data_4XEZ # _entry.id 4XEZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4XEZ pdb_00004xez 10.2210/pdb4xez/pdb WWPDB D_1000205556 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'unliganded wt CDO at pH 4.0 in the presence of Cys' 4IEO unspecified PDB 'unliganded wt CDO at pH 4.5 in the presence of Cys' 4IEP unspecified PDB 'unliganded wt CDO at pH 5.0 in the presence of Cys' 4IEQ unspecified PDB 'Cys-persulfenate bound wt CDO at pH 5.5 in the presence of Cys' 4IER unspecified PDB 'Cys-persulfeante bound wt CDO at pH 6.2 in the presence of Cys' 4IES unspecified PDB 'Cys-persulfeante bound wt CDO at pH 6.8 in the presence of Cys' 4IET unspecified PDB 'Cys-persulfenate bound wt CDO at pH 7.0 in the presence of Cys' 4IEU unspecified PDB 'Cys-only bound wt CDO at pH 8.0 in the presence of Cys' 4IEV unspecified PDB 'Cys-only bound Cysteine Dioxygenase at pH 9.0 in the presence of Cys' 4IEW unspecified PDB 'unliganded room-temp wt CDO at pH 6.2' 4IEX unspecified PDB 'Cys-persulfeante bound wt CDO at pH 7.0 in the presence of Cys,home-source structure' 4IEY unspecified PDB 'unliganded wt CDO at pH 8.0' 4IEZ unspecified PDB 'wt CDO at pH 8.0 in the presence of dithionite' 4JTN unspecified PDB 'Cys-only bound wt CDO at pH 8.0 in the presence of Cys and dithionite' 4JTO unspecified PDB 'Cys-persulfide bound wt CDO' 4KWK unspecified PDB '3-mercaptopropionate-persulfide bound wt CDO' 4KWL unspecified PDB 'unliganded C93A CDO at pH 6.2' 4PIX unspecified PDB 'homocysteine-bound C93A CDO at pH 6.2' 4PIY unspecified PDB 'homocysteine-bound wt CDO at pH 6.2' 4PIZ unspecified PDB 'azide-bound wt CDO at pH 6.2' 4PJY unspecified PDB 'Fe-Cl bound Y157F at pH ~7.0 in the presence of azide' 4EXT unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4XEZ _pdbx_database_status.recvd_initial_deposition_date 2014-12-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Driggers, C.M.' 1 'Karplus, P.A.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Mol. Biol.' _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 428 _citation.language ? _citation.page_first 3999 _citation.page_last 4012 _citation.title 'Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2016.07.012 _citation.pdbx_database_id_PubMed 27477048 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Driggers, C.M.' 1 ? primary 'Kean, K.M.' 2 ? primary 'Hirschberger, L.L.' 3 ? primary 'Cooley, R.B.' 4 ? primary 'Stipanuk, M.H.' 5 ? primary 'Karplus, P.A.' 6 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 4XEZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.600 _cell.length_a_esd ? _cell.length_b 57.600 _cell.length_b_esd ? _cell.length_c 122.400 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4XEZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cysteine dioxygenase type 1' 23042.889 1 1.13.11.20 Y157F ? ? 2 non-polymer syn 'FE (III) ION' 55.845 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 non-polymer syn THIOSULFATE 112.128 1 ? ? ? ? 5 water nat water 18.015 354 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cysteine dioxygenase type I,CDO-I' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEG HGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPP FDTCHAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN ; _entity_poly.pdbx_seq_one_letter_code_can ;MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEG HGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPP FDTCHAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ARG n 1 4 THR n 1 5 GLU n 1 6 LEU n 1 7 LEU n 1 8 LYS n 1 9 PRO n 1 10 ARG n 1 11 THR n 1 12 LEU n 1 13 ALA n 1 14 ASP n 1 15 LEU n 1 16 ILE n 1 17 ARG n 1 18 ILE n 1 19 LEU n 1 20 HIS n 1 21 GLU n 1 22 LEU n 1 23 PHE n 1 24 ALA n 1 25 GLY n 1 26 ASP n 1 27 GLU n 1 28 VAL n 1 29 ASN n 1 30 VAL n 1 31 GLU n 1 32 GLU n 1 33 VAL n 1 34 GLN n 1 35 ALA n 1 36 VAL n 1 37 LEU n 1 38 GLU n 1 39 ALA n 1 40 TYR n 1 41 GLU n 1 42 SER n 1 43 ASN n 1 44 PRO n 1 45 ALA n 1 46 GLU n 1 47 TRP n 1 48 ALA n 1 49 LEU n 1 50 TYR n 1 51 ALA n 1 52 LYS n 1 53 PHE n 1 54 ASP n 1 55 GLN n 1 56 TYR n 1 57 ARG n 1 58 TYR n 1 59 THR n 1 60 ARG n 1 61 ASN n 1 62 LEU n 1 63 VAL n 1 64 ASP n 1 65 GLN n 1 66 GLY n 1 67 ASN n 1 68 GLY n 1 69 LYS n 1 70 PHE n 1 71 ASN n 1 72 LEU n 1 73 MET n 1 74 ILE n 1 75 LEU n 1 76 CYS n 1 77 TRP n 1 78 GLY n 1 79 GLU n 1 80 GLY n 1 81 HIS n 1 82 GLY n 1 83 SER n 1 84 SER n 1 85 ILE n 1 86 HIS n 1 87 ASP n 1 88 HIS n 1 89 THR n 1 90 ASP n 1 91 SER n 1 92 HIS n 1 93 CYS n 1 94 PHE n 1 95 LEU n 1 96 LYS n 1 97 LEU n 1 98 LEU n 1 99 GLN n 1 100 GLY n 1 101 ASN n 1 102 LEU n 1 103 LYS n 1 104 GLU n 1 105 THR n 1 106 LEU n 1 107 PHE n 1 108 ASP n 1 109 TRP n 1 110 PRO n 1 111 ASP n 1 112 LYS n 1 113 LYS n 1 114 SER n 1 115 ASN n 1 116 GLU n 1 117 MET n 1 118 ILE n 1 119 LYS n 1 120 LYS n 1 121 SER n 1 122 GLU n 1 123 ARG n 1 124 THR n 1 125 LEU n 1 126 ARG n 1 127 GLU n 1 128 ASN n 1 129 GLN n 1 130 CYS n 1 131 ALA n 1 132 TYR n 1 133 ILE n 1 134 ASN n 1 135 ASP n 1 136 SER n 1 137 ILE n 1 138 GLY n 1 139 LEU n 1 140 HIS n 1 141 ARG n 1 142 VAL n 1 143 GLU n 1 144 ASN n 1 145 VAL n 1 146 SER n 1 147 HIS n 1 148 THR n 1 149 GLU n 1 150 PRO n 1 151 ALA n 1 152 VAL n 1 153 SER n 1 154 LEU n 1 155 HIS n 1 156 LEU n 1 157 PHE n 1 158 SER n 1 159 PRO n 1 160 PRO n 1 161 PHE n 1 162 ASP n 1 163 THR n 1 164 CYS n 1 165 HIS n 1 166 ALA n 1 167 PHE n 1 168 ASP n 1 169 GLN n 1 170 ARG n 1 171 THR n 1 172 GLY n 1 173 HIS n 1 174 LYS n 1 175 ASN n 1 176 LYS n 1 177 VAL n 1 178 THR n 1 179 MET n 1 180 THR n 1 181 PHE n 1 182 HIS n 1 183 SER n 1 184 LYS n 1 185 PHE n 1 186 GLY n 1 187 ILE n 1 188 ARG n 1 189 THR n 1 190 PRO n 1 191 PHE n 1 192 THR n 1 193 THR n 1 194 SER n 1 195 GLY n 1 196 SER n 1 197 LEU n 1 198 GLU n 1 199 ASN n 1 200 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 200 _entity_src_gen.gene_src_common_name Rat _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Cdo1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.db_code CDO1_RAT _struct_ref.db_name UNP _struct_ref.details ? _struct_ref.entity_id 1 _struct_ref.id 1 _struct_ref.seq_align ? _struct_ref.seq_dif ? _struct_ref.pdbx_db_accession P21816 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ;MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEG HGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPP FDTCHAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_align_end ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4XEZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 200 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P21816 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 200 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 200 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 4XEZ _struct_ref_seq_dif.mon_id PHE _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 157 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P21816 _struct_ref_seq_dif.db_mon_id TYR _struct_ref_seq_dif.pdbx_seq_db_seq_num 157 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 157 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THJ non-polymer . THIOSULFATE ? 'O3 S2 -2' 112.128 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4XEZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.20 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.17 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M tri-sodium citrate pH=5.6, 24% PEG 4000, 0.15M ammonium acetate. 1:1 drop ratio with microseeding.; Soak solution at pH 8.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-02-13 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(220) Asymmetric cut single crystal' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.977 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.977 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4XEZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.2469 _reflns.d_resolution_low 26 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 53790 _reflns.number_obs 53704 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 22.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.2469 _reflns_shell.d_res_low 1.27 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 45.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4XEZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.2469 _refine.ls_d_res_low 26 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 53704 _refine.ls_number_reflns_R_free 5308 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 92.20 _refine.ls_percent_reflns_R_free 9.88 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1249 _refine.ls_R_factor_R_free 0.1617 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1209 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model 4ieu _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 'same 5% as 4ieu' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 14.45 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.10 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1505 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.number_atoms_solvent 354 _refine_hist.number_atoms_total 1866 _refine_hist.d_res_high 1.2469 _refine_hist.d_res_low 26 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 ? 1633 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.245 ? 2218 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.895 ? 607 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.078 ? 237 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 292 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.2469 1.2611 . . 96 696 42.00 . . . 0.2885 . 0.2508 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2611 1.2760 . . 102 889 51.00 . . . 0.2945 . 0.2272 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2760 1.2915 . . 92 1049 60.00 . . . 0.2327 . 0.2189 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.2915 1.3079 . . 138 1172 69.00 . . . 0.2212 . 0.1878 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3079 1.3251 . . 140 1304 76.00 . . . 0.2175 . 0.1729 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3251 1.3432 . . 143 1455 83.00 . . . 0.2234 . 0.1778 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3432 1.3624 . . 185 1488 88.00 . . . 0.2234 . 0.1602 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3624 1.3827 . . 184 1623 94.00 . . . 0.2004 . 0.1546 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3827 1.4044 . . 182 1711 98.00 . . . 0.2097 . 0.1520 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4044 1.4274 . . 168 1736 100.00 . . . 0.1920 . 0.1381 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4274 1.4520 . . 192 1717 100.00 . . . 0.1747 . 0.1230 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4520 1.4784 . . 202 1730 100.00 . . . 0.1718 . 0.1178 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4784 1.5068 . . 187 1725 100.00 . . . 0.1593 . 0.1095 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5068 1.5376 . . 198 1717 100.00 . . . 0.1593 . 0.0984 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5376 1.5710 . . 209 1730 100.00 . . . 0.1459 . 0.1026 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5710 1.6075 . . 199 1716 100.00 . . . 0.1378 . 0.0978 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6075 1.6477 . . 176 1766 100.00 . . . 0.1227 . 0.1004 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6477 1.6923 . . 193 1732 100.00 . . . 0.1401 . 0.1009 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6923 1.7421 . . 192 1734 100.00 . . . 0.1517 . 0.1080 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7421 1.7983 . . 187 1752 100.00 . . . 0.1328 . 0.1124 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7983 1.8625 . . 175 1766 100.00 . . . 0.1591 . 0.1079 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8625 1.9371 . . 177 1758 100.00 . . . 0.1535 . 0.1077 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9371 2.0252 . . 203 1742 100.00 . . . 0.1497 . 0.1019 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0252 2.1319 . . 200 1755 100.00 . . . 0.1308 . 0.1107 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1319 2.2654 . . 192 1780 100.00 . . . 0.1353 . 0.1073 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2654 2.4402 . . 174 1786 100.00 . . . 0.1566 . 0.1205 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4402 2.6856 . . 216 1759 100.00 . . . 0.1870 . 0.1250 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6856 3.0737 . . 197 1818 100.00 . . . 0.1652 . 0.1312 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0737 3.8705 . . 198 1839 100.00 . . . 0.1652 . 0.1184 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8705 26.0645 . . 211 1951 100.00 . . . 0.1596 . 0.1262 . . . . . . . . . . # _struct.entry_id 4XEZ _struct.title 'cysteine dioxygenase variant - Y157F at pH 8.0 with dithionite' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4XEZ _struct_keywords.text 'Cupin Fold, cysteine to cysteine sulfinic acid catalysis, Cytosol, thiol dioxygenase, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 11 ? PHE A 23 ? THR A 11 PHE A 23 1 ? 13 HELX_P HELX_P2 AA2 ASN A 29 ? TYR A 40 ? ASN A 29 TYR A 40 1 ? 12 HELX_P HELX_P3 AA3 ASN A 43 ? ALA A 48 ? ASN A 43 ALA A 48 1 ? 6 HELX_P HELX_P4 AA4 LEU A 49 ? ALA A 51 ? LEU A 49 ALA A 51 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 86 NE2 ? ? ? 1_555 B FE . FE ? ? A HIS 86 A FE 501 1_555 ? ? ? ? ? ? ? 2.027 ? ? metalc2 metalc ? ? A HIS 88 NE2 ? ? ? 1_555 B FE . FE ? ? A HIS 88 A FE 501 1_555 ? ? ? ? ? ? ? 2.031 ? ? metalc3 metalc ? ? A HIS 140 NE2 ? ? ? 1_555 B FE . FE ? ? A HIS 140 A FE 501 1_555 ? ? ? ? ? ? ? 2.061 ? ? metalc4 metalc ? ? B FE . FE ? ? ? 1_555 D THJ . S2 B ? A FE 501 A THJ 503 1_555 ? ? ? ? ? ? ? 2.278 ? ? metalc5 metalc ? ? B FE . FE ? ? ? 1_555 E HOH . O ? ? A FE 501 A HOH 601 1_555 ? ? ? ? ? ? ? 1.930 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 158 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 158 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 159 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 159 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -6.31 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 3 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 130 ? ILE A 133 ? CYS A 130 ILE A 133 AA1 2 HIS A 92 ? GLN A 99 ? HIS A 92 GLN A 99 AA1 3 ALA A 151 ? SER A 158 ? ALA A 151 SER A 158 AA1 4 ASN A 71 ? TRP A 77 ? ASN A 71 TRP A 77 AA1 5 THR A 59 ? ASP A 64 ? THR A 59 ASP A 64 AA1 6 SER A 183 ? LYS A 184 ? SER A 183 LYS A 184 AA1 7 ILE A 187 ? ARG A 188 ? ILE A 187 ARG A 188 AA2 1 ILE A 85 ? HIS A 86 ? ILE A 85 HIS A 86 AA2 2 THR A 163 ? PHE A 167 ? THR A 163 PHE A 167 AA2 3 LYS A 174 ? THR A 178 ? LYS A 174 THR A 178 AA3 1 SER A 121 ? LEU A 125 ? SER A 121 LEU A 125 AA3 2 LEU A 102 ? PHE A 107 ? LEU A 102 PHE A 107 AA3 3 LEU A 139 ? GLU A 143 ? LEU A 139 GLU A 143 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ALA A 131 ? O ALA A 131 N LEU A 95 ? N LEU A 95 AA1 2 3 N HIS A 92 ? N HIS A 92 O SER A 158 ? O SER A 158 AA1 3 4 O HIS A 155 ? O HIS A 155 N MET A 73 ? N MET A 73 AA1 4 5 O ILE A 74 ? O ILE A 74 N ASN A 61 ? N ASN A 61 AA1 5 6 N LEU A 62 ? N LEU A 62 O SER A 183 ? O SER A 183 AA1 6 7 N LYS A 184 ? N LYS A 184 O ILE A 187 ? O ILE A 187 AA2 1 2 N ILE A 85 ? N ILE A 85 O PHE A 167 ? O PHE A 167 AA2 2 3 N CYS A 164 ? N CYS A 164 O VAL A 177 ? O VAL A 177 AA3 1 2 O LEU A 125 ? O LEU A 125 N LEU A 102 ? N LEU A 102 AA3 2 3 N LYS A 103 ? N LYS A 103 O GLU A 143 ? O GLU A 143 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A FE 501 ? 6 'binding site for residue FE A 501' AC2 Software A CL 502 ? 7 'binding site for residue CL A 502' AC3 Software A THJ 503 ? 13 'binding site for residue THJ A 503' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HIS A 86 ? HIS A 86 . ? 1_555 ? 2 AC1 6 HIS A 88 ? HIS A 88 . ? 1_555 ? 3 AC1 6 HIS A 140 ? HIS A 140 . ? 1_555 ? 4 AC1 6 CL C . ? CL A 502 . ? 1_555 ? 5 AC1 6 THJ D . ? THJ A 503 . ? 1_555 ? 6 AC1 6 HOH E . ? HOH A 601 . ? 1_555 ? 7 AC2 7 HIS A 86 ? HIS A 86 . ? 1_555 ? 8 AC2 7 HIS A 88 ? HIS A 88 . ? 1_555 ? 9 AC2 7 HIS A 140 ? HIS A 140 . ? 1_555 ? 10 AC2 7 HIS A 155 ? HIS A 155 . ? 1_555 ? 11 AC2 7 FE B . ? FE A 501 . ? 1_555 ? 12 AC2 7 THJ D . ? THJ A 503 . ? 1_555 ? 13 AC2 7 HOH E . ? HOH A 601 . ? 1_555 ? 14 AC3 13 ARG A 60 ? ARG A 60 . ? 1_555 ? 15 AC3 13 LEU A 75 ? LEU A 75 . ? 1_555 ? 16 AC3 13 HIS A 86 ? HIS A 86 . ? 1_555 ? 17 AC3 13 HIS A 88 ? HIS A 88 . ? 1_555 ? 18 AC3 13 HIS A 140 ? HIS A 140 . ? 1_555 ? 19 AC3 13 HIS A 155 ? HIS A 155 . ? 1_555 ? 20 AC3 13 PHE A 157 ? PHE A 157 . ? 1_555 ? 21 AC3 13 FE B . ? FE A 501 . ? 1_555 ? 22 AC3 13 CL C . ? CL A 502 . ? 1_555 ? 23 AC3 13 HOH E . ? HOH A 601 . ? 1_555 ? 24 AC3 13 HOH E . ? HOH A 692 . ? 1_555 ? 25 AC3 13 HOH E . ? HOH A 722 . ? 1_555 ? 26 AC3 13 HOH E . ? HOH A 779 . ? 1_555 ? # _atom_sites.entry_id 4XEZ _atom_sites.fract_transf_matrix[1][1] 0.017361 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017361 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008170 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 CYS 93 93 93 CYS CYS A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 MET 117 117 117 MET MET A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 HIS 140 140 140 HIS HIS A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 HIS 155 155 155 HIS HIS A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 PHE 157 157 157 PHE PHE A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 PRO 159 159 159 PRO PRO A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 CYS 164 164 164 CYS CYS A . n A 1 165 HIS 165 165 165 HIS HIS A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 GLN 169 169 169 GLN GLN A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 MET 179 179 179 MET MET A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 PHE 181 181 181 PHE PHE A . n A 1 182 HIS 182 182 182 HIS HIS A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 PHE 185 185 185 PHE PHE A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 THR 189 189 189 THR THR A . n A 1 190 PRO 190 190 190 PRO PRO A . n A 1 191 PHE 191 191 ? ? ? A . n A 1 192 THR 192 192 ? ? ? A . n A 1 193 THR 193 193 ? ? ? A . n A 1 194 SER 194 194 ? ? ? A . n A 1 195 GLY 195 195 ? ? ? A . n A 1 196 SER 196 196 ? ? ? A . n A 1 197 LEU 197 197 ? ? ? A . n A 1 198 GLU 198 198 ? ? ? A . n A 1 199 ASN 199 199 ? ? ? A . n A 1 200 ASN 200 200 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE 1 501 501 FE FE A . C 3 CL 1 502 1 CL CL A . D 4 THJ 1 503 1 THJ THJ A . E 5 HOH 1 601 351 HOH HOH A . E 5 HOH 2 602 306 HOH HOH A . E 5 HOH 3 603 109 HOH HOH A . E 5 HOH 4 604 341 HOH HOH A . E 5 HOH 5 605 147 HOH HOH A . E 5 HOH 6 606 225 HOH HOH A . E 5 HOH 7 607 322 HOH HOH A . E 5 HOH 8 608 260 HOH HOH A . E 5 HOH 9 609 87 HOH HOH A . E 5 HOH 10 610 181 HOH HOH A . E 5 HOH 11 611 157 HOH HOH A . E 5 HOH 12 612 145 HOH HOH A . E 5 HOH 13 613 305 HOH HOH A . E 5 HOH 14 614 315 HOH HOH A . E 5 HOH 15 615 258 HOH HOH A . E 5 HOH 16 616 346 HOH HOH A . E 5 HOH 17 617 196 HOH HOH A . E 5 HOH 18 618 197 HOH HOH A . E 5 HOH 19 619 126 HOH HOH A . E 5 HOH 20 620 215 HOH HOH A . E 5 HOH 21 621 99 HOH HOH A . E 5 HOH 22 622 75 HOH HOH A . E 5 HOH 23 623 72 HOH HOH A . E 5 HOH 24 624 342 HOH HOH A . E 5 HOH 25 625 227 HOH HOH A . E 5 HOH 26 626 51 HOH HOH A . E 5 HOH 27 627 98 HOH HOH A . E 5 HOH 28 628 139 HOH HOH A . E 5 HOH 29 629 25 HOH HOH A . E 5 HOH 30 630 68 HOH HOH A . E 5 HOH 31 631 271 HOH HOH A . E 5 HOH 32 632 133 HOH HOH A . E 5 HOH 33 633 18 HOH HOH A . E 5 HOH 34 634 140 HOH HOH A . E 5 HOH 35 635 73 HOH HOH A . E 5 HOH 36 636 199 HOH HOH A . E 5 HOH 37 637 314 HOH HOH A . E 5 HOH 38 638 253 HOH HOH A . E 5 HOH 39 639 175 HOH HOH A . E 5 HOH 40 640 56 HOH HOH A . E 5 HOH 41 641 209 HOH HOH A . E 5 HOH 42 642 31 HOH HOH A . E 5 HOH 43 643 233 HOH HOH A . E 5 HOH 44 644 347 HOH HOH A . E 5 HOH 45 645 301 HOH HOH A . E 5 HOH 46 646 20 HOH HOH A . E 5 HOH 47 647 363 HOH HOH A . E 5 HOH 48 648 307 HOH HOH A . E 5 HOH 49 649 59 HOH HOH A . E 5 HOH 50 650 11 HOH HOH A . E 5 HOH 51 651 183 HOH HOH A . E 5 HOH 52 652 221 HOH HOH A . E 5 HOH 53 653 188 HOH HOH A . E 5 HOH 54 654 222 HOH HOH A . E 5 HOH 55 655 16 HOH HOH A . E 5 HOH 56 656 173 HOH HOH A . E 5 HOH 57 657 13 HOH HOH A . E 5 HOH 58 658 295 HOH HOH A . E 5 HOH 59 659 131 HOH HOH A . E 5 HOH 60 660 38 HOH HOH A . E 5 HOH 61 661 92 HOH HOH A . E 5 HOH 62 662 195 HOH HOH A . E 5 HOH 63 663 27 HOH HOH A . E 5 HOH 64 664 152 HOH HOH A . E 5 HOH 65 665 101 HOH HOH A . E 5 HOH 66 666 28 HOH HOH A . E 5 HOH 67 667 83 HOH HOH A . E 5 HOH 68 668 94 HOH HOH A . E 5 HOH 69 669 69 HOH HOH A . E 5 HOH 70 670 48 HOH HOH A . E 5 HOH 71 671 333 HOH HOH A . E 5 HOH 72 672 29 HOH HOH A . E 5 HOH 73 673 283 HOH HOH A . E 5 HOH 74 674 231 HOH HOH A . E 5 HOH 75 675 167 HOH HOH A . E 5 HOH 76 676 136 HOH HOH A . E 5 HOH 77 677 105 HOH HOH A . E 5 HOH 78 678 50 HOH HOH A . E 5 HOH 79 679 9 HOH HOH A . E 5 HOH 80 680 108 HOH HOH A . E 5 HOH 81 681 49 HOH HOH A . E 5 HOH 82 682 21 HOH HOH A . E 5 HOH 83 683 160 HOH HOH A . E 5 HOH 84 684 1 HOH HOH A . E 5 HOH 85 685 246 HOH HOH A . E 5 HOH 86 686 52 HOH HOH A . E 5 HOH 87 687 190 HOH HOH A . E 5 HOH 88 688 208 HOH HOH A . E 5 HOH 89 689 268 HOH HOH A . E 5 HOH 90 690 212 HOH HOH A . E 5 HOH 91 691 63 HOH HOH A . E 5 HOH 92 692 357 HOH HOH A . E 5 HOH 93 693 39 HOH HOH A . E 5 HOH 94 694 352 HOH HOH A . E 5 HOH 95 695 103 HOH HOH A . E 5 HOH 96 696 232 HOH HOH A . E 5 HOH 97 697 66 HOH HOH A . E 5 HOH 98 698 34 HOH HOH A . E 5 HOH 99 699 15 HOH HOH A . E 5 HOH 100 700 123 HOH HOH A . E 5 HOH 101 701 205 HOH HOH A . E 5 HOH 102 702 115 HOH HOH A . E 5 HOH 103 703 14 HOH HOH A . E 5 HOH 104 704 10 HOH HOH A . E 5 HOH 105 705 61 HOH HOH A . E 5 HOH 106 706 76 HOH HOH A . E 5 HOH 107 707 55 HOH HOH A . E 5 HOH 108 708 57 HOH HOH A . E 5 HOH 109 709 60 HOH HOH A . E 5 HOH 110 710 198 HOH HOH A . E 5 HOH 111 711 191 HOH HOH A . E 5 HOH 112 712 89 HOH HOH A . E 5 HOH 113 713 113 HOH HOH A . E 5 HOH 114 714 186 HOH HOH A . E 5 HOH 115 715 97 HOH HOH A . E 5 HOH 116 716 44 HOH HOH A . E 5 HOH 117 717 278 HOH HOH A . E 5 HOH 118 718 71 HOH HOH A . E 5 HOH 119 719 112 HOH HOH A . E 5 HOH 120 720 30 HOH HOH A . E 5 HOH 121 721 353 HOH HOH A . E 5 HOH 122 722 312 HOH HOH A . E 5 HOH 123 723 35 HOH HOH A . E 5 HOH 124 724 272 HOH HOH A . E 5 HOH 125 725 193 HOH HOH A . E 5 HOH 126 726 153 HOH HOH A . E 5 HOH 127 727 62 HOH HOH A . E 5 HOH 128 728 90 HOH HOH A . E 5 HOH 129 729 323 HOH HOH A . E 5 HOH 130 730 124 HOH HOH A . E 5 HOH 131 731 161 HOH HOH A . E 5 HOH 132 732 114 HOH HOH A . E 5 HOH 133 733 230 HOH HOH A . E 5 HOH 134 734 5 HOH HOH A . E 5 HOH 135 735 252 HOH HOH A . E 5 HOH 136 736 33 HOH HOH A . E 5 HOH 137 737 84 HOH HOH A . E 5 HOH 138 738 82 HOH HOH A . E 5 HOH 139 739 67 HOH HOH A . E 5 HOH 140 740 12 HOH HOH A . E 5 HOH 141 741 19 HOH HOH A . E 5 HOH 142 742 32 HOH HOH A . E 5 HOH 143 743 319 HOH HOH A . E 5 HOH 144 744 132 HOH HOH A . E 5 HOH 145 745 360 HOH HOH A . E 5 HOH 146 746 159 HOH HOH A . E 5 HOH 147 747 23 HOH HOH A . E 5 HOH 148 748 127 HOH HOH A . E 5 HOH 149 749 220 HOH HOH A . E 5 HOH 150 750 36 HOH HOH A . E 5 HOH 151 751 282 HOH HOH A . E 5 HOH 152 752 158 HOH HOH A . E 5 HOH 153 753 2 HOH HOH A . E 5 HOH 154 754 265 HOH HOH A . E 5 HOH 155 755 8 HOH HOH A . E 5 HOH 156 756 22 HOH HOH A . E 5 HOH 157 757 148 HOH HOH A . E 5 HOH 158 758 46 HOH HOH A . E 5 HOH 159 759 37 HOH HOH A . E 5 HOH 160 760 210 HOH HOH A . E 5 HOH 161 761 244 HOH HOH A . E 5 HOH 162 762 135 HOH HOH A . E 5 HOH 163 763 3 HOH HOH A . E 5 HOH 164 764 154 HOH HOH A . E 5 HOH 165 765 45 HOH HOH A . E 5 HOH 166 766 106 HOH HOH A . E 5 HOH 167 767 80 HOH HOH A . E 5 HOH 168 768 6 HOH HOH A . E 5 HOH 169 769 293 HOH HOH A . E 5 HOH 170 770 276 HOH HOH A . E 5 HOH 171 771 216 HOH HOH A . E 5 HOH 172 772 214 HOH HOH A . E 5 HOH 173 773 219 HOH HOH A . E 5 HOH 174 774 270 HOH HOH A . E 5 HOH 175 775 4 HOH HOH A . E 5 HOH 176 776 207 HOH HOH A . E 5 HOH 177 777 41 HOH HOH A . E 5 HOH 178 778 163 HOH HOH A . E 5 HOH 179 779 129 HOH HOH A . E 5 HOH 180 780 40 HOH HOH A . E 5 HOH 181 781 156 HOH HOH A . E 5 HOH 182 782 180 HOH HOH A . E 5 HOH 183 783 24 HOH HOH A . E 5 HOH 184 784 241 HOH HOH A . E 5 HOH 185 785 53 HOH HOH A . E 5 HOH 186 786 125 HOH HOH A . E 5 HOH 187 787 296 HOH HOH A . E 5 HOH 188 788 70 HOH HOH A . E 5 HOH 189 789 85 HOH HOH A . E 5 HOH 190 790 58 HOH HOH A . E 5 HOH 191 791 142 HOH HOH A . E 5 HOH 192 792 257 HOH HOH A . E 5 HOH 193 793 336 HOH HOH A . E 5 HOH 194 794 7 HOH HOH A . E 5 HOH 195 795 42 HOH HOH A . E 5 HOH 196 796 47 HOH HOH A . E 5 HOH 197 797 224 HOH HOH A . E 5 HOH 198 798 118 HOH HOH A . E 5 HOH 199 799 294 HOH HOH A . E 5 HOH 200 800 121 HOH HOH A . E 5 HOH 201 801 189 HOH HOH A . E 5 HOH 202 802 206 HOH HOH A . E 5 HOH 203 803 74 HOH HOH A . E 5 HOH 204 804 256 HOH HOH A . E 5 HOH 205 805 302 HOH HOH A . E 5 HOH 206 806 343 HOH HOH A . E 5 HOH 207 807 255 HOH HOH A . E 5 HOH 208 808 143 HOH HOH A . E 5 HOH 209 809 354 HOH HOH A . E 5 HOH 210 810 91 HOH HOH A . E 5 HOH 211 811 235 HOH HOH A . E 5 HOH 212 812 93 HOH HOH A . E 5 HOH 213 813 358 HOH HOH A . E 5 HOH 214 814 81 HOH HOH A . E 5 HOH 215 815 267 HOH HOH A . E 5 HOH 216 816 281 HOH HOH A . E 5 HOH 217 817 178 HOH HOH A . E 5 HOH 218 818 182 HOH HOH A . E 5 HOH 219 819 329 HOH HOH A . E 5 HOH 220 820 308 HOH HOH A . E 5 HOH 221 821 117 HOH HOH A . E 5 HOH 222 822 43 HOH HOH A . E 5 HOH 223 823 77 HOH HOH A . E 5 HOH 224 824 345 HOH HOH A . E 5 HOH 225 825 137 HOH HOH A . E 5 HOH 226 826 367 HOH HOH A . E 5 HOH 227 827 128 HOH HOH A . E 5 HOH 228 828 202 HOH HOH A . E 5 HOH 229 829 362 HOH HOH A . E 5 HOH 230 830 122 HOH HOH A . E 5 HOH 231 831 316 HOH HOH A . E 5 HOH 232 832 146 HOH HOH A . E 5 HOH 233 833 100 HOH HOH A . E 5 HOH 234 834 79 HOH HOH A . E 5 HOH 235 835 228 HOH HOH A . E 5 HOH 236 836 149 HOH HOH A . E 5 HOH 237 837 26 HOH HOH A . E 5 HOH 238 838 174 HOH HOH A . E 5 HOH 239 839 201 HOH HOH A . E 5 HOH 240 840 325 HOH HOH A . E 5 HOH 241 841 350 HOH HOH A . E 5 HOH 242 842 184 HOH HOH A . E 5 HOH 243 843 285 HOH HOH A . E 5 HOH 244 844 130 HOH HOH A . E 5 HOH 245 845 311 HOH HOH A . E 5 HOH 246 846 247 HOH HOH A . E 5 HOH 247 847 110 HOH HOH A . E 5 HOH 248 848 359 HOH HOH A . E 5 HOH 249 849 213 HOH HOH A . E 5 HOH 250 850 263 HOH HOH A . E 5 HOH 251 851 320 HOH HOH A . E 5 HOH 252 852 95 HOH HOH A . E 5 HOH 253 853 168 HOH HOH A . E 5 HOH 254 854 290 HOH HOH A . E 5 HOH 255 855 309 HOH HOH A . E 5 HOH 256 856 242 HOH HOH A . E 5 HOH 257 857 177 HOH HOH A . E 5 HOH 258 858 179 HOH HOH A . E 5 HOH 259 859 218 HOH HOH A . E 5 HOH 260 860 104 HOH HOH A . E 5 HOH 261 861 155 HOH HOH A . E 5 HOH 262 862 229 HOH HOH A . E 5 HOH 263 863 340 HOH HOH A . E 5 HOH 264 864 344 HOH HOH A . E 5 HOH 265 865 171 HOH HOH A . E 5 HOH 266 866 331 HOH HOH A . E 5 HOH 267 867 119 HOH HOH A . E 5 HOH 268 868 328 HOH HOH A . E 5 HOH 269 869 298 HOH HOH A . E 5 HOH 270 870 204 HOH HOH A . E 5 HOH 271 871 249 HOH HOH A . E 5 HOH 272 872 120 HOH HOH A . E 5 HOH 273 873 349 HOH HOH A . E 5 HOH 274 874 321 HOH HOH A . E 5 HOH 275 875 355 HOH HOH A . E 5 HOH 276 876 166 HOH HOH A . E 5 HOH 277 877 164 HOH HOH A . E 5 HOH 278 878 111 HOH HOH A . E 5 HOH 279 879 289 HOH HOH A . E 5 HOH 280 880 96 HOH HOH A . E 5 HOH 281 881 274 HOH HOH A . E 5 HOH 282 882 286 HOH HOH A . E 5 HOH 283 883 251 HOH HOH A . E 5 HOH 284 884 192 HOH HOH A . E 5 HOH 285 885 361 HOH HOH A . E 5 HOH 286 886 134 HOH HOH A . E 5 HOH 287 887 292 HOH HOH A . E 5 HOH 288 888 88 HOH HOH A . E 5 HOH 289 889 200 HOH HOH A . E 5 HOH 290 890 310 HOH HOH A . E 5 HOH 291 891 348 HOH HOH A . E 5 HOH 292 892 237 HOH HOH A . E 5 HOH 293 893 86 HOH HOH A . E 5 HOH 294 894 332 HOH HOH A . E 5 HOH 295 895 273 HOH HOH A . E 5 HOH 296 896 327 HOH HOH A . E 5 HOH 297 897 250 HOH HOH A . E 5 HOH 298 898 243 HOH HOH A . E 5 HOH 299 899 185 HOH HOH A . E 5 HOH 300 900 275 HOH HOH A . E 5 HOH 301 901 300 HOH HOH A . E 5 HOH 302 902 288 HOH HOH A . E 5 HOH 303 903 17 HOH HOH A . E 5 HOH 304 904 304 HOH HOH A . E 5 HOH 305 905 330 HOH HOH A . E 5 HOH 306 906 151 HOH HOH A . E 5 HOH 307 907 162 HOH HOH A . E 5 HOH 308 908 170 HOH HOH A . E 5 HOH 309 909 266 HOH HOH A . E 5 HOH 310 910 150 HOH HOH A . E 5 HOH 311 911 364 HOH HOH A . E 5 HOH 312 912 138 HOH HOH A . E 5 HOH 313 913 226 HOH HOH A . E 5 HOH 314 914 238 HOH HOH A . E 5 HOH 315 915 65 HOH HOH A . E 5 HOH 316 916 326 HOH HOH A . E 5 HOH 317 917 78 HOH HOH A . E 5 HOH 318 918 217 HOH HOH A . E 5 HOH 319 919 279 HOH HOH A . E 5 HOH 320 920 236 HOH HOH A . E 5 HOH 321 921 144 HOH HOH A . E 5 HOH 322 922 176 HOH HOH A . E 5 HOH 323 923 245 HOH HOH A . E 5 HOH 324 924 165 HOH HOH A . E 5 HOH 325 925 102 HOH HOH A . E 5 HOH 326 926 324 HOH HOH A . E 5 HOH 327 927 211 HOH HOH A . E 5 HOH 328 928 303 HOH HOH A . E 5 HOH 329 929 269 HOH HOH A . E 5 HOH 330 930 116 HOH HOH A . E 5 HOH 331 931 317 HOH HOH A . E 5 HOH 332 932 318 HOH HOH A . E 5 HOH 333 933 299 HOH HOH A . E 5 HOH 334 934 141 HOH HOH A . E 5 HOH 335 935 261 HOH HOH A . E 5 HOH 336 936 172 HOH HOH A . E 5 HOH 337 937 169 HOH HOH A . E 5 HOH 338 938 338 HOH HOH A . E 5 HOH 339 939 187 HOH HOH A . E 5 HOH 340 940 287 HOH HOH A . E 5 HOH 341 941 366 HOH HOH A . E 5 HOH 342 942 297 HOH HOH A . E 5 HOH 343 943 64 HOH HOH A . E 5 HOH 344 944 240 HOH HOH A . E 5 HOH 345 945 203 HOH HOH A . E 5 HOH 346 946 277 HOH HOH A . E 5 HOH 347 947 248 HOH HOH A . E 5 HOH 348 948 365 HOH HOH A . E 5 HOH 349 949 54 HOH HOH A . E 5 HOH 350 950 107 HOH HOH A . E 5 HOH 351 951 254 HOH HOH A . E 5 HOH 352 952 284 HOH HOH A . E 5 HOH 353 953 291 HOH HOH A . E 5 HOH 354 954 337 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 530 ? 1 MORE -33 ? 1 'SSA (A^2)' 9350 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 882 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id E _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE . ? A FE 501 ? 1_555 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 102.3 ? 2 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE . ? A FE 501 ? 1_555 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 100.6 ? 3 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 FE ? B FE . ? A FE 501 ? 1_555 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 98.6 ? 4 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE . ? A FE 501 ? 1_555 S2 B D THJ . ? A THJ 503 ? 1_555 118.6 ? 5 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 FE ? B FE . ? A FE 501 ? 1_555 S2 B D THJ . ? A THJ 503 ? 1_555 125.1 ? 6 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 FE ? B FE . ? A FE 501 ? 1_555 S2 B D THJ . ? A THJ 503 ? 1_555 107.4 ? 7 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE . ? A FE 501 ? 1_555 O ? E HOH . ? A HOH 601 ? 1_555 170.8 ? 8 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 FE ? B FE . ? A FE 501 ? 1_555 O ? E HOH . ? A HOH 601 ? 1_555 68.5 ? 9 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 FE ? B FE . ? A FE 501 ? 1_555 O ? E HOH . ? A HOH 601 ? 1_555 80.3 ? 10 S2 B D THJ . ? A THJ 503 ? 1_555 FE ? B FE . ? A FE 501 ? 1_555 O ? E HOH . ? A HOH 601 ? 1_555 69.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-03-16 2 'Structure model' 1 1 2016-12-14 3 'Structure model' 1 2 2017-09-06 4 'Structure model' 1 3 2019-12-04 5 'Structure model' 1 4 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Author supporting evidence' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_audit_support 2 4 'Structure model' pdbx_audit_support 3 5 'Structure model' chem_comp_atom 4 5 'Structure model' chem_comp_bond 5 5 'Structure model' database_2 6 5 'Structure model' pdbx_initial_refinement_model 7 5 'Structure model' pdbx_struct_conn_angle 8 5 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_audit_support.funding_organization' 2 4 'Structure model' '_pdbx_audit_support.funding_organization' 3 5 'Structure model' '_database_2.pdbx_DOI' 4 5 'Structure model' '_database_2.pdbx_database_accession' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_alt_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_alt_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 17 5 'Structure model' '_pdbx_struct_conn_angle.value' 18 5 'Structure model' '_struct_conn.pdbx_dist_value' 19 5 'Structure model' '_struct_conn.pdbx_ptnr2_label_alt_id' 20 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 21 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 22 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 23 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 24 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.9_1692)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.9_1692)' 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 FE _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 FE _pdbx_validate_close_contact.auth_seq_id_1 501 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 CL _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 CL _pdbx_validate_close_contact.auth_seq_id_2 502 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 A _pdbx_validate_close_contact.dist 2.17 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 128 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 75.45 _pdbx_validate_torsion.psi -10.28 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 947 ? 5.85 . 2 1 O ? A HOH 948 ? 6.01 . 3 1 O ? A HOH 949 ? 6.11 . 4 1 O ? A HOH 950 ? 6.32 . 5 1 O ? A HOH 951 ? 6.67 . 6 1 O ? A HOH 952 ? 6.75 . 7 1 O ? A HOH 953 ? 7.36 . 8 1 O ? A HOH 954 ? 7.99 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 112 ? CG ? A LYS 112 CG 2 1 Y 1 A LYS 112 ? CD ? A LYS 112 CD 3 1 Y 1 A LYS 112 ? CE ? A LYS 112 CE 4 1 Y 1 A LYS 112 ? NZ ? A LYS 112 NZ 5 1 Y 1 A LYS 184 ? CE ? A LYS 184 CE 6 1 Y 1 A LYS 184 ? NZ ? A LYS 184 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A PHE 191 ? A PHE 191 6 1 Y 1 A THR 192 ? A THR 192 7 1 Y 1 A THR 193 ? A THR 193 8 1 Y 1 A SER 194 ? A SER 194 9 1 Y 1 A GLY 195 ? A GLY 195 10 1 Y 1 A SER 196 ? A SER 196 11 1 Y 1 A LEU 197 ? A LEU 197 12 1 Y 1 A GLU 198 ? A GLU 198 13 1 Y 1 A ASN 199 ? A ASN 199 14 1 Y 1 A ASN 200 ? A ASN 200 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 FE FE FE N N 89 GLN N N N N 90 GLN CA C N S 91 GLN C C N N 92 GLN O O N N 93 GLN CB C N N 94 GLN CG C N N 95 GLN CD C N N 96 GLN OE1 O N N 97 GLN NE2 N N N 98 GLN OXT O N N 99 GLN H H N N 100 GLN H2 H N N 101 GLN HA H N N 102 GLN HB2 H N N 103 GLN HB3 H N N 104 GLN HG2 H N N 105 GLN HG3 H N N 106 GLN HE21 H N N 107 GLN HE22 H N N 108 GLN HXT H N N 109 GLU N N N N 110 GLU CA C N S 111 GLU C C N N 112 GLU O O N N 113 GLU CB C N N 114 GLU CG C N N 115 GLU CD C N N 116 GLU OE1 O N N 117 GLU OE2 O N N 118 GLU OXT O N N 119 GLU H H N N 120 GLU H2 H N N 121 GLU HA H N N 122 GLU HB2 H N N 123 GLU HB3 H N N 124 GLU HG2 H N N 125 GLU HG3 H N N 126 GLU HE2 H N N 127 GLU HXT H N N 128 GLY N N N N 129 GLY CA C N N 130 GLY C C N N 131 GLY O O N N 132 GLY OXT O N N 133 GLY H H N N 134 GLY H2 H N N 135 GLY HA2 H N N 136 GLY HA3 H N N 137 GLY HXT H N N 138 HIS N N N N 139 HIS CA C N S 140 HIS C C N N 141 HIS O O N N 142 HIS CB C N N 143 HIS CG C Y N 144 HIS ND1 N Y N 145 HIS CD2 C Y N 146 HIS CE1 C Y N 147 HIS NE2 N Y N 148 HIS OXT O N N 149 HIS H H N N 150 HIS H2 H N N 151 HIS HA H N N 152 HIS HB2 H N N 153 HIS HB3 H N N 154 HIS HD1 H N N 155 HIS HD2 H N N 156 HIS HE1 H N N 157 HIS HE2 H N N 158 HIS HXT H N N 159 HOH O O N N 160 HOH H1 H N N 161 HOH H2 H N N 162 ILE N N N N 163 ILE CA C N S 164 ILE C C N N 165 ILE O O N N 166 ILE CB C N S 167 ILE CG1 C N N 168 ILE CG2 C N N 169 ILE CD1 C N N 170 ILE OXT O N N 171 ILE H H N N 172 ILE H2 H N N 173 ILE HA H N N 174 ILE HB H N N 175 ILE HG12 H N N 176 ILE HG13 H N N 177 ILE HG21 H N N 178 ILE HG22 H N N 179 ILE HG23 H N N 180 ILE HD11 H N N 181 ILE HD12 H N N 182 ILE HD13 H N N 183 ILE HXT H N N 184 LEU N N N N 185 LEU CA C N S 186 LEU C C N N 187 LEU O O N N 188 LEU CB C N N 189 LEU CG C N N 190 LEU CD1 C N N 191 LEU CD2 C N N 192 LEU OXT O N N 193 LEU H H N N 194 LEU H2 H N N 195 LEU HA H N N 196 LEU HB2 H N N 197 LEU HB3 H N N 198 LEU HG H N N 199 LEU HD11 H N N 200 LEU HD12 H N N 201 LEU HD13 H N N 202 LEU HD21 H N N 203 LEU HD22 H N N 204 LEU HD23 H N N 205 LEU HXT H N N 206 LYS N N N N 207 LYS CA C N S 208 LYS C C N N 209 LYS O O N N 210 LYS CB C N N 211 LYS CG C N N 212 LYS CD C N N 213 LYS CE C N N 214 LYS NZ N N N 215 LYS OXT O N N 216 LYS H H N N 217 LYS H2 H N N 218 LYS HA H N N 219 LYS HB2 H N N 220 LYS HB3 H N N 221 LYS HG2 H N N 222 LYS HG3 H N N 223 LYS HD2 H N N 224 LYS HD3 H N N 225 LYS HE2 H N N 226 LYS HE3 H N N 227 LYS HZ1 H N N 228 LYS HZ2 H N N 229 LYS HZ3 H N N 230 LYS HXT H N N 231 MET N N N N 232 MET CA C N S 233 MET C C N N 234 MET O O N N 235 MET CB C N N 236 MET CG C N N 237 MET SD S N N 238 MET CE C N N 239 MET OXT O N N 240 MET H H N N 241 MET H2 H N N 242 MET HA H N N 243 MET HB2 H N N 244 MET HB3 H N N 245 MET HG2 H N N 246 MET HG3 H N N 247 MET HE1 H N N 248 MET HE2 H N N 249 MET HE3 H N N 250 MET HXT H N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THJ S1 S N N 306 THJ O1 O N N 307 THJ O2 O N N 308 THJ O3 O N N 309 THJ S2 S N N 310 THR N N N N 311 THR CA C N S 312 THR C C N N 313 THR O O N N 314 THR CB C N R 315 THR OG1 O N N 316 THR CG2 C N N 317 THR OXT O N N 318 THR H H N N 319 THR H2 H N N 320 THR HA H N N 321 THR HB H N N 322 THR HG1 H N N 323 THR HG21 H N N 324 THR HG22 H N N 325 THR HG23 H N N 326 THR HXT H N N 327 TRP N N N N 328 TRP CA C N S 329 TRP C C N N 330 TRP O O N N 331 TRP CB C N N 332 TRP CG C Y N 333 TRP CD1 C Y N 334 TRP CD2 C Y N 335 TRP NE1 N Y N 336 TRP CE2 C Y N 337 TRP CE3 C Y N 338 TRP CZ2 C Y N 339 TRP CZ3 C Y N 340 TRP CH2 C Y N 341 TRP OXT O N N 342 TRP H H N N 343 TRP H2 H N N 344 TRP HA H N N 345 TRP HB2 H N N 346 TRP HB3 H N N 347 TRP HD1 H N N 348 TRP HE1 H N N 349 TRP HE3 H N N 350 TRP HZ2 H N N 351 TRP HZ3 H N N 352 TRP HH2 H N N 353 TRP HXT H N N 354 TYR N N N N 355 TYR CA C N S 356 TYR C C N N 357 TYR O O N N 358 TYR CB C N N 359 TYR CG C Y N 360 TYR CD1 C Y N 361 TYR CD2 C Y N 362 TYR CE1 C Y N 363 TYR CE2 C Y N 364 TYR CZ C Y N 365 TYR OH O N N 366 TYR OXT O N N 367 TYR H H N N 368 TYR H2 H N N 369 TYR HA H N N 370 TYR HB2 H N N 371 TYR HB3 H N N 372 TYR HD1 H N N 373 TYR HD2 H N N 374 TYR HE1 H N N 375 TYR HE2 H N N 376 TYR HH H N N 377 TYR HXT H N N 378 VAL N N N N 379 VAL CA C N S 380 VAL C C N N 381 VAL O O N N 382 VAL CB C N N 383 VAL CG1 C N N 384 VAL CG2 C N N 385 VAL OXT O N N 386 VAL H H N N 387 VAL H2 H N N 388 VAL HA H N N 389 VAL HB H N N 390 VAL HG11 H N N 391 VAL HG12 H N N 392 VAL HG13 H N N 393 VAL HG21 H N N 394 VAL HG22 H N N 395 VAL HG23 H N N 396 VAL HXT H N N 397 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THJ S1 O1 doub N N 290 THJ S1 O2 doub N N 291 THJ S1 O3 sing N N 292 THJ S1 S2 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of Diabetes and Digestive and Kidney Disease (NIH/NIDDK)' 'United States' NIH-DK-056649 1 'Department of Energy (DOE, United States)' 'United States' DE-AC02-98CH10886 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (III) ION' FE 3 'CHLORIDE ION' CL 4 THIOSULFATE THJ 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4IEU _pdbx_initial_refinement_model.details ? #