data_4TZ2 # _entry.id 4TZ2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4TZ2 pdb_00004tz2 10.2210/pdb4tz2/pdb WWPDB D_1000202550 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 4TYL PDB . unspecified 4TZ8 PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4TZ2 _pdbx_database_status.recvd_initial_deposition_date 2014-07-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Harner, M.J.' 1 'Chauder, B.A.' 2 'Phan, J.' 3 'Fesik, S.W.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 57 _citation.language ? _citation.page_first 9687 _citation.page_last 9692 _citation.title 'Fragment-Based Screening of the Bromodomain of ATAD2.' _citation.year 2014 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jm501035j _citation.pdbx_database_id_PubMed 25314628 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Harner, M.J.' 1 ? primary 'Chauder, B.A.' 2 ? primary 'Phan, J.' 3 ? primary 'Fesik, S.W.' 4 ? # _cell.entry_id 4TZ2 _cell.length_a 79.203 _cell.length_b 79.203 _cell.length_c 136.036 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4TZ2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ATPase family AAA domain-containing protein 2' 15469.516 1 3.6.1.3 ? 'UNP residues 981-1108' ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143 1 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 5 non-polymer syn '3-(5-phenyl-4H-1,2,4-triazol-3-yl)aniline' 236.272 1 ? ? ? ? 6 water nat water 18.015 200 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'AAA nuclear coregulator cancer-associated protein,ANCCA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICS NALEYNPDRDPGDRLIRHRA(CSO)ALRDTAYAIIKEELDEDFEQLCEEIQESR ; _entity_poly.pdbx_seq_one_letter_code_can ;SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICS NALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 GLN n 1 4 GLU n 1 5 GLU n 1 6 ASP n 1 7 THR n 1 8 PHE n 1 9 ARG n 1 10 GLU n 1 11 LEU n 1 12 ARG n 1 13 ILE n 1 14 PHE n 1 15 LEU n 1 16 ARG n 1 17 ASN n 1 18 VAL n 1 19 THR n 1 20 HIS n 1 21 ARG n 1 22 LEU n 1 23 ALA n 1 24 ILE n 1 25 ASP n 1 26 LYS n 1 27 ARG n 1 28 PHE n 1 29 ARG n 1 30 VAL n 1 31 PHE n 1 32 THR n 1 33 LYS n 1 34 PRO n 1 35 VAL n 1 36 ASP n 1 37 PRO n 1 38 ASP n 1 39 GLU n 1 40 VAL n 1 41 PRO n 1 42 ASP n 1 43 TYR n 1 44 VAL n 1 45 THR n 1 46 VAL n 1 47 ILE n 1 48 LYS n 1 49 GLN n 1 50 PRO n 1 51 MET n 1 52 ASP n 1 53 LEU n 1 54 SER n 1 55 SER n 1 56 VAL n 1 57 ILE n 1 58 SER n 1 59 LYS n 1 60 ILE n 1 61 ASP n 1 62 LEU n 1 63 HIS n 1 64 LYS n 1 65 TYR n 1 66 LEU n 1 67 THR n 1 68 VAL n 1 69 LYS n 1 70 ASP n 1 71 TYR n 1 72 LEU n 1 73 ARG n 1 74 ASP n 1 75 ILE n 1 76 ASP n 1 77 LEU n 1 78 ILE n 1 79 CYS n 1 80 SER n 1 81 ASN n 1 82 ALA n 1 83 LEU n 1 84 GLU n 1 85 TYR n 1 86 ASN n 1 87 PRO n 1 88 ASP n 1 89 ARG n 1 90 ASP n 1 91 PRO n 1 92 GLY n 1 93 ASP n 1 94 ARG n 1 95 LEU n 1 96 ILE n 1 97 ARG n 1 98 HIS n 1 99 ARG n 1 100 ALA n 1 101 CSO n 1 102 ALA n 1 103 LEU n 1 104 ARG n 1 105 ASP n 1 106 THR n 1 107 ALA n 1 108 TYR n 1 109 ALA n 1 110 ILE n 1 111 ILE n 1 112 LYS n 1 113 GLU n 1 114 GLU n 1 115 LEU n 1 116 ASP n 1 117 GLU n 1 118 ASP n 1 119 PHE n 1 120 GLU n 1 121 GLN n 1 122 LEU n 1 123 CYS n 1 124 GLU n 1 125 GLU n 1 126 ILE n 1 127 GLN n 1 128 GLU n 1 129 SER n 1 130 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 130 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ATAD2, L16, PRO2000' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) GOLD' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATAD2_HUMAN _struct_ref.pdbx_db_accession Q6PL18 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNA LEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR ; _struct_ref.pdbx_align_begin 981 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4TZ2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6PL18 _struct_ref_seq.db_align_beg 981 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 981 _struct_ref_seq.pdbx_auth_seq_align_end 1108 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4TZ2 SER A 1 ? UNP Q6PL18 ? ? 'expression tag' 979 1 1 4TZ2 MET A 2 ? UNP Q6PL18 ? ? 'expression tag' 980 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 39R non-polymer . '3-(5-phenyl-4H-1,2,4-triazol-3-yl)aniline' ? 'C14 H12 N4' 236.272 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CSO 'L-peptide linking' n S-HYDROXYCYSTEINE ? 'C3 H7 N O3 S' 137.158 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRS non-polymer . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1' 122.143 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4TZ2 _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.98 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 69.10 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Bis-Tris, pH 6.0, 2.2 M (NH4)2SO4, 10% glycerol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-02-02 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-F' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-F _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4TZ2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.70 _reflns.d_resolution_low 38.02 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 28313 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 23.4 _reflns.pdbx_Rmerge_I_obs 0.071 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.106 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.89 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.70 _reflns_shell.d_res_low 1.73 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 7.41 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4TZ2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.70 _refine.ls_d_res_low 38.02 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 28309 _refine.ls_number_reflns_R_free 2000 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.95 _refine.ls_percent_reflns_R_free 7.06 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1713 _refine.ls_R_factor_R_free 0.2011 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1690 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 3DAI' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 18.45 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.15 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1085 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.number_atoms_solvent 200 _refine_hist.number_atoms_total 1318 _refine_hist.d_res_high 1.70 _refine_hist.d_res_low 38.02 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.019 ? 1185 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.607 ? 1610 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 19.153 ? 472 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.081 ? 175 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 213 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error 'X-RAY DIFFRACTION' 1.70 1.7460 . . 139 1835 100.00 . . . 0.2387 . 0.1657 . . . . . . . . 'X-RAY DIFFRACTION' 1.7460 1.7932 . . 140 1836 100.00 . . . 0.2145 . 0.1533 . . . . . . . . 'X-RAY DIFFRACTION' 1.7932 1.8460 . . 140 1845 100.00 . . . 0.2082 . 0.1688 . . . . . . . . 'X-RAY DIFFRACTION' 1.8460 1.9056 . . 140 1834 100.00 . . . 0.2221 . 0.1604 . . . . . . . . 'X-RAY DIFFRACTION' 1.9056 1.9737 . . 140 1851 100.00 . . . 0.2085 . 0.1691 . . . . . . . . 'X-RAY DIFFRACTION' 1.9737 2.0527 . . 141 1842 100.00 . . . 0.2101 . 0.1677 . . . . . . . . 'X-RAY DIFFRACTION' 2.0527 2.1461 . . 141 1863 100.00 . . . 0.2313 . 0.1587 . . . . . . . . 'X-RAY DIFFRACTION' 2.1461 2.2593 . . 141 1849 100.00 . . . 0.1700 . 0.1481 . . . . . . . . 'X-RAY DIFFRACTION' 2.2593 2.4008 . . 142 1876 100.00 . . . 0.1735 . 0.1541 . . . . . . . . 'X-RAY DIFFRACTION' 2.4008 2.5861 . . 142 1862 100.00 . . . 0.2153 . 0.1623 . . . . . . . . 'X-RAY DIFFRACTION' 2.5861 2.8463 . . 144 1895 100.00 . . . 0.2051 . 0.1793 . . . . . . . . 'X-RAY DIFFRACTION' 2.8463 3.2580 . . 145 1906 100.00 . . . 0.1929 . 0.1765 . . . . . . . . 'X-RAY DIFFRACTION' 3.2580 4.1039 . . 147 1942 100.00 . . . 0.1965 . 0.1587 . . . . . . . . 'X-RAY DIFFRACTION' 4.1039 38.0326 . . 158 2073 100.00 . . . 0.2023 . 0.1896 . . . . . . . . # _struct.entry_id 4TZ2 _struct.pdbx_CASP_flag ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_details ? _struct.pdbx_model_type_details ? _struct.title 'Fragment-Based Screening of the Bromodomain of ATAD2' # _struct_keywords.entry_id 4TZ2 _struct_keywords.text 'ATAD2, Bromodomain, Hydrolase-Hydrolase inhibitor complex' _struct_keywords.pdbx_keywords 'Hydrolase/Hydrolase inhibitor' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? G N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 1 ? ILE A 24 ? SER A 979 ILE A 1002 1 ? 24 HELX_P HELX_P2 AA2 ASP A 25 ? THR A 32 ? ASP A 1003 THR A 1010 5 ? 8 HELX_P HELX_P3 AA3 ASP A 42 ? ILE A 47 ? ASP A 1020 ILE A 1025 1 ? 6 HELX_P HELX_P4 AA4 ASP A 52 ? LEU A 62 ? ASP A 1030 LEU A 1040 1 ? 11 HELX_P HELX_P5 AA5 THR A 67 ? ASN A 86 ? THR A 1045 ASN A 1064 1 ? 20 HELX_P HELX_P6 AA6 ASP A 90 ? LEU A 115 ? ASP A 1068 LEU A 1093 1 ? 26 HELX_P HELX_P7 AA7 ASP A 116 ? ARG A 130 ? ASP A 1094 ARG A 1108 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ALA 100 C ? ? ? 1_555 A CSO 101 N ? ? A ALA 1078 A CSO 1079 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale2 covale both ? A CSO 101 C ? ? ? 1_555 A ALA 102 N ? ? A CSO 1079 A ALA 1080 1_555 ? ? ? ? ? ? ? 1.326 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 1201 ? 6 'binding site for residue SO4 A 1201' AC2 Software A TRS 1202 ? 10 'binding site for residue TRS A 1202' AC3 Software A CL 1203 ? 3 'binding site for residue CL A 1203' AC4 Software A CL 1204 ? 1 'binding site for residue CL A 1204' AC5 Software A 39R 1205 ? 9 'binding site for residue 39R A 1205' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ARG A 9 ? ARG A 987 . ? 1_555 ? 2 AC1 6 ARG A 12 ? ARG A 990 . ? 1_555 ? 3 AC1 6 ARG A 16 ? ARG A 994 . ? 1_555 ? 4 AC1 6 ARG A 89 ? ARG A 1067 . ? 6_444 ? 5 AC1 6 ARG A 94 ? ARG A 1072 . ? 6_444 ? 6 AC1 6 HOH G . ? HOH A 1360 . ? 1_555 ? 7 AC2 10 GLU A 10 ? GLU A 988 . ? 1_555 ? 8 AC2 10 PRO A 91 ? PRO A 1069 . ? 8_445 ? 9 AC2 10 GLU A 114 ? GLU A 1092 . ? 1_555 ? 10 AC2 10 LEU A 115 ? LEU A 1093 . ? 1_555 ? 11 AC2 10 ASP A 116 ? ASP A 1094 . ? 1_555 ? 12 AC2 10 PHE A 119 ? PHE A 1097 . ? 1_555 ? 13 AC2 10 HOH G . ? HOH A 1326 . ? 1_555 ? 14 AC2 10 HOH G . ? HOH A 1327 . ? 1_555 ? 15 AC2 10 HOH G . ? HOH A 1336 . ? 12_544 ? 16 AC2 10 HOH G . ? HOH A 1357 . ? 1_555 ? 17 AC3 3 ARG A 99 ? ARG A 1077 . ? 1_555 ? 18 AC3 3 HOH G . ? HOH A 1358 . ? 1_555 ? 19 AC3 3 HOH G . ? HOH A 1367 . ? 1_555 ? 20 AC4 1 ARG A 89 ? ARG A 1067 . ? 1_555 ? 21 AC5 9 VAL A 30 ? VAL A 1008 . ? 1_555 ? 22 AC5 9 TYR A 43 ? TYR A 1021 . ? 1_555 ? 23 AC5 9 MET A 51 ? MET A 1029 . ? 1_555 ? 24 AC5 9 ILE A 78 ? ILE A 1056 . ? 1_555 ? 25 AC5 9 ASN A 81 ? ASN A 1059 . ? 1_555 ? 26 AC5 9 ASN A 86 ? ASN A 1064 . ? 1_555 ? 27 AC5 9 ILE A 96 ? ILE A 1074 . ? 1_555 ? 28 AC5 9 HOH G . ? HOH A 1395 . ? 1_555 ? 29 AC5 9 HOH G . ? HOH A 1471 . ? 1_555 ? # _atom_sites.entry_id 4TZ2 _atom_sites.fract_transf_matrix[1][1] 0.012626 _atom_sites.fract_transf_matrix[1][2] 0.007290 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014579 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007351 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 979 979 SER SER A . n A 1 2 MET 2 980 980 MET MET A . n A 1 3 GLN 3 981 981 GLN GLN A . n A 1 4 GLU 4 982 982 GLU GLU A . n A 1 5 GLU 5 983 983 GLU GLU A . n A 1 6 ASP 6 984 984 ASP ASP A . n A 1 7 THR 7 985 985 THR THR A . n A 1 8 PHE 8 986 986 PHE PHE A . n A 1 9 ARG 9 987 987 ARG ARG A . n A 1 10 GLU 10 988 988 GLU GLU A . n A 1 11 LEU 11 989 989 LEU LEU A . n A 1 12 ARG 12 990 990 ARG ARG A . n A 1 13 ILE 13 991 991 ILE ILE A . n A 1 14 PHE 14 992 992 PHE PHE A . n A 1 15 LEU 15 993 993 LEU LEU A . n A 1 16 ARG 16 994 994 ARG ARG A . n A 1 17 ASN 17 995 995 ASN ASN A . n A 1 18 VAL 18 996 996 VAL VAL A . n A 1 19 THR 19 997 997 THR THR A . n A 1 20 HIS 20 998 998 HIS HIS A . n A 1 21 ARG 21 999 999 ARG ARG A . n A 1 22 LEU 22 1000 1000 LEU LEU A . n A 1 23 ALA 23 1001 1001 ALA ALA A . n A 1 24 ILE 24 1002 1002 ILE ILE A . n A 1 25 ASP 25 1003 1003 ASP ASP A . n A 1 26 LYS 26 1004 1004 LYS LYS A . n A 1 27 ARG 27 1005 1005 ARG ARG A . n A 1 28 PHE 28 1006 1006 PHE PHE A . n A 1 29 ARG 29 1007 1007 ARG ARG A . n A 1 30 VAL 30 1008 1008 VAL VAL A . n A 1 31 PHE 31 1009 1009 PHE PHE A . n A 1 32 THR 32 1010 1010 THR THR A . n A 1 33 LYS 33 1011 1011 LYS LYS A . n A 1 34 PRO 34 1012 1012 PRO PRO A . n A 1 35 VAL 35 1013 1013 VAL VAL A . n A 1 36 ASP 36 1014 1014 ASP ASP A . n A 1 37 PRO 37 1015 1015 PRO PRO A . n A 1 38 ASP 38 1016 1016 ASP ASP A . n A 1 39 GLU 39 1017 1017 GLU GLU A . n A 1 40 VAL 40 1018 1018 VAL VAL A . n A 1 41 PRO 41 1019 1019 PRO PRO A . n A 1 42 ASP 42 1020 1020 ASP ASP A . n A 1 43 TYR 43 1021 1021 TYR TYR A . n A 1 44 VAL 44 1022 1022 VAL VAL A . n A 1 45 THR 45 1023 1023 THR THR A . n A 1 46 VAL 46 1024 1024 VAL VAL A . n A 1 47 ILE 47 1025 1025 ILE ILE A . n A 1 48 LYS 48 1026 1026 LYS LYS A . n A 1 49 GLN 49 1027 1027 GLN GLN A . n A 1 50 PRO 50 1028 1028 PRO PRO A . n A 1 51 MET 51 1029 1029 MET MET A . n A 1 52 ASP 52 1030 1030 ASP ASP A . n A 1 53 LEU 53 1031 1031 LEU LEU A . n A 1 54 SER 54 1032 1032 SER SER A . n A 1 55 SER 55 1033 1033 SER SER A . n A 1 56 VAL 56 1034 1034 VAL VAL A . n A 1 57 ILE 57 1035 1035 ILE ILE A . n A 1 58 SER 58 1036 1036 SER SER A . n A 1 59 LYS 59 1037 1037 LYS LYS A . n A 1 60 ILE 60 1038 1038 ILE ILE A . n A 1 61 ASP 61 1039 1039 ASP ASP A . n A 1 62 LEU 62 1040 1040 LEU LEU A . n A 1 63 HIS 63 1041 1041 HIS HIS A . n A 1 64 LYS 64 1042 1042 LYS LYS A . n A 1 65 TYR 65 1043 1043 TYR TYR A . n A 1 66 LEU 66 1044 1044 LEU LEU A . n A 1 67 THR 67 1045 1045 THR THR A . n A 1 68 VAL 68 1046 1046 VAL VAL A . n A 1 69 LYS 69 1047 1047 LYS LYS A . n A 1 70 ASP 70 1048 1048 ASP ASP A . n A 1 71 TYR 71 1049 1049 TYR TYR A . n A 1 72 LEU 72 1050 1050 LEU LEU A . n A 1 73 ARG 73 1051 1051 ARG ARG A . n A 1 74 ASP 74 1052 1052 ASP ASP A . n A 1 75 ILE 75 1053 1053 ILE ILE A . n A 1 76 ASP 76 1054 1054 ASP ASP A . n A 1 77 LEU 77 1055 1055 LEU LEU A . n A 1 78 ILE 78 1056 1056 ILE ILE A . n A 1 79 CYS 79 1057 1057 CYS CYS A . n A 1 80 SER 80 1058 1058 SER SER A . n A 1 81 ASN 81 1059 1059 ASN ASN A . n A 1 82 ALA 82 1060 1060 ALA ALA A . n A 1 83 LEU 83 1061 1061 LEU LEU A . n A 1 84 GLU 84 1062 1062 GLU GLU A . n A 1 85 TYR 85 1063 1063 TYR TYR A . n A 1 86 ASN 86 1064 1064 ASN ASN A . n A 1 87 PRO 87 1065 1065 PRO PRO A . n A 1 88 ASP 88 1066 1066 ASP ASP A . n A 1 89 ARG 89 1067 1067 ARG ARG A . n A 1 90 ASP 90 1068 1068 ASP ASP A . n A 1 91 PRO 91 1069 1069 PRO PRO A . n A 1 92 GLY 92 1070 1070 GLY GLY A . n A 1 93 ASP 93 1071 1071 ASP ASP A . n A 1 94 ARG 94 1072 1072 ARG ARG A . n A 1 95 LEU 95 1073 1073 LEU LEU A . n A 1 96 ILE 96 1074 1074 ILE ILE A . n A 1 97 ARG 97 1075 1075 ARG ARG A . n A 1 98 HIS 98 1076 1076 HIS HIS A . n A 1 99 ARG 99 1077 1077 ARG ARG A . n A 1 100 ALA 100 1078 1078 ALA ALA A . n A 1 101 CSO 101 1079 1079 CSO CSO A . n A 1 102 ALA 102 1080 1080 ALA ALA A . n A 1 103 LEU 103 1081 1081 LEU LEU A . n A 1 104 ARG 104 1082 1082 ARG ARG A . n A 1 105 ASP 105 1083 1083 ASP ASP A . n A 1 106 THR 106 1084 1084 THR THR A . n A 1 107 ALA 107 1085 1085 ALA ALA A . n A 1 108 TYR 108 1086 1086 TYR TYR A . n A 1 109 ALA 109 1087 1087 ALA ALA A . n A 1 110 ILE 110 1088 1088 ILE ILE A . n A 1 111 ILE 111 1089 1089 ILE ILE A . n A 1 112 LYS 112 1090 1090 LYS LYS A . n A 1 113 GLU 113 1091 1091 GLU GLU A . n A 1 114 GLU 114 1092 1092 GLU GLU A . n A 1 115 LEU 115 1093 1093 LEU LEU A . n A 1 116 ASP 116 1094 1094 ASP ASP A . n A 1 117 GLU 117 1095 1095 GLU GLU A . n A 1 118 ASP 118 1096 1096 ASP ASP A . n A 1 119 PHE 119 1097 1097 PHE PHE A . n A 1 120 GLU 120 1098 1098 GLU GLU A . n A 1 121 GLN 121 1099 1099 GLN GLN A . n A 1 122 LEU 122 1100 1100 LEU LEU A . n A 1 123 CYS 123 1101 1101 CYS CYS A . n A 1 124 GLU 124 1102 1102 GLU GLU A . n A 1 125 GLU 125 1103 1103 GLU GLU A . n A 1 126 ILE 126 1104 1104 ILE ILE A . n A 1 127 GLN 127 1105 1105 GLN GLN A . n A 1 128 GLU 128 1106 1106 GLU GLU A . n A 1 129 SER 129 1107 1107 SER SER A . n A 1 130 ARG 130 1108 1108 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 1201 1 SO4 SO4 A . C 3 TRS 1 1202 1 TRS TRS A . D 4 CL 1 1203 1 CL CL A . E 4 CL 1 1204 2 CL CL A . F 5 39R 1 1205 1 39R DRG A . G 6 HOH 1 1301 155 HOH HOH A . G 6 HOH 2 1302 174 HOH HOH A . G 6 HOH 3 1303 74 HOH HOH A . G 6 HOH 4 1304 188 HOH HOH A . G 6 HOH 5 1305 191 HOH HOH A . G 6 HOH 6 1306 133 HOH HOH A . G 6 HOH 7 1307 152 HOH HOH A . G 6 HOH 8 1308 151 HOH HOH A . G 6 HOH 9 1309 47 HOH HOH A . G 6 HOH 10 1310 57 HOH HOH A . G 6 HOH 11 1311 17 HOH HOH A . G 6 HOH 12 1312 26 HOH HOH A . G 6 HOH 13 1313 64 HOH HOH A . G 6 HOH 14 1314 23 HOH HOH A . G 6 HOH 15 1315 90 HOH HOH A . G 6 HOH 16 1316 48 HOH HOH A . G 6 HOH 17 1317 35 HOH HOH A . G 6 HOH 18 1318 80 HOH HOH A . G 6 HOH 19 1319 110 HOH HOH A . G 6 HOH 20 1320 73 HOH HOH A . G 6 HOH 21 1321 158 HOH HOH A . G 6 HOH 22 1322 114 HOH HOH A . G 6 HOH 23 1323 11 HOH HOH A . G 6 HOH 24 1324 103 HOH HOH A . G 6 HOH 25 1325 15 HOH HOH A . G 6 HOH 26 1326 3 HOH HOH A . G 6 HOH 27 1327 42 HOH HOH A . G 6 HOH 28 1328 27 HOH HOH A . G 6 HOH 29 1329 123 HOH HOH A . G 6 HOH 30 1330 109 HOH HOH A . G 6 HOH 31 1331 79 HOH HOH A . G 6 HOH 32 1332 4 HOH HOH A . G 6 HOH 33 1333 86 HOH HOH A . G 6 HOH 34 1334 62 HOH HOH A . G 6 HOH 35 1335 5 HOH HOH A . G 6 HOH 36 1336 153 HOH HOH A . G 6 HOH 37 1337 127 HOH HOH A . G 6 HOH 38 1338 77 HOH HOH A . G 6 HOH 39 1339 2 HOH HOH A . G 6 HOH 40 1340 144 HOH HOH A . G 6 HOH 41 1341 21 HOH HOH A . G 6 HOH 42 1342 46 HOH HOH A . G 6 HOH 43 1343 69 HOH HOH A . G 6 HOH 44 1344 8 HOH HOH A . G 6 HOH 45 1345 157 HOH HOH A . G 6 HOH 46 1346 51 HOH HOH A . G 6 HOH 47 1347 88 HOH HOH A . G 6 HOH 48 1348 193 HOH HOH A . G 6 HOH 49 1349 18 HOH HOH A . G 6 HOH 50 1350 94 HOH HOH A . G 6 HOH 51 1351 111 HOH HOH A . G 6 HOH 52 1352 190 HOH HOH A . G 6 HOH 53 1353 189 HOH HOH A . G 6 HOH 54 1354 172 HOH HOH A . G 6 HOH 55 1355 171 HOH HOH A . G 6 HOH 56 1356 186 HOH HOH A . G 6 HOH 57 1357 143 HOH HOH A . G 6 HOH 58 1358 156 HOH HOH A . G 6 HOH 59 1359 50 HOH HOH A . G 6 HOH 60 1360 106 HOH HOH A . G 6 HOH 61 1361 136 HOH HOH A . G 6 HOH 62 1362 134 HOH HOH A . G 6 HOH 63 1363 165 HOH HOH A . G 6 HOH 64 1364 154 HOH HOH A . G 6 HOH 65 1365 159 HOH HOH A . G 6 HOH 66 1366 142 HOH HOH A . G 6 HOH 67 1367 182 HOH HOH A . G 6 HOH 68 1368 39 HOH HOH A . G 6 HOH 69 1369 32 HOH HOH A . G 6 HOH 70 1370 124 HOH HOH A . G 6 HOH 71 1371 173 HOH HOH A . G 6 HOH 72 1372 83 HOH HOH A . G 6 HOH 73 1373 117 HOH HOH A . G 6 HOH 74 1374 166 HOH HOH A . G 6 HOH 75 1375 28 HOH HOH A . G 6 HOH 76 1376 96 HOH HOH A . G 6 HOH 77 1377 184 HOH HOH A . G 6 HOH 78 1378 93 HOH HOH A . G 6 HOH 79 1379 119 HOH HOH A . G 6 HOH 80 1380 200 HOH HOH A . G 6 HOH 81 1381 45 HOH HOH A . G 6 HOH 82 1382 43 HOH HOH A . G 6 HOH 83 1383 129 HOH HOH A . G 6 HOH 84 1384 102 HOH HOH A . G 6 HOH 85 1385 167 HOH HOH A . G 6 HOH 86 1386 49 HOH HOH A . G 6 HOH 87 1387 196 HOH HOH A . G 6 HOH 88 1388 130 HOH HOH A . G 6 HOH 89 1389 180 HOH HOH A . G 6 HOH 90 1390 1 HOH HOH A . G 6 HOH 91 1391 6 HOH HOH A . G 6 HOH 92 1392 7 HOH HOH A . G 6 HOH 93 1393 9 HOH HOH A . G 6 HOH 94 1394 10 HOH HOH A . G 6 HOH 95 1395 12 HOH HOH A . G 6 HOH 96 1396 13 HOH HOH A . G 6 HOH 97 1397 14 HOH HOH A . G 6 HOH 98 1398 16 HOH HOH A . G 6 HOH 99 1399 19 HOH HOH A . G 6 HOH 100 1400 20 HOH HOH A . G 6 HOH 101 1401 22 HOH HOH A . G 6 HOH 102 1402 24 HOH HOH A . G 6 HOH 103 1403 25 HOH HOH A . G 6 HOH 104 1404 29 HOH HOH A . G 6 HOH 105 1405 30 HOH HOH A . G 6 HOH 106 1406 31 HOH HOH A . G 6 HOH 107 1407 33 HOH HOH A . G 6 HOH 108 1408 34 HOH HOH A . G 6 HOH 109 1409 36 HOH HOH A . G 6 HOH 110 1410 37 HOH HOH A . G 6 HOH 111 1411 38 HOH HOH A . G 6 HOH 112 1412 40 HOH HOH A . G 6 HOH 113 1413 41 HOH HOH A . G 6 HOH 114 1414 44 HOH HOH A . G 6 HOH 115 1415 52 HOH HOH A . G 6 HOH 116 1416 53 HOH HOH A . G 6 HOH 117 1417 54 HOH HOH A . G 6 HOH 118 1418 55 HOH HOH A . G 6 HOH 119 1419 56 HOH HOH A . G 6 HOH 120 1420 58 HOH HOH A . G 6 HOH 121 1421 59 HOH HOH A . G 6 HOH 122 1422 60 HOH HOH A . G 6 HOH 123 1423 61 HOH HOH A . G 6 HOH 124 1424 63 HOH HOH A . G 6 HOH 125 1425 65 HOH HOH A . G 6 HOH 126 1426 66 HOH HOH A . G 6 HOH 127 1427 67 HOH HOH A . G 6 HOH 128 1428 68 HOH HOH A . G 6 HOH 129 1429 70 HOH HOH A . G 6 HOH 130 1430 71 HOH HOH A . G 6 HOH 131 1431 72 HOH HOH A . G 6 HOH 132 1432 75 HOH HOH A . G 6 HOH 133 1433 76 HOH HOH A . G 6 HOH 134 1434 78 HOH HOH A . G 6 HOH 135 1435 81 HOH HOH A . G 6 HOH 136 1436 82 HOH HOH A . G 6 HOH 137 1437 84 HOH HOH A . G 6 HOH 138 1438 85 HOH HOH A . G 6 HOH 139 1439 87 HOH HOH A . G 6 HOH 140 1440 89 HOH HOH A . G 6 HOH 141 1441 91 HOH HOH A . G 6 HOH 142 1442 92 HOH HOH A . G 6 HOH 143 1443 95 HOH HOH A . G 6 HOH 144 1444 97 HOH HOH A . G 6 HOH 145 1445 98 HOH HOH A . G 6 HOH 146 1446 99 HOH HOH A . G 6 HOH 147 1447 100 HOH HOH A . G 6 HOH 148 1448 101 HOH HOH A . G 6 HOH 149 1449 104 HOH HOH A . G 6 HOH 150 1450 105 HOH HOH A . G 6 HOH 151 1451 107 HOH HOH A . G 6 HOH 152 1452 108 HOH HOH A . G 6 HOH 153 1453 112 HOH HOH A . G 6 HOH 154 1454 113 HOH HOH A . G 6 HOH 155 1455 115 HOH HOH A . G 6 HOH 156 1456 116 HOH HOH A . G 6 HOH 157 1457 118 HOH HOH A . G 6 HOH 158 1458 120 HOH HOH A . G 6 HOH 159 1459 121 HOH HOH A . G 6 HOH 160 1460 122 HOH HOH A . G 6 HOH 161 1461 125 HOH HOH A . G 6 HOH 162 1462 126 HOH HOH A . G 6 HOH 163 1463 128 HOH HOH A . G 6 HOH 164 1464 131 HOH HOH A . G 6 HOH 165 1465 132 HOH HOH A . G 6 HOH 166 1466 135 HOH HOH A . G 6 HOH 167 1467 137 HOH HOH A . G 6 HOH 168 1468 138 HOH HOH A . G 6 HOH 169 1469 139 HOH HOH A . G 6 HOH 170 1470 140 HOH HOH A . G 6 HOH 171 1471 141 HOH HOH A . G 6 HOH 172 1472 145 HOH HOH A . G 6 HOH 173 1473 146 HOH HOH A . G 6 HOH 174 1474 147 HOH HOH A . G 6 HOH 175 1475 148 HOH HOH A . G 6 HOH 176 1476 149 HOH HOH A . G 6 HOH 177 1477 150 HOH HOH A . G 6 HOH 178 1478 160 HOH HOH A . G 6 HOH 179 1479 161 HOH HOH A . G 6 HOH 180 1480 162 HOH HOH A . G 6 HOH 181 1481 163 HOH HOH A . G 6 HOH 182 1482 164 HOH HOH A . G 6 HOH 183 1483 168 HOH HOH A . G 6 HOH 184 1484 169 HOH HOH A . G 6 HOH 185 1485 170 HOH HOH A . G 6 HOH 186 1486 175 HOH HOH A . G 6 HOH 187 1487 176 HOH HOH A . G 6 HOH 188 1488 177 HOH HOH A . G 6 HOH 189 1489 178 HOH HOH A . G 6 HOH 190 1490 179 HOH HOH A . G 6 HOH 191 1491 181 HOH HOH A . G 6 HOH 192 1492 183 HOH HOH A . G 6 HOH 193 1493 185 HOH HOH A . G 6 HOH 194 1494 187 HOH HOH A . G 6 HOH 195 1495 192 HOH HOH A . G 6 HOH 196 1496 194 HOH HOH A . G 6 HOH 197 1497 195 HOH HOH A . G 6 HOH 198 1498 197 HOH HOH A . G 6 HOH 199 1499 198 HOH HOH A . G 6 HOH 200 1500 199 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CSO _pdbx_struct_mod_residue.label_seq_id 101 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CSO _pdbx_struct_mod_residue.auth_seq_id 1079 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 1342 ? G HOH . 2 1 A HOH 1387 ? G HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-10-29 2 'Structure model' 1 1 2014-12-03 3 'Structure model' 1 2 2015-02-04 4 'Structure model' 1 3 2017-09-06 5 'Structure model' 1 4 2017-11-22 6 'Structure model' 1 5 2019-12-04 7 'Structure model' 1 6 2023-09-27 8 'Structure model' 1 7 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Derived calculations' 3 4 'Structure model' Advisory 4 4 'Structure model' 'Author supporting evidence' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' Other 8 4 'Structure model' 'Source and taxonomy' 9 5 'Structure model' 'Refinement description' 10 6 'Structure model' 'Author supporting evidence' 11 7 'Structure model' 'Data collection' 12 7 'Structure model' 'Database references' 13 7 'Structure model' 'Refinement description' 14 8 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' entity_src_gen 3 4 'Structure model' pdbx_audit_support 4 4 'Structure model' pdbx_database_status 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' pdbx_validate_close_contact 7 4 'Structure model' pdbx_validate_symm_contact 8 5 'Structure model' software 9 6 'Structure model' pdbx_audit_support 10 7 'Structure model' chem_comp_atom 11 7 'Structure model' chem_comp_bond 12 7 'Structure model' database_2 13 7 'Structure model' pdbx_initial_refinement_model 14 7 'Structure model' refine_hist 15 8 'Structure model' chem_comp_atom 16 8 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_id_CSD' 2 4 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 3 4 'Structure model' '_pdbx_audit_support.funding_organization' 4 4 'Structure model' '_pdbx_database_status.pdb_format_compatible' 5 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 6 4 'Structure model' '_pdbx_validate_symm_contact.auth_seq_id_1' 7 4 'Structure model' '_pdbx_validate_symm_contact.auth_seq_id_2' 8 4 'Structure model' '_pdbx_validate_symm_contact.dist' 9 4 'Structure model' '_pdbx_validate_symm_contact.site_symmetry_2' 10 6 'Structure model' '_pdbx_audit_support.funding_organization' 11 7 'Structure model' '_database_2.pdbx_DOI' 12 7 'Structure model' '_database_2.pdbx_database_accession' 13 8 'Structure model' '_chem_comp_atom.atom_id' 14 8 'Structure model' '_chem_comp_bond.atom_id_2' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.9_1692)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MAR345dtb ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 1329 ? ? O A HOH 1383 ? ? 1.81 2 1 O A GLU 1017 ? ? O A HOH 1486 ? ? 1.90 3 1 O A HOH 1421 ? ? O A HOH 1425 ? ? 1.91 4 1 O A HOH 1352 ? ? O A HOH 1371 ? ? 1.93 5 1 O A HOH 1447 ? ? O A HOH 1482 ? ? 1.94 6 1 O A HOH 1493 ? ? O A HOH 1499 ? ? 2.07 7 1 O A HOH 1345 ? ? O A HOH 1364 ? ? 2.16 8 1 CL A CL 1203 ? ? O A HOH 1367 ? ? 2.17 9 1 CL A CL 1203 ? ? O A HOH 1358 ? ? 2.19 10 1 OD1 A ASN 1059 ? ? O A HOH 1398 ? ? 2.19 11 1 O A VAL 1024 ? ? O A HOH 1301 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 1381 ? ? 1_555 O A HOH 1381 ? ? 12_544 1.59 2 1 O A HOH 1307 ? ? 1_555 O A HOH 1308 ? ? 8_445 1.83 3 1 O A HOH 1336 ? ? 1_555 O A HOH 1356 ? ? 12_544 1.90 4 1 O A HOH 1364 ? ? 1_555 O A HOH 1374 ? ? 12_544 1.97 5 1 O A HOH 1325 ? ? 1_555 O A HOH 1373 ? ? 12_544 2.12 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 VAL _pdbx_validate_rmsd_angle.auth_seq_id_1 1018 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 1019 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CA _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 1019 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 128.77 _pdbx_validate_rmsd_angle.angle_target_value 119.30 _pdbx_validate_rmsd_angle.angle_deviation 9.47 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.50 _pdbx_validate_rmsd_angle.linker_flag Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id VAL _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 1013 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -37.15 _pdbx_validate_torsion.psi 124.35 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 39R CAJ C Y N 1 39R CAN C Y N 2 39R NAA N N N 3 39R CAF C Y N 4 39R CAE C Y N 5 39R CAI C Y N 6 39R CAP C Y N 7 39R CAQ C Y N 8 39R NAL N Y N 9 39R NAK N Y N 10 39R NAM N Y N 11 39R CAR C Y N 12 39R CAO C Y N 13 39R CAG C Y N 14 39R CAC C Y N 15 39R CAB C Y N 16 39R CAD C Y N 17 39R CAH C Y N 18 39R H1 H N N 19 39R H2 H N N 20 39R H3 H N N 21 39R H4 H N N 22 39R H5 H N N 23 39R H6 H N N 24 39R H7 H N N 25 39R H8 H N N 26 39R H9 H N N 27 39R H10 H N N 28 39R H11 H N N 29 39R H12 H N N 30 ALA N N N N 31 ALA CA C N S 32 ALA C C N N 33 ALA O O N N 34 ALA CB C N N 35 ALA OXT O N N 36 ALA H H N N 37 ALA H2 H N N 38 ALA HA H N N 39 ALA HB1 H N N 40 ALA HB2 H N N 41 ALA HB3 H N N 42 ALA HXT H N N 43 ARG N N N N 44 ARG CA C N S 45 ARG C C N N 46 ARG O O N N 47 ARG CB C N N 48 ARG CG C N N 49 ARG CD C N N 50 ARG NE N N N 51 ARG CZ C N N 52 ARG NH1 N N N 53 ARG NH2 N N N 54 ARG OXT O N N 55 ARG H H N N 56 ARG H2 H N N 57 ARG HA H N N 58 ARG HB2 H N N 59 ARG HB3 H N N 60 ARG HG2 H N N 61 ARG HG3 H N N 62 ARG HD2 H N N 63 ARG HD3 H N N 64 ARG HE H N N 65 ARG HH11 H N N 66 ARG HH12 H N N 67 ARG HH21 H N N 68 ARG HH22 H N N 69 ARG HXT H N N 70 ASN N N N N 71 ASN CA C N S 72 ASN C C N N 73 ASN O O N N 74 ASN CB C N N 75 ASN CG C N N 76 ASN OD1 O N N 77 ASN ND2 N N N 78 ASN OXT O N N 79 ASN H H N N 80 ASN H2 H N N 81 ASN HA H N N 82 ASN HB2 H N N 83 ASN HB3 H N N 84 ASN HD21 H N N 85 ASN HD22 H N N 86 ASN HXT H N N 87 ASP N N N N 88 ASP CA C N S 89 ASP C C N N 90 ASP O O N N 91 ASP CB C N N 92 ASP CG C N N 93 ASP OD1 O N N 94 ASP OD2 O N N 95 ASP OXT O N N 96 ASP H H N N 97 ASP H2 H N N 98 ASP HA H N N 99 ASP HB2 H N N 100 ASP HB3 H N N 101 ASP HD2 H N N 102 ASP HXT H N N 103 CL CL CL N N 104 CSO N N N N 105 CSO CA C N R 106 CSO CB C N N 107 CSO SG S N N 108 CSO C C N N 109 CSO O O N N 110 CSO OXT O N N 111 CSO OD O N N 112 CSO H H N N 113 CSO H2 H N N 114 CSO HA H N N 115 CSO HB2 H N N 116 CSO HB3 H N N 117 CSO HXT H N N 118 CSO HD H N N 119 CYS N N N N 120 CYS CA C N R 121 CYS C C N N 122 CYS O O N N 123 CYS CB C N N 124 CYS SG S N N 125 CYS OXT O N N 126 CYS H H N N 127 CYS H2 H N N 128 CYS HA H N N 129 CYS HB2 H N N 130 CYS HB3 H N N 131 CYS HG H N N 132 CYS HXT H N N 133 GLN N N N N 134 GLN CA C N S 135 GLN C C N N 136 GLN O O N N 137 GLN CB C N N 138 GLN CG C N N 139 GLN CD C N N 140 GLN OE1 O N N 141 GLN NE2 N N N 142 GLN OXT O N N 143 GLN H H N N 144 GLN H2 H N N 145 GLN HA H N N 146 GLN HB2 H N N 147 GLN HB3 H N N 148 GLN HG2 H N N 149 GLN HG3 H N N 150 GLN HE21 H N N 151 GLN HE22 H N N 152 GLN HXT H N N 153 GLU N N N N 154 GLU CA C N S 155 GLU C C N N 156 GLU O O N N 157 GLU CB C N N 158 GLU CG C N N 159 GLU CD C N N 160 GLU OE1 O N N 161 GLU OE2 O N N 162 GLU OXT O N N 163 GLU H H N N 164 GLU H2 H N N 165 GLU HA H N N 166 GLU HB2 H N N 167 GLU HB3 H N N 168 GLU HG2 H N N 169 GLU HG3 H N N 170 GLU HE2 H N N 171 GLU HXT H N N 172 GLY N N N N 173 GLY CA C N N 174 GLY C C N N 175 GLY O O N N 176 GLY OXT O N N 177 GLY H H N N 178 GLY H2 H N N 179 GLY HA2 H N N 180 GLY HA3 H N N 181 GLY HXT H N N 182 HIS N N N N 183 HIS CA C N S 184 HIS C C N N 185 HIS O O N N 186 HIS CB C N N 187 HIS CG C Y N 188 HIS ND1 N Y N 189 HIS CD2 C Y N 190 HIS CE1 C Y N 191 HIS NE2 N Y N 192 HIS OXT O N N 193 HIS H H N N 194 HIS H2 H N N 195 HIS HA H N N 196 HIS HB2 H N N 197 HIS HB3 H N N 198 HIS HD1 H N N 199 HIS HD2 H N N 200 HIS HE1 H N N 201 HIS HE2 H N N 202 HIS HXT H N N 203 HOH O O N N 204 HOH H1 H N N 205 HOH H2 H N N 206 ILE N N N N 207 ILE CA C N S 208 ILE C C N N 209 ILE O O N N 210 ILE CB C N S 211 ILE CG1 C N N 212 ILE CG2 C N N 213 ILE CD1 C N N 214 ILE OXT O N N 215 ILE H H N N 216 ILE H2 H N N 217 ILE HA H N N 218 ILE HB H N N 219 ILE HG12 H N N 220 ILE HG13 H N N 221 ILE HG21 H N N 222 ILE HG22 H N N 223 ILE HG23 H N N 224 ILE HD11 H N N 225 ILE HD12 H N N 226 ILE HD13 H N N 227 ILE HXT H N N 228 LEU N N N N 229 LEU CA C N S 230 LEU C C N N 231 LEU O O N N 232 LEU CB C N N 233 LEU CG C N N 234 LEU CD1 C N N 235 LEU CD2 C N N 236 LEU OXT O N N 237 LEU H H N N 238 LEU H2 H N N 239 LEU HA H N N 240 LEU HB2 H N N 241 LEU HB3 H N N 242 LEU HG H N N 243 LEU HD11 H N N 244 LEU HD12 H N N 245 LEU HD13 H N N 246 LEU HD21 H N N 247 LEU HD22 H N N 248 LEU HD23 H N N 249 LEU HXT H N N 250 LYS N N N N 251 LYS CA C N S 252 LYS C C N N 253 LYS O O N N 254 LYS CB C N N 255 LYS CG C N N 256 LYS CD C N N 257 LYS CE C N N 258 LYS NZ N N N 259 LYS OXT O N N 260 LYS H H N N 261 LYS H2 H N N 262 LYS HA H N N 263 LYS HB2 H N N 264 LYS HB3 H N N 265 LYS HG2 H N N 266 LYS HG3 H N N 267 LYS HD2 H N N 268 LYS HD3 H N N 269 LYS HE2 H N N 270 LYS HE3 H N N 271 LYS HZ1 H N N 272 LYS HZ2 H N N 273 LYS HZ3 H N N 274 LYS HXT H N N 275 MET N N N N 276 MET CA C N S 277 MET C C N N 278 MET O O N N 279 MET CB C N N 280 MET CG C N N 281 MET SD S N N 282 MET CE C N N 283 MET OXT O N N 284 MET H H N N 285 MET H2 H N N 286 MET HA H N N 287 MET HB2 H N N 288 MET HB3 H N N 289 MET HG2 H N N 290 MET HG3 H N N 291 MET HE1 H N N 292 MET HE2 H N N 293 MET HE3 H N N 294 MET HXT H N N 295 PHE N N N N 296 PHE CA C N S 297 PHE C C N N 298 PHE O O N N 299 PHE CB C N N 300 PHE CG C Y N 301 PHE CD1 C Y N 302 PHE CD2 C Y N 303 PHE CE1 C Y N 304 PHE CE2 C Y N 305 PHE CZ C Y N 306 PHE OXT O N N 307 PHE H H N N 308 PHE H2 H N N 309 PHE HA H N N 310 PHE HB2 H N N 311 PHE HB3 H N N 312 PHE HD1 H N N 313 PHE HD2 H N N 314 PHE HE1 H N N 315 PHE HE2 H N N 316 PHE HZ H N N 317 PHE HXT H N N 318 PRO N N N N 319 PRO CA C N S 320 PRO C C N N 321 PRO O O N N 322 PRO CB C N N 323 PRO CG C N N 324 PRO CD C N N 325 PRO OXT O N N 326 PRO H H N N 327 PRO HA H N N 328 PRO HB2 H N N 329 PRO HB3 H N N 330 PRO HG2 H N N 331 PRO HG3 H N N 332 PRO HD2 H N N 333 PRO HD3 H N N 334 PRO HXT H N N 335 SER N N N N 336 SER CA C N S 337 SER C C N N 338 SER O O N N 339 SER CB C N N 340 SER OG O N N 341 SER OXT O N N 342 SER H H N N 343 SER H2 H N N 344 SER HA H N N 345 SER HB2 H N N 346 SER HB3 H N N 347 SER HG H N N 348 SER HXT H N N 349 SO4 S S N N 350 SO4 O1 O N N 351 SO4 O2 O N N 352 SO4 O3 O N N 353 SO4 O4 O N N 354 THR N N N N 355 THR CA C N S 356 THR C C N N 357 THR O O N N 358 THR CB C N R 359 THR OG1 O N N 360 THR CG2 C N N 361 THR OXT O N N 362 THR H H N N 363 THR H2 H N N 364 THR HA H N N 365 THR HB H N N 366 THR HG1 H N N 367 THR HG21 H N N 368 THR HG22 H N N 369 THR HG23 H N N 370 THR HXT H N N 371 TRS C C N N 372 TRS C1 C N N 373 TRS C2 C N N 374 TRS C3 C N N 375 TRS N N N N 376 TRS O1 O N N 377 TRS O2 O N N 378 TRS O3 O N N 379 TRS H11 H N N 380 TRS H12 H N N 381 TRS H21 H N N 382 TRS H22 H N N 383 TRS H31 H N N 384 TRS H32 H N N 385 TRS HN1 H N N 386 TRS HN2 H N N 387 TRS HN3 H N N 388 TRS HO1 H N N 389 TRS HO2 H N N 390 TRS HO3 H N N 391 TYR N N N N 392 TYR CA C N S 393 TYR C C N N 394 TYR O O N N 395 TYR CB C N N 396 TYR CG C Y N 397 TYR CD1 C Y N 398 TYR CD2 C Y N 399 TYR CE1 C Y N 400 TYR CE2 C Y N 401 TYR CZ C Y N 402 TYR OH O N N 403 TYR OXT O N N 404 TYR H H N N 405 TYR H2 H N N 406 TYR HA H N N 407 TYR HB2 H N N 408 TYR HB3 H N N 409 TYR HD1 H N N 410 TYR HD2 H N N 411 TYR HE1 H N N 412 TYR HE2 H N N 413 TYR HH H N N 414 TYR HXT H N N 415 VAL N N N N 416 VAL CA C N S 417 VAL C C N N 418 VAL O O N N 419 VAL CB C N N 420 VAL CG1 C N N 421 VAL CG2 C N N 422 VAL OXT O N N 423 VAL H H N N 424 VAL H2 H N N 425 VAL HA H N N 426 VAL HB H N N 427 VAL HG11 H N N 428 VAL HG12 H N N 429 VAL HG13 H N N 430 VAL HG21 H N N 431 VAL HG22 H N N 432 VAL HG23 H N N 433 VAL HXT H N N 434 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 39R CAE CAF doub Y N 1 39R CAE CAI sing Y N 2 39R CAF CAN sing Y N 3 39R CAI CAP doub Y N 4 39R CAN NAA sing N N 5 39R CAN CAJ doub Y N 6 39R CAP CAJ sing Y N 7 39R CAP CAQ sing N N 8 39R CAH CAD doub Y N 9 39R CAH CAO sing Y N 10 39R CAD CAB sing Y N 11 39R NAL CAQ sing Y N 12 39R NAL CAR sing Y N 13 39R CAQ NAK doub Y N 14 39R CAR CAO sing N N 15 39R CAR NAM doub Y N 16 39R CAO CAG doub Y N 17 39R CAB CAC doub Y N 18 39R NAK NAM sing Y N 19 39R CAG CAC sing Y N 20 39R CAJ H1 sing N N 21 39R NAA H2 sing N N 22 39R NAA H3 sing N N 23 39R CAF H4 sing N N 24 39R CAE H5 sing N N 25 39R CAI H6 sing N N 26 39R NAL H7 sing N N 27 39R CAG H8 sing N N 28 39R CAC H9 sing N N 29 39R CAB H10 sing N N 30 39R CAD H11 sing N N 31 39R CAH H12 sing N N 32 ALA N CA sing N N 33 ALA N H sing N N 34 ALA N H2 sing N N 35 ALA CA C sing N N 36 ALA CA CB sing N N 37 ALA CA HA sing N N 38 ALA C O doub N N 39 ALA C OXT sing N N 40 ALA CB HB1 sing N N 41 ALA CB HB2 sing N N 42 ALA CB HB3 sing N N 43 ALA OXT HXT sing N N 44 ARG N CA sing N N 45 ARG N H sing N N 46 ARG N H2 sing N N 47 ARG CA C sing N N 48 ARG CA CB sing N N 49 ARG CA HA sing N N 50 ARG C O doub N N 51 ARG C OXT sing N N 52 ARG CB CG sing N N 53 ARG CB HB2 sing N N 54 ARG CB HB3 sing N N 55 ARG CG CD sing N N 56 ARG CG HG2 sing N N 57 ARG CG HG3 sing N N 58 ARG CD NE sing N N 59 ARG CD HD2 sing N N 60 ARG CD HD3 sing N N 61 ARG NE CZ sing N N 62 ARG NE HE sing N N 63 ARG CZ NH1 sing N N 64 ARG CZ NH2 doub N N 65 ARG NH1 HH11 sing N N 66 ARG NH1 HH12 sing N N 67 ARG NH2 HH21 sing N N 68 ARG NH2 HH22 sing N N 69 ARG OXT HXT sing N N 70 ASN N CA sing N N 71 ASN N H sing N N 72 ASN N H2 sing N N 73 ASN CA C sing N N 74 ASN CA CB sing N N 75 ASN CA HA sing N N 76 ASN C O doub N N 77 ASN C OXT sing N N 78 ASN CB CG sing N N 79 ASN CB HB2 sing N N 80 ASN CB HB3 sing N N 81 ASN CG OD1 doub N N 82 ASN CG ND2 sing N N 83 ASN ND2 HD21 sing N N 84 ASN ND2 HD22 sing N N 85 ASN OXT HXT sing N N 86 ASP N CA sing N N 87 ASP N H sing N N 88 ASP N H2 sing N N 89 ASP CA C sing N N 90 ASP CA CB sing N N 91 ASP CA HA sing N N 92 ASP C O doub N N 93 ASP C OXT sing N N 94 ASP CB CG sing N N 95 ASP CB HB2 sing N N 96 ASP CB HB3 sing N N 97 ASP CG OD1 doub N N 98 ASP CG OD2 sing N N 99 ASP OD2 HD2 sing N N 100 ASP OXT HXT sing N N 101 CSO N CA sing N N 102 CSO N H sing N N 103 CSO N H2 sing N N 104 CSO CA CB sing N N 105 CSO CA C sing N N 106 CSO CA HA sing N N 107 CSO CB SG sing N N 108 CSO CB HB2 sing N N 109 CSO CB HB3 sing N N 110 CSO SG OD sing N N 111 CSO C O doub N N 112 CSO C OXT sing N N 113 CSO OXT HXT sing N N 114 CSO OD HD sing N N 115 CYS N CA sing N N 116 CYS N H sing N N 117 CYS N H2 sing N N 118 CYS CA C sing N N 119 CYS CA CB sing N N 120 CYS CA HA sing N N 121 CYS C O doub N N 122 CYS C OXT sing N N 123 CYS CB SG sing N N 124 CYS CB HB2 sing N N 125 CYS CB HB3 sing N N 126 CYS SG HG sing N N 127 CYS OXT HXT sing N N 128 GLN N CA sing N N 129 GLN N H sing N N 130 GLN N H2 sing N N 131 GLN CA C sing N N 132 GLN CA CB sing N N 133 GLN CA HA sing N N 134 GLN C O doub N N 135 GLN C OXT sing N N 136 GLN CB CG sing N N 137 GLN CB HB2 sing N N 138 GLN CB HB3 sing N N 139 GLN CG CD sing N N 140 GLN CG HG2 sing N N 141 GLN CG HG3 sing N N 142 GLN CD OE1 doub N N 143 GLN CD NE2 sing N N 144 GLN NE2 HE21 sing N N 145 GLN NE2 HE22 sing N N 146 GLN OXT HXT sing N N 147 GLU N CA sing N N 148 GLU N H sing N N 149 GLU N H2 sing N N 150 GLU CA C sing N N 151 GLU CA CB sing N N 152 GLU CA HA sing N N 153 GLU C O doub N N 154 GLU C OXT sing N N 155 GLU CB CG sing N N 156 GLU CB HB2 sing N N 157 GLU CB HB3 sing N N 158 GLU CG CD sing N N 159 GLU CG HG2 sing N N 160 GLU CG HG3 sing N N 161 GLU CD OE1 doub N N 162 GLU CD OE2 sing N N 163 GLU OE2 HE2 sing N N 164 GLU OXT HXT sing N N 165 GLY N CA sing N N 166 GLY N H sing N N 167 GLY N H2 sing N N 168 GLY CA C sing N N 169 GLY CA HA2 sing N N 170 GLY CA HA3 sing N N 171 GLY C O doub N N 172 GLY C OXT sing N N 173 GLY OXT HXT sing N N 174 HIS N CA sing N N 175 HIS N H sing N N 176 HIS N H2 sing N N 177 HIS CA C sing N N 178 HIS CA CB sing N N 179 HIS CA HA sing N N 180 HIS C O doub N N 181 HIS C OXT sing N N 182 HIS CB CG sing N N 183 HIS CB HB2 sing N N 184 HIS CB HB3 sing N N 185 HIS CG ND1 sing Y N 186 HIS CG CD2 doub Y N 187 HIS ND1 CE1 doub Y N 188 HIS ND1 HD1 sing N N 189 HIS CD2 NE2 sing Y N 190 HIS CD2 HD2 sing N N 191 HIS CE1 NE2 sing Y N 192 HIS CE1 HE1 sing N N 193 HIS NE2 HE2 sing N N 194 HIS OXT HXT sing N N 195 HOH O H1 sing N N 196 HOH O H2 sing N N 197 ILE N CA sing N N 198 ILE N H sing N N 199 ILE N H2 sing N N 200 ILE CA C sing N N 201 ILE CA CB sing N N 202 ILE CA HA sing N N 203 ILE C O doub N N 204 ILE C OXT sing N N 205 ILE CB CG1 sing N N 206 ILE CB CG2 sing N N 207 ILE CB HB sing N N 208 ILE CG1 CD1 sing N N 209 ILE CG1 HG12 sing N N 210 ILE CG1 HG13 sing N N 211 ILE CG2 HG21 sing N N 212 ILE CG2 HG22 sing N N 213 ILE CG2 HG23 sing N N 214 ILE CD1 HD11 sing N N 215 ILE CD1 HD12 sing N N 216 ILE CD1 HD13 sing N N 217 ILE OXT HXT sing N N 218 LEU N CA sing N N 219 LEU N H sing N N 220 LEU N H2 sing N N 221 LEU CA C sing N N 222 LEU CA CB sing N N 223 LEU CA HA sing N N 224 LEU C O doub N N 225 LEU C OXT sing N N 226 LEU CB CG sing N N 227 LEU CB HB2 sing N N 228 LEU CB HB3 sing N N 229 LEU CG CD1 sing N N 230 LEU CG CD2 sing N N 231 LEU CG HG sing N N 232 LEU CD1 HD11 sing N N 233 LEU CD1 HD12 sing N N 234 LEU CD1 HD13 sing N N 235 LEU CD2 HD21 sing N N 236 LEU CD2 HD22 sing N N 237 LEU CD2 HD23 sing N N 238 LEU OXT HXT sing N N 239 LYS N CA sing N N 240 LYS N H sing N N 241 LYS N H2 sing N N 242 LYS CA C sing N N 243 LYS CA CB sing N N 244 LYS CA HA sing N N 245 LYS C O doub N N 246 LYS C OXT sing N N 247 LYS CB CG sing N N 248 LYS CB HB2 sing N N 249 LYS CB HB3 sing N N 250 LYS CG CD sing N N 251 LYS CG HG2 sing N N 252 LYS CG HG3 sing N N 253 LYS CD CE sing N N 254 LYS CD HD2 sing N N 255 LYS CD HD3 sing N N 256 LYS CE NZ sing N N 257 LYS CE HE2 sing N N 258 LYS CE HE3 sing N N 259 LYS NZ HZ1 sing N N 260 LYS NZ HZ2 sing N N 261 LYS NZ HZ3 sing N N 262 LYS OXT HXT sing N N 263 MET N CA sing N N 264 MET N H sing N N 265 MET N H2 sing N N 266 MET CA C sing N N 267 MET CA CB sing N N 268 MET CA HA sing N N 269 MET C O doub N N 270 MET C OXT sing N N 271 MET CB CG sing N N 272 MET CB HB2 sing N N 273 MET CB HB3 sing N N 274 MET CG SD sing N N 275 MET CG HG2 sing N N 276 MET CG HG3 sing N N 277 MET SD CE sing N N 278 MET CE HE1 sing N N 279 MET CE HE2 sing N N 280 MET CE HE3 sing N N 281 MET OXT HXT sing N N 282 PHE N CA sing N N 283 PHE N H sing N N 284 PHE N H2 sing N N 285 PHE CA C sing N N 286 PHE CA CB sing N N 287 PHE CA HA sing N N 288 PHE C O doub N N 289 PHE C OXT sing N N 290 PHE CB CG sing N N 291 PHE CB HB2 sing N N 292 PHE CB HB3 sing N N 293 PHE CG CD1 doub Y N 294 PHE CG CD2 sing Y N 295 PHE CD1 CE1 sing Y N 296 PHE CD1 HD1 sing N N 297 PHE CD2 CE2 doub Y N 298 PHE CD2 HD2 sing N N 299 PHE CE1 CZ doub Y N 300 PHE CE1 HE1 sing N N 301 PHE CE2 CZ sing Y N 302 PHE CE2 HE2 sing N N 303 PHE CZ HZ sing N N 304 PHE OXT HXT sing N N 305 PRO N CA sing N N 306 PRO N CD sing N N 307 PRO N H sing N N 308 PRO CA C sing N N 309 PRO CA CB sing N N 310 PRO CA HA sing N N 311 PRO C O doub N N 312 PRO C OXT sing N N 313 PRO CB CG sing N N 314 PRO CB HB2 sing N N 315 PRO CB HB3 sing N N 316 PRO CG CD sing N N 317 PRO CG HG2 sing N N 318 PRO CG HG3 sing N N 319 PRO CD HD2 sing N N 320 PRO CD HD3 sing N N 321 PRO OXT HXT sing N N 322 SER N CA sing N N 323 SER N H sing N N 324 SER N H2 sing N N 325 SER CA C sing N N 326 SER CA CB sing N N 327 SER CA HA sing N N 328 SER C O doub N N 329 SER C OXT sing N N 330 SER CB OG sing N N 331 SER CB HB2 sing N N 332 SER CB HB3 sing N N 333 SER OG HG sing N N 334 SER OXT HXT sing N N 335 SO4 S O1 doub N N 336 SO4 S O2 doub N N 337 SO4 S O3 sing N N 338 SO4 S O4 sing N N 339 THR N CA sing N N 340 THR N H sing N N 341 THR N H2 sing N N 342 THR CA C sing N N 343 THR CA CB sing N N 344 THR CA HA sing N N 345 THR C O doub N N 346 THR C OXT sing N N 347 THR CB OG1 sing N N 348 THR CB CG2 sing N N 349 THR CB HB sing N N 350 THR OG1 HG1 sing N N 351 THR CG2 HG21 sing N N 352 THR CG2 HG22 sing N N 353 THR CG2 HG23 sing N N 354 THR OXT HXT sing N N 355 TRS C C1 sing N N 356 TRS C C2 sing N N 357 TRS C C3 sing N N 358 TRS C N sing N N 359 TRS C1 O1 sing N N 360 TRS C1 H11 sing N N 361 TRS C1 H12 sing N N 362 TRS C2 O2 sing N N 363 TRS C2 H21 sing N N 364 TRS C2 H22 sing N N 365 TRS C3 O3 sing N N 366 TRS C3 H31 sing N N 367 TRS C3 H32 sing N N 368 TRS N HN1 sing N N 369 TRS N HN2 sing N N 370 TRS N HN3 sing N N 371 TRS O1 HO1 sing N N 372 TRS O2 HO2 sing N N 373 TRS O3 HO3 sing N N 374 TYR N CA sing N N 375 TYR N H sing N N 376 TYR N H2 sing N N 377 TYR CA C sing N N 378 TYR CA CB sing N N 379 TYR CA HA sing N N 380 TYR C O doub N N 381 TYR C OXT sing N N 382 TYR CB CG sing N N 383 TYR CB HB2 sing N N 384 TYR CB HB3 sing N N 385 TYR CG CD1 doub Y N 386 TYR CG CD2 sing Y N 387 TYR CD1 CE1 sing Y N 388 TYR CD1 HD1 sing N N 389 TYR CD2 CE2 doub Y N 390 TYR CD2 HD2 sing N N 391 TYR CE1 CZ doub Y N 392 TYR CE1 HE1 sing N N 393 TYR CE2 CZ sing Y N 394 TYR CE2 HE2 sing N N 395 TYR CZ OH sing N N 396 TYR OH HH sing N N 397 TYR OXT HXT sing N N 398 VAL N CA sing N N 399 VAL N H sing N N 400 VAL N H2 sing N N 401 VAL CA C sing N N 402 VAL CA CB sing N N 403 VAL CA HA sing N N 404 VAL C O doub N N 405 VAL C OXT sing N N 406 VAL CB CG1 sing N N 407 VAL CB CG2 sing N N 408 VAL CB HB sing N N 409 VAL CG1 HG11 sing N N 410 VAL CG1 HG12 sing N N 411 VAL CG1 HG13 sing N N 412 VAL CG2 HG21 sing N N 413 VAL CG2 HG22 sing N N 414 VAL CG2 HG23 sing N N 415 VAL OXT HXT sing N N 416 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Cancer Institute (NIH/NCI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number DP1OD006933/DP1CA174419 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 4 'CHLORIDE ION' CL 5 '3-(5-phenyl-4H-1,2,4-triazol-3-yl)aniline' 39R 6 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3DAI _pdbx_initial_refinement_model.details 'PDB entry 3DAI' #