data_4UCV # _entry.id 4UCV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4UCV PDBE EBI-62503 WWPDB D_1290062503 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 4UCO unspecified 'FRAGMENT BOUND TO H.INFLUENZA NAD DEPENDENT DNA LIGASE' PDB 4UCR unspecified 'FRAGMENT BOUND TO H.INFLUENZA NAD DEPENDENT DNA LIGASE' PDB 4UCS unspecified 'FRAGMENT BOUND TO H.INFLUENZA NAD DEPENDENT DNA LIGASE' PDB 4UCT unspecified 'FRAGMENT BOUND TO H.INFLUENZA NAD DEPENDENT DNA LIGASE' PDB 4UCU unspecified 'FRAGMENT BOUND TO H.INFLUENZA NAD DEPENDENT DNA LIGASE' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4UCV _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2014-12-04 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hale, M.' 1 'Brassington, C.' 2 'Carcanague, D.' 3 'Embrey, K.' 4 'Eyermann, C.J.' 5 'Giacobbe, R.A.' 6 'Gingipali, L.' 7 'Gowravaram, M.' 8 'Harang, J.' 9 'Howard, T.' 10 'Ioannidis, G.' 11 'Jahic, H.' 12 'Kutschke, A.' 13 'Laganas, V.A.' 14 'Loch, J.' 15 'Miller, M.D.' 16 'Murphy-Benenato, K.E.' 17 'Oguto, H.' 18 'Otterbein, L.' 19 'Patel, S.J.' 20 'Shapiro, A.B.' 21 'Boriack-Sjodin, P.A.' 22 # _citation.id primary _citation.title 'From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors' _citation.journal_abbrev 'Tetrahedron Lett.' _citation.journal_volume 56 _citation.page_first 3108 _citation.page_last ? _citation.year 2015 _citation.journal_id_ASTM TELEAY _citation.country UK _citation.journal_id_ISSN 0040-4039 _citation.journal_id_CSD 0024 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI 10.1016/J.TETLET.2014.12.067 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Hale, M.' 1 primary 'Brassington, C.' 2 primary 'Carcanague, D.' 3 primary 'Embrey, K.' 4 primary 'Eyermann, C.J.' 5 primary 'Giacobbe, R.A.' 6 primary 'Gingipali, L.' 7 primary 'Gowravaram, M.' 8 primary 'Harang, J.' 9 primary 'Howard, T.' 10 primary 'Ioannidis, G.' 11 primary 'Jahic, H.' 12 primary 'Kutschke, A.' 13 primary 'Laganas, V.A.' 14 primary 'Loch, J.' 15 primary 'Miller, M.D.' 16 primary 'Murphy-Benenato, K.E.' 17 primary 'Oguto, H.' 18 primary 'Otterbein, L.' 19 primary 'Patel, S.J.' 20 primary 'Shapiro, A.B.' 21 primary 'Boriack-Sjodin, P.A.' 22 # _cell.entry_id 4UCV _cell.length_a 139.160 _cell.length_b 139.160 _cell.length_c 56.329 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4UCV _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA LIGASE' 36513.344 1 6.5.1.2 ? 'ADENYLATION DOMAIN, RESIDUES 1-324' ? 2 non-polymer syn '1-(2,4-dimethylbenzyl)-6-oxo-1,6-dihydropyridine-3-carboxamide' 256.300 1 ? ? ? ? 3 non-polymer syn 8-methoxy-2,3-dimethylquinoxalin-5-ol 204.225 1 ? ? ? ? 4 water nat water 18.015 48 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'POLYDEOXYRIBONUCLEOTIDE SYNTHASE NAD(+), NAD DEPENDENT DNA LIGASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPML SLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQL LTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTH YARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPAQE ELTL ; _entity_poly.pdbx_seq_one_letter_code_can ;MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPML SLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQL LTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTH YARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPAQE ELTL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 ASN n 1 4 ILE n 1 5 GLN n 1 6 THR n 1 7 GLN n 1 8 LEU n 1 9 ASP n 1 10 ASN n 1 11 LEU n 1 12 ARG n 1 13 LYS n 1 14 THR n 1 15 LEU n 1 16 ARG n 1 17 GLN n 1 18 TYR n 1 19 GLU n 1 20 TYR n 1 21 GLU n 1 22 TYR n 1 23 HIS n 1 24 VAL n 1 25 LEU n 1 26 ASP n 1 27 ASN n 1 28 PRO n 1 29 SER n 1 30 VAL n 1 31 PRO n 1 32 ASP n 1 33 SER n 1 34 GLU n 1 35 TYR n 1 36 ASP n 1 37 ARG n 1 38 LEU n 1 39 PHE n 1 40 HIS n 1 41 GLN n 1 42 LEU n 1 43 LYS n 1 44 ALA n 1 45 LEU n 1 46 GLU n 1 47 LEU n 1 48 GLU n 1 49 HIS n 1 50 PRO n 1 51 GLU n 1 52 PHE n 1 53 LEU n 1 54 THR n 1 55 SER n 1 56 ASP n 1 57 SER n 1 58 PRO n 1 59 THR n 1 60 GLN n 1 61 ARG n 1 62 VAL n 1 63 GLY n 1 64 ALA n 1 65 LYS n 1 66 PRO n 1 67 LEU n 1 68 SER n 1 69 GLY n 1 70 PHE n 1 71 SER n 1 72 GLN n 1 73 ILE n 1 74 ARG n 1 75 HIS n 1 76 GLU n 1 77 ILE n 1 78 PRO n 1 79 MET n 1 80 LEU n 1 81 SER n 1 82 LEU n 1 83 ASP n 1 84 ASN n 1 85 ALA n 1 86 PHE n 1 87 SER n 1 88 ASP n 1 89 ALA n 1 90 GLU n 1 91 PHE n 1 92 ASN n 1 93 ALA n 1 94 PHE n 1 95 VAL n 1 96 LYS n 1 97 ARG n 1 98 ILE n 1 99 GLU n 1 100 ASP n 1 101 ARG n 1 102 LEU n 1 103 ILE n 1 104 LEU n 1 105 LEU n 1 106 PRO n 1 107 LYS n 1 108 PRO n 1 109 LEU n 1 110 THR n 1 111 PHE n 1 112 CYS n 1 113 CYS n 1 114 GLU n 1 115 PRO n 1 116 LYS n 1 117 LEU n 1 118 ASP n 1 119 GLY n 1 120 LEU n 1 121 ALA n 1 122 VAL n 1 123 SER n 1 124 ILE n 1 125 LEU n 1 126 TYR n 1 127 VAL n 1 128 ASN n 1 129 GLY n 1 130 GLU n 1 131 LEU n 1 132 THR n 1 133 GLN n 1 134 ALA n 1 135 ALA n 1 136 THR n 1 137 ARG n 1 138 GLY n 1 139 ASP n 1 140 GLY n 1 141 THR n 1 142 THR n 1 143 GLY n 1 144 GLU n 1 145 ASP n 1 146 ILE n 1 147 THR n 1 148 ALA n 1 149 ASN n 1 150 ILE n 1 151 ARG n 1 152 THR n 1 153 ILE n 1 154 ARG n 1 155 ASN n 1 156 VAL n 1 157 PRO n 1 158 LEU n 1 159 GLN n 1 160 LEU n 1 161 LEU n 1 162 THR n 1 163 ASP n 1 164 ASN n 1 165 PRO n 1 166 PRO n 1 167 ALA n 1 168 ARG n 1 169 LEU n 1 170 GLU n 1 171 VAL n 1 172 ARG n 1 173 GLY n 1 174 GLU n 1 175 VAL n 1 176 PHE n 1 177 MET n 1 178 PRO n 1 179 HIS n 1 180 ALA n 1 181 GLY n 1 182 PHE n 1 183 GLU n 1 184 ARG n 1 185 LEU n 1 186 ASN n 1 187 LYS n 1 188 TYR n 1 189 ALA n 1 190 LEU n 1 191 GLU n 1 192 HIS n 1 193 ASN n 1 194 GLU n 1 195 LYS n 1 196 THR n 1 197 PHE n 1 198 ALA n 1 199 ASN n 1 200 PRO n 1 201 ARG n 1 202 ASN n 1 203 ALA n 1 204 ALA n 1 205 ALA n 1 206 GLY n 1 207 SER n 1 208 LEU n 1 209 ARG n 1 210 GLN n 1 211 LEU n 1 212 ASP n 1 213 PRO n 1 214 ASN n 1 215 ILE n 1 216 THR n 1 217 SER n 1 218 LYS n 1 219 ARG n 1 220 PRO n 1 221 LEU n 1 222 VAL n 1 223 LEU n 1 224 ASN n 1 225 ALA n 1 226 TYR n 1 227 GLY n 1 228 ILE n 1 229 GLY n 1 230 ILE n 1 231 ALA n 1 232 GLU n 1 233 GLY n 1 234 VAL n 1 235 ASP n 1 236 LEU n 1 237 PRO n 1 238 THR n 1 239 THR n 1 240 HIS n 1 241 TYR n 1 242 ALA n 1 243 ARG n 1 244 LEU n 1 245 GLN n 1 246 TRP n 1 247 LEU n 1 248 LYS n 1 249 SER n 1 250 ILE n 1 251 GLY n 1 252 ILE n 1 253 PRO n 1 254 VAL n 1 255 ASN n 1 256 PRO n 1 257 GLU n 1 258 ILE n 1 259 ARG n 1 260 LEU n 1 261 CYS n 1 262 ASN n 1 263 GLY n 1 264 ALA n 1 265 ASP n 1 266 GLU n 1 267 VAL n 1 268 LEU n 1 269 GLY n 1 270 PHE n 1 271 TYR n 1 272 ARG n 1 273 ASP n 1 274 ILE n 1 275 GLN n 1 276 ASN n 1 277 LYS n 1 278 ARG n 1 279 SER n 1 280 SER n 1 281 LEU n 1 282 GLY n 1 283 TYR n 1 284 ASP n 1 285 ILE n 1 286 ASP n 1 287 GLY n 1 288 THR n 1 289 VAL n 1 290 LEU n 1 291 LYS n 1 292 ILE n 1 293 ASN n 1 294 ASP n 1 295 ILE n 1 296 ALA n 1 297 LEU n 1 298 GLN n 1 299 ASN n 1 300 GLU n 1 301 LEU n 1 302 GLY n 1 303 PHE n 1 304 ILE n 1 305 SER n 1 306 LYS n 1 307 ALA n 1 308 PRO n 1 309 ARG n 1 310 TRP n 1 311 ALA n 1 312 ILE n 1 313 ALA n 1 314 TYR n 1 315 LYS n 1 316 PHE n 1 317 PRO n 1 318 ALA n 1 319 GLN n 1 320 GLU n 1 321 GLU n 1 322 LEU n 1 323 THR n 1 324 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HAEMOPHILUS INFLUENZAE' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 727 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DNLJ_HAEIN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P43813 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4UCV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 324 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P43813 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 324 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 324 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 I6G non-polymer . 8-methoxy-2,3-dimethylquinoxalin-5-ol ? 'C11 H12 N2 O2' 204.225 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IWH non-polymer . '1-(2,4-dimethylbenzyl)-6-oxo-1,6-dihydropyridine-3-carboxamide' ? 'C15 H16 N2 O2' 256.300 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4UCV _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.73 _exptl_crystal.density_percent_sol 67.06 _exptl_crystal.description NONE # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'RIGAKU CCD' _diffrn_detector.pdbx_collection_date 2005-05-12 _diffrn_detector.details OSMIC # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU MICROMAX-007' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4UCV _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 48.00 _reflns.d_resolution_high 2.60 _reflns.number_obs 17356 _reflns.number_all ? _reflns.percent_possible_obs 98.0 _reflns.pdbx_Rmerge_I_obs 0.10 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 8.00 _reflns.B_iso_Wilson_estimate 49.81 _reflns.pdbx_redundancy 4 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.69 _reflns_shell.percent_possible_all 98.0 _reflns_shell.Rmerge_I_obs 0.55 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.50 _reflns_shell.pdbx_redundancy 4 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4UCV _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 17356 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 48.89 _refine.ls_d_res_high 2.60 _refine.ls_percent_reflns_obs 98.72 _refine.ls_R_factor_obs 0.2580 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2567 _refine.ls_R_factor_R_free 0.2803 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.44 _refine.ls_number_reflns_R_free 945 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.8543 _refine.correlation_coeff_Fo_to_Fc_free 0.8423 _refine.B_iso_mean 44.56 _refine.aniso_B[1][1] 3.8683 _refine.aniso_B[2][2] 3.8683 _refine.aniso_B[3][3] -7.7367 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI 0.409 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.280 # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 4UCV _refine_analyze.Luzzati_coordinate_error_obs 0.472 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2510 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.number_atoms_solvent 48 _refine_hist.number_atoms_total 2592 _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 48.89 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_bond_d 0.009 ? 2.00 5099 'X-RAY DIFFRACTION' HARMONIC t_angle_deg 0.98 ? 2.00 9219 'X-RAY DIFFRACTION' HARMONIC t_dihedral_angle_d ? ? 2.00 1110 'X-RAY DIFFRACTION' SINUSOIDAL t_incorr_chiral_ct ? ? ? ? 'X-RAY DIFFRACTION' ? t_pseud_angle ? ? ? ? 'X-RAY DIFFRACTION' ? t_trig_c_planes ? ? 2.00 71 'X-RAY DIFFRACTION' HARMONIC t_gen_planes ? ? 5.00 762 'X-RAY DIFFRACTION' HARMONIC t_it ? ? 20.00 5099 'X-RAY DIFFRACTION' HARMONIC t_nbd ? ? 5.00 0 'X-RAY DIFFRACTION' SEMIHARMONIC t_omega_torsion 2.78 ? ? ? 'X-RAY DIFFRACTION' ? t_other_torsion 16.56 ? ? ? 'X-RAY DIFFRACTION' ? t_improper_torsion ? ? ? ? 'X-RAY DIFFRACTION' ? t_chiral_improper_torsion ? ? 5.00 338 'X-RAY DIFFRACTION' SEMIHARMONIC t_sum_occupancies ? ? ? ? 'X-RAY DIFFRACTION' ? t_utility_distance ? ? ? ? 'X-RAY DIFFRACTION' ? t_utility_angle ? ? ? ? 'X-RAY DIFFRACTION' ? t_utility_torsion ? ? ? ? 'X-RAY DIFFRACTION' ? t_ideal_dist_contact ? ? 4.00 5258 'X-RAY DIFFRACTION' SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 9 _refine_ls_shell.d_res_high 2.60 _refine_ls_shell.d_res_low 2.76 _refine_ls_shell.number_reflns_R_work 2518 _refine_ls_shell.R_factor_R_work 0.3911 _refine_ls_shell.percent_reflns_obs 98.72 _refine_ls_shell.R_factor_R_free 0.4002 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free 5.44 _refine_ls_shell.number_reflns_R_free 145 _refine_ls_shell.number_reflns_all 2663 _refine_ls_shell.R_factor_all 0.3916 # _struct.entry_id 4UCV _struct.title 'Fragment bound to H.influenza NAD dependent DNA ligase' _struct.pdbx_descriptor 'DNA LIGASE (E.C.6.5.1.2)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4UCV _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 2 ? VAL A 24 ? THR A 2 VAL A 24 1 ? 23 HELX_P HELX_P2 2 PRO A 31 ? HIS A 49 ? PRO A 31 HIS A 49 1 ? 19 HELX_P HELX_P3 3 PRO A 50 ? LEU A 53 ? PRO A 50 LEU A 53 5 ? 4 HELX_P HELX_P4 4 SER A 87 ? LEU A 102 ? SER A 87 LEU A 102 1 ? 16 HELX_P HELX_P5 5 ILE A 146 ? ARG A 151 ? ILE A 146 ARG A 151 1 ? 6 HELX_P HELX_P6 6 PRO A 178 ? HIS A 192 ? PRO A 178 HIS A 192 1 ? 15 HELX_P HELX_P7 7 ASN A 199 ? ARG A 209 ? ASN A 199 ARG A 209 1 ? 11 HELX_P HELX_P8 8 ASP A 212 ? ARG A 219 ? ASP A 212 ARG A 219 1 ? 8 HELX_P HELX_P9 9 THR A 239 ? ILE A 250 ? THR A 239 ILE A 250 1 ? 12 HELX_P HELX_P10 10 GLY A 263 ? ARG A 278 ? GLY A 263 ARG A 278 1 ? 16 HELX_P HELX_P11 11 SER A 279 ? LEU A 281 ? SER A 279 LEU A 281 5 ? 3 HELX_P HELX_P12 12 ASP A 294 ? GLY A 302 ? ASP A 294 GLY A 302 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 2 ? AB ? 3 ? AC ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AC 1 2 ? anti-parallel AC 2 3 ? anti-parallel AC 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 GLN A 72 ? ARG A 74 ? GLN A 72 ARG A 74 AA 2 THR A 142 ? GLU A 144 ? THR A 142 GLU A 144 AB 1 ARG A 259 ? ASN A 262 ? ARG A 259 ASN A 262 AB 2 THR A 110 ? LEU A 117 ? THR A 110 LEU A 117 AB 3 ILE A 285 ? ILE A 292 ? ILE A 285 ILE A 292 AC 1 GLU A 130 ? THR A 136 ? GLU A 130 THR A 136 AC 2 LEU A 120 ? VAL A 127 ? LEU A 120 VAL A 127 AC 3 ARG A 168 ? PHE A 176 ? ARG A 168 PHE A 176 AC 4 VAL A 222 ? GLU A 232 ? VAL A 222 GLU A 232 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ILE A 73 ? N ILE A 73 O GLY A 143 ? O GLY A 143 AB 1 2 N CYS A 261 ? N CYS A 261 O PHE A 111 ? O PHE A 111 AB 2 3 O LYS A 116 ? O LYS A 116 N ASP A 286 ? N ASP A 286 AC 1 2 N ALA A 135 ? N ALA A 135 O SER A 123 ? O SER A 123 AC 2 3 N TYR A 126 ? N TYR A 126 O LEU A 169 ? O LEU A 169 AC 3 4 N PHE A 176 ? N PHE A 176 O VAL A 222 ? O VAL A 222 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE IWH A 1319' AC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE I6G A 1320' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 TYR A 18 ? TYR A 18 . ? 1_555 ? 2 AC1 9 GLU A 21 ? GLU A 21 . ? 4_565 ? 3 AC1 9 TYR A 22 ? TYR A 22 . ? 1_555 ? 4 AC1 9 HIS A 23 ? HIS A 23 . ? 1_555 ? 5 AC1 9 ASN A 27 ? ASN A 27 . ? 4_565 ? 6 AC1 9 VAL A 30 ? VAL A 30 . ? 1_555 ? 7 AC1 9 ASP A 32 ? ASP A 32 . ? 1_555 ? 8 AC1 9 TYR A 35 ? TYR A 35 . ? 1_555 ? 9 AC1 9 HOH D . ? HOH A 2007 . ? 1_555 ? 10 AC2 8 LEU A 80 ? LEU A 80 . ? 1_555 ? 11 AC2 8 SER A 81 ? SER A 81 . ? 1_555 ? 12 AC2 8 LEU A 82 ? LEU A 82 . ? 1_555 ? 13 AC2 8 GLU A 114 ? GLU A 114 . ? 1_555 ? 14 AC2 8 GLU A 174 ? GLU A 174 . ? 1_555 ? 15 AC2 8 TYR A 226 ? TYR A 226 . ? 1_555 ? 16 AC2 8 VAL A 289 ? VAL A 289 . ? 1_555 ? 17 AC2 8 LYS A 291 ? LYS A 291 . ? 1_555 ? # _database_PDB_matrix.entry_id 4UCV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4UCV _atom_sites.fract_transf_matrix[1][1] 0.007186 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007186 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017753 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 CYS 112 112 112 CYS CYS A . n A 1 113 CYS 113 113 113 CYS CYS A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 TYR 126 126 126 TYR TYR A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 THR 141 141 141 THR THR A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 ASN 155 155 155 ASN ASN A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 ASN 164 164 164 ASN ASN A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 PRO 166 166 166 PRO PRO A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 MET 177 177 177 MET MET A . n A 1 178 PRO 178 178 178 PRO PRO A . n A 1 179 HIS 179 179 179 HIS HIS A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 PHE 182 182 182 PHE PHE A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 ARG 184 184 184 ARG ARG A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 ASN 186 186 186 ASN ASN A . n A 1 187 LYS 187 187 187 LYS LYS A . n A 1 188 TYR 188 188 188 TYR TYR A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 GLU 191 191 191 GLU GLU A . n A 1 192 HIS 192 192 192 HIS HIS A . n A 1 193 ASN 193 193 193 ASN ASN A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 LYS 195 195 195 LYS LYS A . n A 1 196 THR 196 196 196 THR THR A . n A 1 197 PHE 197 197 197 PHE PHE A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 ASN 199 199 199 ASN ASN A . n A 1 200 PRO 200 200 200 PRO PRO A . n A 1 201 ARG 201 201 201 ARG ARG A . n A 1 202 ASN 202 202 202 ASN ASN A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 ALA 204 204 204 ALA ALA A . n A 1 205 ALA 205 205 205 ALA ALA A . n A 1 206 GLY 206 206 206 GLY GLY A . n A 1 207 SER 207 207 207 SER SER A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 ARG 209 209 209 ARG ARG A . n A 1 210 GLN 210 210 210 GLN GLN A . n A 1 211 LEU 211 211 211 LEU LEU A . n A 1 212 ASP 212 212 212 ASP ASP A . n A 1 213 PRO 213 213 213 PRO PRO A . n A 1 214 ASN 214 214 214 ASN ASN A . n A 1 215 ILE 215 215 215 ILE ILE A . n A 1 216 THR 216 216 216 THR THR A . n A 1 217 SER 217 217 217 SER SER A . n A 1 218 LYS 218 218 218 LYS LYS A . n A 1 219 ARG 219 219 219 ARG ARG A . n A 1 220 PRO 220 220 220 PRO PRO A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 VAL 222 222 222 VAL VAL A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 ASN 224 224 224 ASN ASN A . n A 1 225 ALA 225 225 225 ALA ALA A . n A 1 226 TYR 226 226 226 TYR TYR A . n A 1 227 GLY 227 227 227 GLY GLY A . n A 1 228 ILE 228 228 228 ILE ILE A . n A 1 229 GLY 229 229 229 GLY GLY A . n A 1 230 ILE 230 230 230 ILE ILE A . n A 1 231 ALA 231 231 231 ALA ALA A . n A 1 232 GLU 232 232 232 GLU GLU A . n A 1 233 GLY 233 233 233 GLY GLY A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 ASP 235 235 235 ASP ASP A . n A 1 236 LEU 236 236 236 LEU LEU A . n A 1 237 PRO 237 237 237 PRO PRO A . n A 1 238 THR 238 238 238 THR THR A . n A 1 239 THR 239 239 239 THR THR A . n A 1 240 HIS 240 240 240 HIS HIS A . n A 1 241 TYR 241 241 241 TYR TYR A . n A 1 242 ALA 242 242 242 ALA ALA A . n A 1 243 ARG 243 243 243 ARG ARG A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 GLN 245 245 245 GLN GLN A . n A 1 246 TRP 246 246 246 TRP TRP A . n A 1 247 LEU 247 247 247 LEU LEU A . n A 1 248 LYS 248 248 248 LYS LYS A . n A 1 249 SER 249 249 249 SER SER A . n A 1 250 ILE 250 250 250 ILE ILE A . n A 1 251 GLY 251 251 251 GLY GLY A . n A 1 252 ILE 252 252 252 ILE ILE A . n A 1 253 PRO 253 253 253 PRO PRO A . n A 1 254 VAL 254 254 254 VAL VAL A . n A 1 255 ASN 255 255 255 ASN ASN A . n A 1 256 PRO 256 256 256 PRO PRO A . n A 1 257 GLU 257 257 257 GLU GLU A . n A 1 258 ILE 258 258 258 ILE ILE A . n A 1 259 ARG 259 259 259 ARG ARG A . n A 1 260 LEU 260 260 260 LEU LEU A . n A 1 261 CYS 261 261 261 CYS CYS A . n A 1 262 ASN 262 262 262 ASN ASN A . n A 1 263 GLY 263 263 263 GLY GLY A . n A 1 264 ALA 264 264 264 ALA ALA A . n A 1 265 ASP 265 265 265 ASP ASP A . n A 1 266 GLU 266 266 266 GLU GLU A . n A 1 267 VAL 267 267 267 VAL VAL A . n A 1 268 LEU 268 268 268 LEU LEU A . n A 1 269 GLY 269 269 269 GLY GLY A . n A 1 270 PHE 270 270 270 PHE PHE A . n A 1 271 TYR 271 271 271 TYR TYR A . n A 1 272 ARG 272 272 272 ARG ARG A . n A 1 273 ASP 273 273 273 ASP ASP A . n A 1 274 ILE 274 274 274 ILE ILE A . n A 1 275 GLN 275 275 275 GLN GLN A . n A 1 276 ASN 276 276 276 ASN ASN A . n A 1 277 LYS 277 277 277 LYS LYS A . n A 1 278 ARG 278 278 278 ARG ARG A . n A 1 279 SER 279 279 279 SER SER A . n A 1 280 SER 280 280 280 SER SER A . n A 1 281 LEU 281 281 281 LEU LEU A . n A 1 282 GLY 282 282 282 GLY GLY A . n A 1 283 TYR 283 283 283 TYR TYR A . n A 1 284 ASP 284 284 284 ASP ASP A . n A 1 285 ILE 285 285 285 ILE ILE A . n A 1 286 ASP 286 286 286 ASP ASP A . n A 1 287 GLY 287 287 287 GLY GLY A . n A 1 288 THR 288 288 288 THR THR A . n A 1 289 VAL 289 289 289 VAL VAL A . n A 1 290 LEU 290 290 290 LEU LEU A . n A 1 291 LYS 291 291 291 LYS LYS A . n A 1 292 ILE 292 292 292 ILE ILE A . n A 1 293 ASN 293 293 293 ASN ASN A . n A 1 294 ASP 294 294 294 ASP ASP A . n A 1 295 ILE 295 295 295 ILE ILE A . n A 1 296 ALA 296 296 296 ALA ALA A . n A 1 297 LEU 297 297 297 LEU LEU A . n A 1 298 GLN 298 298 298 GLN GLN A . n A 1 299 ASN 299 299 299 ASN ASN A . n A 1 300 GLU 300 300 300 GLU GLU A . n A 1 301 LEU 301 301 301 LEU LEU A . n A 1 302 GLY 302 302 302 GLY GLY A . n A 1 303 PHE 303 303 303 PHE PHE A . n A 1 304 ILE 304 304 304 ILE ILE A . n A 1 305 SER 305 305 305 SER SER A . n A 1 306 LYS 306 306 306 LYS LYS A . n A 1 307 ALA 307 307 307 ALA ALA A . n A 1 308 PRO 308 308 308 PRO PRO A . n A 1 309 ARG 309 309 309 ARG ARG A . n A 1 310 TRP 310 310 310 TRP TRP A . n A 1 311 ALA 311 311 311 ALA ALA A . n A 1 312 ILE 312 312 312 ILE ILE A . n A 1 313 ALA 313 313 313 ALA ALA A . n A 1 314 TYR 314 314 314 TYR TYR A . n A 1 315 LYS 315 315 315 LYS LYS A . n A 1 316 PHE 316 316 316 PHE PHE A . n A 1 317 PRO 317 317 317 PRO PRO A . n A 1 318 ALA 318 318 318 ALA ALA A . n A 1 319 GLN 319 319 ? ? ? A . n A 1 320 GLU 320 320 ? ? ? A . n A 1 321 GLU 321 321 ? ? ? A . n A 1 322 LEU 322 322 ? ? ? A . n A 1 323 THR 323 323 ? ? ? A . n A 1 324 LEU 324 324 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IWH 1 1319 1319 IWH IWH A . C 3 I6G 1 1320 1320 I6G I6G A . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . D 4 HOH 21 2021 2021 HOH HOH A . D 4 HOH 22 2022 2022 HOH HOH A . D 4 HOH 23 2023 2023 HOH HOH A . D 4 HOH 24 2024 2024 HOH HOH A . D 4 HOH 25 2025 2025 HOH HOH A . D 4 HOH 26 2026 2026 HOH HOH A . D 4 HOH 27 2027 2027 HOH HOH A . D 4 HOH 28 2028 2028 HOH HOH A . D 4 HOH 29 2029 2029 HOH HOH A . D 4 HOH 30 2030 2030 HOH HOH A . D 4 HOH 31 2031 2031 HOH HOH A . D 4 HOH 32 2032 2032 HOH HOH A . D 4 HOH 33 2033 2033 HOH HOH A . D 4 HOH 34 2034 2034 HOH HOH A . D 4 HOH 35 2035 2035 HOH HOH A . D 4 HOH 36 2036 2036 HOH HOH A . D 4 HOH 37 2037 2037 HOH HOH A . D 4 HOH 38 2038 2038 HOH HOH A . D 4 HOH 39 2039 2039 HOH HOH A . D 4 HOH 40 2040 2040 HOH HOH A . D 4 HOH 41 2041 2041 HOH HOH A . D 4 HOH 42 2042 2042 HOH HOH A . D 4 HOH 43 2043 2043 HOH HOH A . D 4 HOH 44 2044 2044 HOH HOH A . D 4 HOH 45 2045 2045 HOH HOH A . D 4 HOH 46 2046 2046 HOH HOH A . D 4 HOH 47 2047 2047 HOH HOH A . D 4 HOH 48 2048 2048 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6170 ? 1 MORE -34.6 ? 1 'SSA (A^2)' 30390 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 56.3290000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-10-14 2 'Structure model' 1 1 2017-06-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Data collection' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category diffrn_source # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_diffrn_source.type' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal BUSTER refinement 2.11.5 ? 1 MOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 AMoRE phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 27 ? ? -155.11 72.01 2 1 ASP A 145 ? ? -69.91 95.70 3 1 ASN A 193 ? ? -2.01 94.83 4 1 SER A 280 ? ? -141.55 26.70 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 65 ? CG ? A LYS 65 CG 2 1 Y 1 A LYS 65 ? CD ? A LYS 65 CD 3 1 Y 1 A LYS 65 ? CE ? A LYS 65 CE 4 1 Y 1 A LYS 65 ? NZ ? A LYS 65 NZ 5 1 Y 1 A LYS 107 ? CG ? A LYS 107 CG 6 1 Y 1 A LYS 107 ? CD ? A LYS 107 CD 7 1 Y 1 A LYS 107 ? CE ? A LYS 107 CE 8 1 Y 1 A LYS 107 ? NZ ? A LYS 107 NZ 9 1 Y 1 A GLU 191 ? CG ? A GLU 191 CG 10 1 Y 1 A GLU 191 ? CD ? A GLU 191 CD 11 1 Y 1 A GLU 191 ? OE1 ? A GLU 191 OE1 12 1 Y 1 A GLU 191 ? OE2 ? A GLU 191 OE2 13 1 Y 1 A ALA 318 ? O ? A ALA 318 O # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 319 ? A GLN 319 2 1 Y 1 A GLU 320 ? A GLU 320 3 1 Y 1 A GLU 321 ? A GLU 321 4 1 Y 1 A LEU 322 ? A LEU 322 5 1 Y 1 A THR 323 ? A THR 323 6 1 Y 1 A LEU 324 ? A LEU 324 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-(2,4-dimethylbenzyl)-6-oxo-1,6-dihydropyridine-3-carboxamide' IWH 3 8-methoxy-2,3-dimethylquinoxalin-5-ol I6G 4 water HOH #