.chi_squared _pdbx_diffrn_reflns_shell.redundancy _pdbx_diffrn_reflns_shell.percent_possible_obs 1 8.67 50.00 ? ? 0.030 ? 1.102 19.60 ? 1 6.89 8.67 ? ? 0.051 ? 1.102 20.40 ? 1 6.02 6.89 ? ? 0.094 ? 0.998 21.00 ? 1 5.47 6.02 ? ? 0.132 ? 0.986 21.50 ? 1 5.08 5.47 ? ? 0.135 ? 1.003 21.60 ? 1 4.78 5.08 ? ? 0.125 ? 1.022 21.60 ? 1 4.54 4.78 ? ? 0.128 ? 0.928 22.10 ? 1 4.34 4.54 ? ? 0.130 ? 0.893 21.80 ? 1 4.18 4.34 ? ? 0.136 ? 0.822 22.00 ? 1 4.03 4.18 ? ? 0.173 ? 0.840 22.20 ? 1 3.91 4.03 ? ? 0.237 ? 0.816 22.40 ? 1 3.79 3.91 ? ? 0.295 ? 0.803 21.80 ? 1 3.69 3.79 ? ? 0.407 ? 0.787 22.10 ? 1 3.60 3.69 ? ? 0.434 ? 0.801 22.20 ? 1 3.52 3.60 ? ? 0.585 ? 0.748 22.30 ? 1 3.45 3.52 ? ? 0.578 ? 0.765 21.60 ? 1 3.38 3.45 ? ? 0.835 ? 0.742 20.50 ? 1 3.31 3.38 ? ? 0.962 ? 0.747 18.90 ? 1 3.26 3.31 ? ? 0.953 ? 0.756 17.80 ? 1 3.20 3.26 ? ? ? ? 0.737 15.90 ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A LEU 5 ? A LEU 5 6 1 Y 1 A ALA 6 ? A ALA 6 7 1 Y 1 A ASN 7 ? A ASN 7 8 1 Y 1 A ILE 8 ? A ILE 8 9 1 Y 1 A ASN 9 ? A ASN 9 10 1 Y 1 A GLN 10 ? A GLN 10 11 1 Y 1 A ILE 11 ? A ILE 11 12 1 Y 1 A ASP 12 ? A ASP 12 13 1 Y 1 A VAL 13 ? A VAL 13 14 1 Y 1 A PRO 14 ? A PRO 14 15 1 Y 1 A ASP 74 ? A ASP 74 16 1 Y 1 A VAL 75 ? A VAL 75 17 1 Y 1 A ASP 76 ? A ASP 76 18 1 Y 1 A ARG 77 ? A ARG 77 19 1 Y 1 A LEU 78 ? A LEU 78 20 1 Y 1 A HIS 79 ? A HIS 79 21 1 Y 1 A ASP 80 ? A ASP 80 22 1 Y 1 A GLY 81 ? A GLY 81 23 1 Y 1 A ARG 82 ? A ARG 82 24 1 Y 1 A VAL 83 ? A VAL 83 25 1 Y 1 A LYS 84 ? A LYS 84 26 1 Y 1 A ASP 85 ? A ASP 85 27 1 Y 1 A LEU 302 ? A LEU 302 28 1 Y 1 A GLY 303 ? A GLY 303 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BOG C1 C N R 74 BOG O1 O N N 75 BOG C2 C N R 76 BOG O2 O N N 77 BOG C3 C N S 78 BOG O3 O N N 79 BOG C4 C N S 80 BOG O4 O N N 81 BOG C5 C N R 82 BOG O5 O N N 83 BOG C6 C N N 84 BOG O6 O N N 85 BOG "C1'" C N N 86 BOG "C2'" C N N 87 BOG "C3'" C N N 88 BOG "C4'" C N N 89 BOG "C5'" C N N 90 BOG "C6'" C N N 91 BOG "C7'" C N N 92 BOG "C8'" C N N 93 BOG H1 H N N 94 BOG H2 H N N 95 BOG HO2 H N N 96 BOG H3 H N N 97 BOG HO3 H N N 98 BOG H4 H N N 99 BOG HO4 H N N 100 BOG H5 H N N 101 BOG H61 H N N 102 BOG H62 H N N 103 BOG HO6 H N N 104 BOG "H1'1" H N N 105 BOG "H1'2" H N N 106 BOG "H2'1" H N N 107 BOG "H2'2" H N N 108 BOG "H3'1" H N N 109 BOG "H3'2" H N N 110 BOG "H4'1" H N N 111 BOG "H4'2" H N N 112 BOG "H5'1" H N N 113 BOG "H5'2" H N N 114 BOG "H6'1" H N N 115 BOG "H6'2" H N N 116 BOG "H7'1" H N N 117 BOG "H7'2" H N N 118 BOG "H8'1" H N N 119 BOG "H8'2" H N N 120 BOG "H8'3" H N N 121 CYS N N N N 122 CYS CA C N R 123 CYS C C N N 124 CYS O O N N 125 CYS CB C N N 126 CYS SG S N N 127 CYS OXT O N N 128 CYS H H N N 129 CYS H2 H N N 130 CYS HA H N N 131 CYS HB2 H N N 132 CYS HB3 H N N 133 CYS HG H N N 134 CYS HXT H N N 135 GLN N N N N 136 GLN CA C N S 137 GLN C C N N 138 GLN O O N N 139 GLN CB C N N 140 GLN CG C N N 141 GLN CD C N N 142 GLN OE1 O N N 143 GLN NE2 N N N 144 GLN OXT O N N 145 GLN H H N N 146 GLN H2 H N N 147 GLN HA H N N 148 GLN HB2 H N N 149 GLN HB3 H N N 150 GLN HG2 H N N 151 GLN HG3 H N N 152 GLN HE21 H N N 153 GLN HE22 H N N 154 GLN HXT H N N 155 GLU N N N N 156 GLU CA C N S 157 GLU C C N N 158 GLU O O N N 159 GLU CB C N N 160 GLU CG C N N 161 GLU CD C N N 162 GLU OE1 O N N 163 GLU OE2 O N N 164 GLU OXT O N N 165 GLU H H N N 166 GLU H2 H N N 167 GLU HA H N N 168 GLU HB2 H N N 169 GLU HB3 H N N 170 GLU HG2 H N N 171 GLU HG3 H N N 172 GLU HE2 H N N 173 GLU HXT H N N 174 GLY N N N N 175 GLY CA C N N 176 GLY C C N N 177 GLY O O N N 178 GLY OXT O N N 179 GLY H H N N 180 GLY H2 H N N 181 GLY HA2 H N N 182 GLY HA3 H N N 183 GLY HXT H N N 184 HIS N N N N 185 HIS CA C N S 186 HIS C C N N 187 HIS O O N N 188 HIS CB C N N 189 HIS CG C Y N 190 HIS ND1 N Y N 191 HIS CD2 C Y N 192 HIS CE1 C Y N 193 HIS NE2 N Y N 194 HIS OXT O N N 195 HIS H H N N 196 HIS H2 H N N 197 HIS HA H N N 198 HIS HB2 H N N 199 HIS HB3 H N N 200 HIS HD1 H N N 201 HIS HD2 H N N 202 HIS HE1 H N N 203 HIS HE2 H N N 204 HIS HXT H N N 205 ILE N N N N 206 ILE CA C N S 207 ILE C C N N 208 ILE O O N N 209 ILE CB C N S 210 ILE CG1 C N N 211 ILE CG2 C N N 212 ILE CD1 C N N 213 ILE OXT O N N 214 ILE H H N N 215 ILE H2 H N N 216 ILE HA H N N 217 ILE HB H N N 218 ILE HG12 H N N 219 ILE HG13 H N N 220 ILE HG21 H N N 221 ILE HG22 H N N 222 ILE HG23 H N N 223 ILE HD11 H N N 224 ILE HD12 H N N 225 ILE HD13 H N N 226 ILE HXT H N N 227 LEU N N N N 228 LEU CA C N S 229 LEU C C N N 230 LEU O O N N 231 LEU CB C N N 232 LEU CG C N N 233 LEU CD1 C N N 234 LEU CD2 C N N 235 LEU OXT O N N 236 LEU H H N N 237 LEU H2 H N N 238 LEU HA H N N 239 LEU HB2 H N N 240 LEU HB3 H N N 241 LEU HG H N N 242 LEU HD11 H N N 243 LEU HD12 H N N 244 LEU HD13 H N N 245 LEU HD21 H N N 246 LEU HD22 H N N 247 LEU HD23 H N N 248 LEU HXT H N N 249 LYS N N N N 250 LYS CA C N S 251 LYS C C N N 252 LYS O O N N 253 LYS CB C N N 254 LYS CG C N N 255 LYS CD C N N 256 LYS CE C N N 257 LYS NZ N N N 258 LYS OXT O N N 259 LYS H H N N 260 LYS H2 H N N 261 LYS HA H N N 262 LYS HB2 H N N 263 LYS HB3 H N N 264 LYS HG2 H N N 265 LYS HG3 H N N 266 LYS HD2 H N N 267 LYS HD3 H N N 268 LYS HE2 H N N 269 LYS HE3 H N N 270 LYS HZ1 H N N 271 LYS HZ2 H N N 272 LYS HZ3 H N N 273 LYS HXT H N N 274 MSE N N N N 275 MSE CA C N S 276 MSE C C N N 277 MSE O O N N 278 MSE OXT O N N 279 MSE CB C N N 280 MSE CG C N N 281 MSE SE SE N N 282 MSE CE C N N 283 MSE H H N N 284 MSE H2 H N N 285 MSE HA H N N 286 MSE HXT H N N 287 MSE HB2 H N N 288 MSE HB3 H N N 289 MSE HG2 H N N 290 MSE HG3 H N N 291 MSE HE1 H N N 292 MSE HE2 H N N 293 MSE HE3 H N N 294 PHE N N N N 295 PHE CA C N S 296 PHE C C N N 297 PHE O O N N 298 PHE CB C N N 299 PHE CG C Y N 300 PHE CD1 C Y N 301 PHE CD2 C Y N 302 PHE CE1 C Y N 303 PHE CE2 C Y N 304 PHE CZ C Y N 305 PHE OXT O N N 306 PHE H H N N 307 PHE H2 H N N 308 PHE HA H N N 309 PHE HB2 H N N 310 PHE HB3 H N N 311 PHE HD1 H N N 312 PHE HD2 H N N 313 PHE HE1 H N N 314 PHE HE2 H N N 315 PHE HZ H N N 316 PHE HXT H N N 317 PRO N N N N 318 PRO CA C N S 319 PRO C C N N 320 PRO O O N N 321 PRO CB C N N 322 PRO CG C N N 323 PRO CD C N N 324 PRO OXT O N N 325 PRO H H N N 326 PRO HA H N N 327 PRO HB2 H N N 328 PRO HB3 H N N 329 PRO HG2 H N N 330 PRO HG3 H N N 331 PRO HD2 H N N 332 PRO HD3 H N N 333 PRO HXT H N N 334 SER N N N N 335 SER CA C N S 336 SER C C N N 337 SER O O N N 338 SER CB C N N 339 SER OG O N N 340 SER OXT O N N 341 SER H H N N 342 SER H2 H N N 343 SER HA H N N 344 SER HB2 H N N 345 SER HB3 H N N 346 SER HG H N N 347 SER HXT H N N 348 THR N N N N 349 THR CA C N S 350 THR C C N N 351 THR O O N N 352 THR CB C N R 353 THR OG1 O N N 354 THR CG2 C N N 355 THR OXT O N N 356 THR H H N N 357 THR H2 H N N 358 THR HA H N N 359 THR HB H N N 360 THR HG1 H N N 361 THR HG21 H N N 362 THR HG22 H N N 363 THR HG23 H N N 364 THR HXT H N N 365 TRP N N N N 366 TRP CA C N S 367 TRP C C N N 368 TRP O O N N 369 TRP CB C N N 370 TRP CG C Y N 371 TRP CD1 C Y N 372 TRP CD2 C Y N 373 TRP NE1 N Y N 374 TRP CE2 C Y N 375 TRP CE3 C Y N 376 TRP CZ2 C Y N 377 TRP CZ3 C Y N 378 TRP CH2 C Y N 379 TRP OXT O N N 380 TRP H H N N 381 TRP H2 H N N 382 TRP HA H N N 383 TRP HB2 H N N 384 TRP HB3 H N N 385 TRP HD1 H N N 386 TRP HE1 H N N 387 TRP HE3 H N N 388 TRP HZ2 H N N 389 TRP HZ3 H N N 390 TRP HH2 H N N 391 TRP HXT H N N 392 TYR N N N N 393 TYR CA C N S 394 TYR C C N N 395 TYR O O N N 396 TYR CB C N N 397 TYR CG C Y N 398 TYR CD1 C Y N 399 TYR CD2 C Y N 400 TYR CE1 C Y N 401 TYR CE2 C Y N 402 TYR CZ C Y N 403 TYR OH O N N 404 TYR OXT O N N 405 TYR H H N N 406 TYR H2 H N N 407 TYR HA H N N 408 TYR HB2 H N N 409 TYR HB3 H N N 410 TYR HD1 H N N 411 TYR HD2 H N N 412 TYR HE1 H N N 413 TYR HE2 H N N 414 TYR HH H N N 415 TYR HXT H N N 416 VAL N N N N 417 VAL CA C N S 418 VAL C C N N 419 VAL O O N N 420 VAL CB C N N 421 VAL CG1 C N N 422 VAL CG2 C N N 423 VAL OXT O N N 424 VAL H H N N 425 VAL H2 H N N 426 VAL HA H N N 427 VAL HB H N N 428 VAL HG11 H N N 429 VAL HG12 H N N 430 VAL HG13 H N N 431 VAL HG21 H N N 432 VAL HG22 H N N 433 VAL HG23 H N N 434 VAL HXT H N N 435 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BOG C1 O1 sing N N 70 BOG C1 C2 sing N N 71 BOG C1 O5 sing N N 72 BOG C1 H1 sing N N 73 BOG O1 "C1'" sing N N 74 BOG C2 O2 sing N N 75 BOG C2 C3 sing N N 76 BOG C2 H2 sing N N 77 BOG O2 HO2 sing N N 78 BOG C3 O3 sing N N 79 BOG C3 C4 sing N N 80 BOG C3 H3 sing N N 81 BOG O3 HO3 sing N N 82 BOG C4 O4 sing N N 83 BOG C4 C5 sing N N 84 BOG C4 H4 sing N N 85 BOG O4 HO4 sing N N 86 BOG C5 O5 sing N N 87 BOG C5 C6 sing N N 88 BOG C5 H5 sing N N 89 BOG C6 O6 sing N N 90 BOG C6 H61 sing N N 91 BOG C6 H62 sing N N 92 BOG O6 HO6 sing N N 93 BOG "C1'" "C2'" sing N N 94 BOG "C1'" "H1'1" sing N N 95 BOG "C1'" "H1'2" sing N N 96 BOG "C2'" "C3'" sing N N 97 BOG "C2'" "H2'1" sing N N 98 BOG "C2'" "H2'2" sing N N 99 BOG "C3'" "C4'" sing N N 100 BOG "C3'" "H3'1" sing N N 101 BOG "C3'" "H3'2" sing N N 102 BOG "C4'" "C5'" sing N N 103 BOG "C4'" "H4'1" sing N N 104 BOG "C4'" "H4'2" sing N N 105 BOG "C5'" "C6'" sing N N 106 BOG "C5'" "H5'1" sing N N 107 BOG "C5'" "H5'2" sing N N 108 BOG "C6'" "C7'" sing N N 109 BOG "C6'" "H6'1" sing N N 110 BOG "C6'" "H6'2" sing N N 111 BOG "C7'" "C8'" sing N N 112 BOG "C7'" "H7'1" sing N N 113 BOG "C7'" "H7'2" sing N N 114 BOG "C8'" "H8'1" sing N N 115 BOG "C8'" "H8'2" sing N N 116 BOG "C8'" "H8'3" sing N N 117 CYS N CA sing N N 118 CYS N H sing N N 119 CYS N H2 sing N N 120 CYS CA C sing N N 121 CYS CA CB sing N N 122 CYS CA HA sing N N 123 CYS C O doub N N 124 CYS C OXT sing N N 125 CYS CB SG sing N N 126 CYS CB HB2 sing N N 127 CYS CB HB3 sing N N 128 CYS SG HG sing N N 129 CYS OXT HXT sing N N 130 GLN N CA sing N N 131 GLN N H sing N N 132 GLN N H2 sing N N 133 GLN CA C sing N N 134 GLN CA CB sing N N 135 GLN CA HA sing N N 136 GLN C O doub N N 137 GLN C OXT sing N N 138 GLN CB CG sing N N 139 GLN CB HB2 sing N N 140 GLN CB HB3 sing N N 141 GLN CG CD sing N N 142 GLN CG HG2 sing N N 143 GLN CG HG3 sing N N 144 GLN CD OE1 doub N N 145 GLN CD NE2 sing N N 146 GLN NE2 HE21 sing N N 147 GLN NE2 HE22 sing N N 148 GLN OXT HXT sing N N 149 GLU N CA sing N N 150 GLU N H sing N N 151 GLU N H2 sing N N 152 GLU CA C sing N N 153 GLU CA CB sing N N 154 GLU CA HA sing N N 155 GLU C O doub N N 156 GLU C OXT sing N N 157 GLU CB CG sing N N 158 GLU CB HB2 sing N N 159 GLU CB HB3 sing N N 160 GLU CG CD sing N N 161 GLU CG HG2 sing N N 162 GLU CG HG3 sing N N 163 GLU CD OE1 doub N N 164 GLU CD OE2 sing N N 165 GLU OE2 HE2 sing N N 166 GLU OXT HXT sing N N 167 GLY N CA sing N N 168 GLY N H sing N N 169 GLY N H2 sing N N 170 GLY CA C sing N N 171 GLY CA HA2 sing N N 172 GLY CA HA3 sing N N 173 GLY C O doub N N 174 GLY C OXT sing N N 175 GLY OXT HXT sing N N 176 HIS N CA sing N N 177 HIS N H sing N N 178 HIS N H2 sing N N 179 HIS CA C sing N N 180 HIS CA CB sing N N 181 HIS CA HA sing N N 182 HIS C O doub N N 183 HIS C OXT sing N N 184 HIS CB CG sing N N 185 HIS CB HB2 sing N N 186 HIS CB HB3 sing N N 187 HIS CG ND1 sing Y N 188 HIS CG CD2 doub Y N 189 HIS ND1 CE1 doub Y N 190 HIS ND1 HD1 sing N N 191 HIS CD2 NE2 sing Y N 192 HIS CD2 HD2 sing N N 193 HIS CE1 NE2 sing Y N 194 HIS CE1 HE1 sing N N 195 HIS NE2 HE2 sing N N 196 HIS OXT HXT sing N N 197 ILE N CA sing N N 198 ILE N H sing N N 199 ILE N H2 sing N N 200 ILE CA C sing N N 201 ILE CA CB sing N N 202 ILE CA HA sing N N 203 ILE C O doub N N 204 ILE C OXT sing N N 205 ILE CB CG1 sing N N 206 ILE CB CG2 sing N N 207 ILE CB HB sing N N 208 ILE CG1 CD1 sing N N 209 ILE CG1 HG12 sing N N 210 ILE CG1 HG13 sing N N 211 ILE CG2 HG21 sing N N 212 ILE CG2 HG22 sing N N 213 ILE CG2 HG23 sing N N 214 ILE CD1 HD11 sing N N 215 ILE CD1 HD12 sing N N 216 ILE CD1 HD13 sing N N 217 ILE OXT HXT sing N N 218 LEU N CA sing N N 219 LEU N H sing N N 220 LEU N H2 sing N N 221 LEU CA C sing N N 222 LEU CA CB sing N N 223 LEU CA HA sing N N 224 LEU C O doub N N 225 LEU C OXT sing N N 226 LEU CB CG sing N N 227 LEU CB HB2 sing N N 228 LEU CB HB3 sing N N 229 LEU CG CD1 sing N N 230 LEU CG CD2 sing N N 231 LEU CG HG sing N N 232 LEU CD1 HD11 sing N N 233 LEU CD1 HD12 sing N N 234 LEU CD1 HD13 sing N N 235 LEU CD2 HD21 sing N N 236 LEU CD2 HD22 sing N N 237 LEU CD2 HD23 sing N N 238 LEU OXT HXT sing N N 239 LYS N CA sing N N 240 LYS N H sing N N 241 LYS N H2 sing N N 242 LYS CA C sing N N 243 LYS CA CB sing N N 244 LYS CA HA sing N N 245 LYS C O doub N N 246 LYS C OXT sing N N 247 LYS CB CG sing N N 248 LYS CB HB2 sing N N 249 LYS CB HB3 sing N N 250 LYS CG CD sing N N 251 LYS CG HG2 sing N N 252 LYS CG HG3 sing N N 253 LYS CD CE sing N N 254 LYS CD HD2 sing N N 255 LYS CD HD3 sing N N 256 LYS CE NZ sing N N 257 LYS CE HE2 sing N N 258 LYS CE HE3 sing N N 259 LYS NZ HZ1 sing N N 260 LYS NZ HZ2 sing N N 261 LYS NZ HZ3 sing N N 262 LYS OXT HXT sing N N 263 MSE N CA sing N N 264 MSE N H sing N N 265 MSE N H2 sing N N 266 MSE CA C sing N N 267 MSE CA CB sing N N 268 MSE CA HA sing N N 269 MSE C O doub N N 270 MSE C OXT sing N N 271 MSE OXT HXT sing N N 272 MSE CB CG sing N N 273 MSE CB HB2 sing N N 274 MSE CB HB3 sing N N 275 MSE CG SE sing N N 276 MSE CG HG2 sing N N 277 MSE CG HG3 sing N N 278 MSE SE CE sing N N 279 MSE CE HE1 sing N N 280 MSE CE HE2 sing N N 281 MSE CE HE3 sing N N 282 PHE N CA sing N N 283 PHE N H sing N N 284 PHE N H2 sing N N 285 PHE CA C sing N N 286 PHE CA CB sing N N 287 PHE CA HA sing N N 288 PHE C O doub N N 289 PHE C OXT sing N N 290 PHE CB CG sing N N 291 PHE CB HB2 sing N N 292 PHE CB HB3 sing N N 293 PHE CG CD1 doub Y N 294 PHE CG CD2 sing Y N 295 PHE CD1 CE1 sing Y N 296 PHE CD1 HD1 sing N N 297 PHE CD2 CE2 doub Y N 298 PHE CD2 HD2 sing N N 299 PHE CE1 CZ doub Y N 300 PHE CE1 HE1 sing N N 301 PHE CE2 CZ sing Y N 302 PHE CE2 HE2 sing N N 303 PHE CZ HZ sing N N 304 PHE OXT HXT sing N N 305 PRO N CA sing N N 306 PRO N CD sing N N 307 PRO N H sing N N 308 PRO CA C sing N N 309 PRO CA CB sing N N 310 PRO CA HA sing N N 311 PRO C O doub N N 312 PRO C OXT sing N N 313 PRO CB CG sing N N 314 PRO CB HB2 sing N N 315 PRO CB HB3 sing N N 316 PRO CG CD sing N N 317 PRO CG HG2 sing N N 318 PRO CG HG3 sing N N 319 PRO CD HD2 sing N N 320 PRO CD HD3 sing N N 321 PRO OXT HXT sing N N 322 SER N CA sing N N 323 SER N H sing N N 324 SER N H2 sing N N 325 SER CA C sing N N 326 SER CA CB sing N N 327 SER CA HA sing N N 328 SER C O doub N N 329 SER C OXT sing N N 330 SER CB OG sing N N 331 SER CB HB2 sing N N 332 SER CB HB3 sing N N 333 SER OG HG sing N N 334 SER OXT HXT sing N N 335 THR N CA sing N N 336 THR N H sing N N 337 THR N H2 sing N N 338 THR CA C sing N N 339 THR CA CB sing N N 340 THR CA HA sing N N 341 THR C O doub N N 342 THR C OXT sing N N 343 THR CB OG1 sing N N 344 THR CB CG2 sing N N 345 THR CB HB sing N N 346 THR OG1 HG1 sing N N 347 THR CG2 HG21 sing N N 348 THR CG2 HG22 sing N N 349 THR CG2 HG23 sing N N 350 THR OXT HXT sing N N 351 TRP N CA sing N N 352 TRP N H sing N N 353 TRP N H2 sing N N 354 TRP CA C sing N N 355 TRP CA CB sing N N 356 TRP CA HA sing N N 357 TRP C O doub N N 358 TRP C OXT sing N N 359 TRP CB CG sing N N 360 TRP CB HB2 sing N N 361 TRP CB HB3 sing N N 362 TRP CG CD1 doub Y N 363 TRP CG CD2 sing Y N 364 TRP CD1 NE1 sing Y N 365 TRP CD1 HD1 sing N N 366 TRP CD2 CE2 doub Y N 367 TRP CD2 CE3 sing Y N 368 TRP NE1 CE2 sing Y N 369 TRP NE1 HE1 sing N N 370 TRP CE2 CZ2 sing Y N 371 TRP CE3 CZ3 doub Y N 372 TRP CE3 HE3 sing N N 373 TRP CZ2 CH2 doub Y N 374 TRP CZ2 HZ2 sing N N 375 TRP CZ3 CH2 sing Y N 376 TRP CZ3 HZ3 sing N N 377 TRP CH2 HH2 sing N N 378 TRP OXT HXT sing N N 379 TYR N CA sing N N 380 TYR N H sing N N 381 TYR N H2 sing N N 382 TYR CA C sing N N 383 TYR CA CB sing N N 384 TYR CA HA sing N N 385 TYR C O doub N N 386 TYR C OXT sing N N 387 TYR CB CG sing N N 388 TYR CB HB2 sing N N 389 TYR CB HB3 sing N N 390 TYR CG CD1 doub Y N 391 TYR CG CD2 sing Y N 392 TYR CD1 CE1 sing Y N 393 TYR CD1 HD1 sing N N 394 TYR CD2 CE2 doub Y N 395 TYR CD2 HD2 sing N N 396 TYR CE1 CZ doub Y N 397 TYR CE1 HE1 sing N N 398 TYR CE2 CZ sing Y N 399 TYR CE2 HE2 sing N N 400 TYR CZ OH sing N N 401 TYR OH HH sing N N 402 TYR OXT HXT sing N N 403 VAL N CA sing N N 404 VAL N H sing N N 405 VAL N H2 sing N N 406 VAL CA C sing N N 407 VAL CA CB sing N N 408 VAL CA HA sing N N 409 VAL C O doub N N 410 VAL C OXT sing N N 411 VAL CB CG1 sing N N 412 VAL CB CG2 sing N N 413 VAL CB HB sing N N 414 VAL CG1 HG11 sing N N 415 VAL CG1 HG12 sing N N 416 VAL CG1 HG13 sing N N 417 VAL CG2 HG21 sing N N 418 VAL CG2 HG22 sing N N 419 VAL CG2 HG23 sing N N 420 VAL OXT HXT sing N N 421 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of Diabetes and Digestive and Kidney Disease (NIH/NIDDK)' 'United States' R01DK088057 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R01GM098878 2 'American Heart Association' 'United States' 12EIA8850017 3 'Cancer Prevention and Research Institute of Texas (CPRIT)' 'United States' R12MZ 4 # _atom_sites.entry_id 4TQ5 _atom_sites.fract_transf_matrix[1][1] 0.016149 _atom_sites.fract_transf_matrix[1][2] 0.009324 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018648 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004020 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE # loop_