data_4XH7 # _entry.id 4XH7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4XH7 pdb_00004xh7 10.2210/pdb4xh7/pdb WWPDB D_1000205673 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4XH7 _pdbx_database_status.recvd_initial_deposition_date 2015-01-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, Z.' 1 'Zhu, H.' 2 'Liu, W.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CN _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Biochim.Biophys.Sin.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1745-7270 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 47 _citation.language ? _citation.page_first 199 _citation.page_last 206 _citation.title 'Biochemical and structural characterization of MUPP1-PDZ4 domain from Mus musculus.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/abbs/gmv002 _citation.pdbx_database_id_PubMed 25662616 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhu, H.' 1 ? primary 'Liu, Z.' 2 ? primary 'Huang, Y.' 3 ? primary 'Zhang, C.' 4 ? primary 'Li, G.' 5 ? primary 'Liu, W.' 6 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 4XH7 _cell.details ? _cell.formula_units_Z ? _cell.length_a 51.142 _cell.length_a_esd ? _cell.length_b 52.681 _cell.length_b_esd ? _cell.length_c 96.844 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4XH7 _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Multiple PDZ domain protein' 16199.199 1 ? ? 'PDZ 4 domain, UNP residues 521-665' ? 2 non-polymer syn IMIDAZOLE 69.085 1 ? ? ? ? 3 water nat water 18.015 99 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPGSAEDVQQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVN GINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIALSEMDSLDINDLELTEKPHIDLGEFIGSSETED ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGSAEDVQQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVN GINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIALSEMDSLDINDLELTEKPHIDLGEFIGSSETED ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 SER n 1 5 ALA n 1 6 GLU n 1 7 ASP n 1 8 VAL n 1 9 GLN n 1 10 GLN n 1 11 GLU n 1 12 ALA n 1 13 ALA n 1 14 LEU n 1 15 LEU n 1 16 THR n 1 17 LYS n 1 18 TRP n 1 19 GLN n 1 20 ARG n 1 21 ILE n 1 22 MET n 1 23 GLY n 1 24 ILE n 1 25 ASN n 1 26 TYR n 1 27 GLU n 1 28 ILE n 1 29 VAL n 1 30 VAL n 1 31 ALA n 1 32 HIS n 1 33 VAL n 1 34 SER n 1 35 LYS n 1 36 PHE n 1 37 SER n 1 38 GLU n 1 39 ASN n 1 40 SER n 1 41 GLY n 1 42 LEU n 1 43 GLY n 1 44 ILE n 1 45 SER n 1 46 LEU n 1 47 GLU n 1 48 ALA n 1 49 THR n 1 50 VAL n 1 51 GLY n 1 52 HIS n 1 53 HIS n 1 54 PHE n 1 55 ILE n 1 56 ARG n 1 57 SER n 1 58 VAL n 1 59 LEU n 1 60 PRO n 1 61 GLU n 1 62 GLY n 1 63 PRO n 1 64 VAL n 1 65 GLY n 1 66 HIS n 1 67 SER n 1 68 GLY n 1 69 LYS n 1 70 LEU n 1 71 PHE n 1 72 SER n 1 73 GLY n 1 74 ASP n 1 75 GLU n 1 76 LEU n 1 77 LEU n 1 78 GLU n 1 79 VAL n 1 80 ASN n 1 81 GLY n 1 82 ILE n 1 83 ASN n 1 84 LEU n 1 85 LEU n 1 86 GLY n 1 87 GLU n 1 88 ASN n 1 89 HIS n 1 90 GLN n 1 91 ASP n 1 92 VAL n 1 93 VAL n 1 94 ASN n 1 95 ILE n 1 96 LEU n 1 97 LYS n 1 98 GLU n 1 99 LEU n 1 100 PRO n 1 101 ILE n 1 102 ASP n 1 103 VAL n 1 104 THR n 1 105 MET n 1 106 VAL n 1 107 CYS n 1 108 CYS n 1 109 ARG n 1 110 ARG n 1 111 THR n 1 112 VAL n 1 113 PRO n 1 114 PRO n 1 115 ILE n 1 116 ALA n 1 117 LEU n 1 118 SER n 1 119 GLU n 1 120 MET n 1 121 ASP n 1 122 SER n 1 123 LEU n 1 124 ASP n 1 125 ILE n 1 126 ASN n 1 127 ASP n 1 128 LEU n 1 129 GLU n 1 130 LEU n 1 131 THR n 1 132 GLU n 1 133 LYS n 1 134 PRO n 1 135 HIS n 1 136 ILE n 1 137 ASP n 1 138 LEU n 1 139 GLY n 1 140 GLU n 1 141 PHE n 1 142 ILE n 1 143 GLY n 1 144 SER n 1 145 SER n 1 146 GLU n 1 147 THR n 1 148 GLU n 1 149 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 149 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Mpdz _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MPDZ_MOUSE _struct_ref.pdbx_db_accession Q8VBX6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AEDVQQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGINL LGENHQDVVNILKELPIDVTMVCCRRTVPPIALSEMDSLDINDLELTEKPHIDLGEFIGSSETED ; _struct_ref.pdbx_align_begin 521 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4XH7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 149 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8VBX6 _struct_ref_seq.db_align_beg 521 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 665 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 521 _struct_ref_seq.pdbx_auth_seq_align_end 665 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4XH7 GLY A 1 ? UNP Q8VBX6 ? ? 'expression tag' 517 1 1 4XH7 PRO A 2 ? UNP Q8VBX6 ? ? 'expression tag' 518 2 1 4XH7 GLY A 3 ? UNP Q8VBX6 ? ? 'expression tag' 519 3 1 4XH7 SER A 4 ? UNP Q8VBX6 ? ? 'expression tag' 520 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IMD non-polymer . IMIDAZOLE ? 'C3 H5 N2 1' 69.085 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4XH7 _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.01 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2%(v/v) polyethylene glycol 400, 0.1 M imidazole, 24%(w/v) polyethylene glycol monoethyl ether 5000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-12-21 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0093 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0093 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4XH7 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.65 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16041 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 48.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.Rmerge_I_obs 0.773 _reflns_shell.d_res_high 1.65 _reflns_shell.d_res_low 1.68 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_sigI_obs 3.7 _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_gt ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_gt ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_redundancy 7.8 _reflns_shell.pdbx_rejects ? _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_gt ? _reflns_shell.percent_possible_obs ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4XH7 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.65 _refine.ls_d_res_low 50 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16031 _refine.ls_number_reflns_R_free 805 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.04 _refine.ls_percent_reflns_R_free 5.02 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1742 _refine.ls_R_factor_R_free 0.2038 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1726 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3JXT _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.94 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.13 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 804 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 99 _refine_hist.number_atoms_total 908 _refine_hist.d_res_high 1.65 _refine_hist.d_res_low 50 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 ? 830 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.372 ? 1130 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.686 ? 286 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.062 ? 138 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 145 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.6480 1.7512 . . 138 2442 98.00 . . . 0.2967 . 0.2081 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7512 1.8864 . . 132 2543 100.00 . . . 0.2213 . 0.1823 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8864 2.0763 . . 135 2513 100.00 . . . 0.2184 . 0.1672 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0763 2.3767 . . 133 2544 100.00 . . . 0.2158 . 0.1674 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3767 2.9941 . . 136 2569 100.00 . . . 0.2179 . 0.1854 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9941 36.7040 . . 131 2615 97.00 . . . 0.1789 . 0.1650 . . . . . . . . . . # _struct.entry_id 4XH7 _struct.title 'Crystal structure of MUPP1 PDZ4' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4XH7 _struct_keywords.text 'MUPP1, PDZ domain, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 4 ? GLY A 23 ? SER A 520 GLY A 539 1 ? 20 HELX_P HELX_P2 AA2 GLY A 62 ? GLY A 68 ? GLY A 578 GLY A 584 1 ? 7 HELX_P HELX_P3 AA3 ASN A 88 ? GLU A 98 ? ASN A 604 GLU A 614 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 26 ? SER A 34 ? TYR A 542 SER A 550 AA1 2 ASP A 102 ? ARG A 110 ? ASP A 618 ARG A 626 AA1 3 GLU A 75 ? VAL A 79 ? GLU A 591 VAL A 595 AA1 4 ILE A 82 ? ASN A 83 ? ILE A 598 ASN A 599 AA2 1 ILE A 44 ? THR A 49 ? ILE A 560 THR A 565 AA2 2 HIS A 52 ? VAL A 58 ? HIS A 568 VAL A 574 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 33 ? N VAL A 549 O VAL A 103 ? O VAL A 619 AA1 2 3 O CYS A 108 ? O CYS A 624 N GLU A 75 ? N GLU A 591 AA1 3 4 N VAL A 79 ? N VAL A 595 O ILE A 82 ? O ILE A 598 AA2 1 2 N SER A 45 ? N SER A 561 O ARG A 56 ? O ARG A 572 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id IMD _struct_site.pdbx_auth_seq_id 701 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'binding site for residue IMD A 701' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLY A 68 ? GLY A 584 . ? 1_555 ? 2 AC1 6 GLY A 68 ? GLY A 584 . ? 2_545 ? 3 AC1 6 LEU A 70 ? LEU A 586 . ? 2_545 ? 4 AC1 6 LEU A 70 ? LEU A 586 . ? 1_555 ? 5 AC1 6 PHE A 71 ? PHE A 587 . ? 2_545 ? 6 AC1 6 PHE A 71 ? PHE A 587 . ? 1_555 ? # _atom_sites.entry_id 4XH7 _atom_sites.fract_transf_matrix[1][1] 0.019553 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018982 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010326 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 517 ? ? ? A . n A 1 2 PRO 2 518 ? ? ? A . n A 1 3 GLY 3 519 ? ? ? A . n A 1 4 SER 4 520 520 SER SER A . n A 1 5 ALA 5 521 521 ALA ALA A . n A 1 6 GLU 6 522 522 GLU GLU A . n A 1 7 ASP 7 523 523 ASP ASP A . n A 1 8 VAL 8 524 524 VAL VAL A . n A 1 9 GLN 9 525 525 GLN GLN A . n A 1 10 GLN 10 526 526 GLN GLN A . n A 1 11 GLU 11 527 527 GLU GLU A . n A 1 12 ALA 12 528 528 ALA ALA A . n A 1 13 ALA 13 529 529 ALA ALA A . n A 1 14 LEU 14 530 530 LEU LEU A . n A 1 15 LEU 15 531 531 LEU LEU A . n A 1 16 THR 16 532 532 THR THR A . n A 1 17 LYS 17 533 533 LYS LYS A . n A 1 18 TRP 18 534 534 TRP TRP A . n A 1 19 GLN 19 535 535 GLN GLN A . n A 1 20 ARG 20 536 536 ARG ARG A . n A 1 21 ILE 21 537 537 ILE ILE A . n A 1 22 MET 22 538 538 MET MET A . n A 1 23 GLY 23 539 539 GLY GLY A . n A 1 24 ILE 24 540 540 ILE ILE A . n A 1 25 ASN 25 541 541 ASN ASN A . n A 1 26 TYR 26 542 542 TYR TYR A . n A 1 27 GLU 27 543 543 GLU GLU A . n A 1 28 ILE 28 544 544 ILE ILE A . n A 1 29 VAL 29 545 545 VAL VAL A . n A 1 30 VAL 30 546 546 VAL VAL A . n A 1 31 ALA 31 547 547 ALA ALA A . n A 1 32 HIS 32 548 548 HIS HIS A . n A 1 33 VAL 33 549 549 VAL VAL A . n A 1 34 SER 34 550 550 SER SER A . n A 1 35 LYS 35 551 551 LYS LYS A . n A 1 36 PHE 36 552 552 PHE PHE A . n A 1 37 SER 37 553 553 SER SER A . n A 1 38 GLU 38 554 554 GLU GLU A . n A 1 39 ASN 39 555 555 ASN ASN A . n A 1 40 SER 40 556 556 SER SER A . n A 1 41 GLY 41 557 557 GLY GLY A . n A 1 42 LEU 42 558 558 LEU LEU A . n A 1 43 GLY 43 559 559 GLY GLY A . n A 1 44 ILE 44 560 560 ILE ILE A . n A 1 45 SER 45 561 561 SER SER A . n A 1 46 LEU 46 562 562 LEU LEU A . n A 1 47 GLU 47 563 563 GLU GLU A . n A 1 48 ALA 48 564 564 ALA ALA A . n A 1 49 THR 49 565 565 THR THR A . n A 1 50 VAL 50 566 566 VAL VAL A . n A 1 51 GLY 51 567 567 GLY GLY A . n A 1 52 HIS 52 568 568 HIS HIS A . n A 1 53 HIS 53 569 569 HIS HIS A . n A 1 54 PHE 54 570 570 PHE PHE A . n A 1 55 ILE 55 571 571 ILE ILE A . n A 1 56 ARG 56 572 572 ARG ARG A . n A 1 57 SER 57 573 573 SER SER A . n A 1 58 VAL 58 574 574 VAL VAL A . n A 1 59 LEU 59 575 575 LEU LEU A . n A 1 60 PRO 60 576 576 PRO PRO A . n A 1 61 GLU 61 577 577 GLU GLU A . n A 1 62 GLY 62 578 578 GLY GLY A . n A 1 63 PRO 63 579 579 PRO PRO A . n A 1 64 VAL 64 580 580 VAL VAL A . n A 1 65 GLY 65 581 581 GLY GLY A . n A 1 66 HIS 66 582 582 HIS HIS A . n A 1 67 SER 67 583 583 SER SER A . n A 1 68 GLY 68 584 584 GLY GLY A . n A 1 69 LYS 69 585 585 LYS LYS A . n A 1 70 LEU 70 586 586 LEU LEU A . n A 1 71 PHE 71 587 587 PHE PHE A . n A 1 72 SER 72 588 588 SER SER A . n A 1 73 GLY 73 589 589 GLY GLY A . n A 1 74 ASP 74 590 590 ASP ASP A . n A 1 75 GLU 75 591 591 GLU GLU A . n A 1 76 LEU 76 592 592 LEU LEU A . n A 1 77 LEU 77 593 593 LEU LEU A . n A 1 78 GLU 78 594 594 GLU GLU A . n A 1 79 VAL 79 595 595 VAL VAL A . n A 1 80 ASN 80 596 596 ASN ASN A . n A 1 81 GLY 81 597 597 GLY GLY A . n A 1 82 ILE 82 598 598 ILE ILE A . n A 1 83 ASN 83 599 599 ASN ASN A . n A 1 84 LEU 84 600 600 LEU LEU A . n A 1 85 LEU 85 601 601 LEU LEU A . n A 1 86 GLY 86 602 602 GLY GLY A . n A 1 87 GLU 87 603 603 GLU GLU A . n A 1 88 ASN 88 604 604 ASN ASN A . n A 1 89 HIS 89 605 605 HIS HIS A . n A 1 90 GLN 90 606 606 GLN GLN A . n A 1 91 ASP 91 607 607 ASP ASP A . n A 1 92 VAL 92 608 608 VAL VAL A . n A 1 93 VAL 93 609 609 VAL VAL A . n A 1 94 ASN 94 610 610 ASN ASN A . n A 1 95 ILE 95 611 611 ILE ILE A . n A 1 96 LEU 96 612 612 LEU LEU A . n A 1 97 LYS 97 613 613 LYS LYS A . n A 1 98 GLU 98 614 614 GLU GLU A . n A 1 99 LEU 99 615 615 LEU LEU A . n A 1 100 PRO 100 616 616 PRO PRO A . n A 1 101 ILE 101 617 617 ILE ILE A . n A 1 102 ASP 102 618 618 ASP ASP A . n A 1 103 VAL 103 619 619 VAL VAL A . n A 1 104 THR 104 620 620 THR THR A . n A 1 105 MET 105 621 621 MET MET A . n A 1 106 VAL 106 622 622 VAL VAL A . n A 1 107 CYS 107 623 623 CYS CYS A . n A 1 108 CYS 108 624 624 CYS CYS A . n A 1 109 ARG 109 625 625 ARG ARG A . n A 1 110 ARG 110 626 626 ARG ARG A . n A 1 111 THR 111 627 627 THR THR A . n A 1 112 VAL 112 628 628 VAL VAL A . n A 1 113 PRO 113 629 629 PRO PRO A . n A 1 114 PRO 114 630 ? ? ? A . n A 1 115 ILE 115 631 ? ? ? A . n A 1 116 ALA 116 632 ? ? ? A . n A 1 117 LEU 117 633 ? ? ? A . n A 1 118 SER 118 634 ? ? ? A . n A 1 119 GLU 119 635 ? ? ? A . n A 1 120 MET 120 636 ? ? ? A . n A 1 121 ASP 121 637 ? ? ? A . n A 1 122 SER 122 638 ? ? ? A . n A 1 123 LEU 123 639 ? ? ? A . n A 1 124 ASP 124 640 ? ? ? A . n A 1 125 ILE 125 641 ? ? ? A . n A 1 126 ASN 126 642 ? ? ? A . n A 1 127 ASP 127 643 ? ? ? A . n A 1 128 LEU 128 644 ? ? ? A . n A 1 129 GLU 129 645 ? ? ? A . n A 1 130 LEU 130 646 ? ? ? A . n A 1 131 THR 131 647 ? ? ? A . n A 1 132 GLU 132 648 ? ? ? A . n A 1 133 LYS 133 649 ? ? ? A . n A 1 134 PRO 134 650 ? ? ? A . n A 1 135 HIS 135 651 ? ? ? A . n A 1 136 ILE 136 652 ? ? ? A . n A 1 137 ASP 137 653 ? ? ? A . n A 1 138 LEU 138 654 ? ? ? A . n A 1 139 GLY 139 655 ? ? ? A . n A 1 140 GLU 140 656 ? ? ? A . n A 1 141 PHE 141 657 ? ? ? A . n A 1 142 ILE 142 658 ? ? ? A . n A 1 143 GLY 143 659 ? ? ? A . n A 1 144 SER 144 660 ? ? ? A . n A 1 145 SER 145 661 ? ? ? A . n A 1 146 GLU 146 662 ? ? ? A . n A 1 147 THR 147 663 ? ? ? A . n A 1 148 GLU 148 664 ? ? ? A . n A 1 149 ASP 149 665 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IMD 1 701 1 IMD IMD A . C 3 HOH 1 801 77 HOH HOH A . C 3 HOH 2 802 84 HOH HOH A . C 3 HOH 3 803 32 HOH HOH A . C 3 HOH 4 804 100 HOH HOH A . C 3 HOH 5 805 22 HOH HOH A . C 3 HOH 6 806 54 HOH HOH A . C 3 HOH 7 807 9 HOH HOH A . C 3 HOH 8 808 24 HOH HOH A . C 3 HOH 9 809 51 HOH HOH A . C 3 HOH 10 810 2 HOH HOH A . C 3 HOH 11 811 28 HOH HOH A . C 3 HOH 12 812 8 HOH HOH A . C 3 HOH 13 813 14 HOH HOH A . C 3 HOH 14 814 39 HOH HOH A . C 3 HOH 15 815 20 HOH HOH A . C 3 HOH 16 816 12 HOH HOH A . C 3 HOH 17 817 38 HOH HOH A . C 3 HOH 18 818 44 HOH HOH A . C 3 HOH 19 819 101 HOH HOH A . C 3 HOH 20 820 7 HOH HOH A . C 3 HOH 21 821 4 HOH HOH A . C 3 HOH 22 822 43 HOH HOH A . C 3 HOH 23 823 23 HOH HOH A . C 3 HOH 24 824 55 HOH HOH A . C 3 HOH 25 825 60 HOH HOH A . C 3 HOH 26 826 13 HOH HOH A . C 3 HOH 27 827 5 HOH HOH A . C 3 HOH 28 828 15 HOH HOH A . C 3 HOH 29 829 81 HOH HOH A . C 3 HOH 30 830 76 HOH HOH A . C 3 HOH 31 831 91 HOH HOH A . C 3 HOH 32 832 10 HOH HOH A . C 3 HOH 33 833 30 HOH HOH A . C 3 HOH 34 834 56 HOH HOH A . C 3 HOH 35 835 66 HOH HOH A . C 3 HOH 36 836 114 HOH HOH A . C 3 HOH 37 837 78 HOH HOH A . C 3 HOH 38 838 48 HOH HOH A . C 3 HOH 39 839 65 HOH HOH A . C 3 HOH 40 840 63 HOH HOH A . C 3 HOH 41 841 80 HOH HOH A . C 3 HOH 42 842 106 HOH HOH A . C 3 HOH 43 843 93 HOH HOH A . C 3 HOH 44 844 27 HOH HOH A . C 3 HOH 45 845 58 HOH HOH A . C 3 HOH 46 846 1 HOH HOH A . C 3 HOH 47 847 3 HOH HOH A . C 3 HOH 48 848 6 HOH HOH A . C 3 HOH 49 849 11 HOH HOH A . C 3 HOH 50 850 16 HOH HOH A . C 3 HOH 51 851 17 HOH HOH A . C 3 HOH 52 852 18 HOH HOH A . C 3 HOH 53 853 19 HOH HOH A . C 3 HOH 54 854 21 HOH HOH A . C 3 HOH 55 855 25 HOH HOH A . C 3 HOH 56 856 26 HOH HOH A . C 3 HOH 57 857 29 HOH HOH A . C 3 HOH 58 858 31 HOH HOH A . C 3 HOH 59 859 33 HOH HOH A . C 3 HOH 60 860 34 HOH HOH A . C 3 HOH 61 861 35 HOH HOH A . C 3 HOH 62 862 36 HOH HOH A . C 3 HOH 63 863 37 HOH HOH A . C 3 HOH 64 864 40 HOH HOH A . C 3 HOH 65 865 41 HOH HOH A . C 3 HOH 66 866 42 HOH HOH A . C 3 HOH 67 867 45 HOH HOH A . C 3 HOH 68 868 46 HOH HOH A . C 3 HOH 69 869 47 HOH HOH A . C 3 HOH 70 870 49 HOH HOH A . C 3 HOH 71 871 50 HOH HOH A . C 3 HOH 72 872 57 HOH HOH A . C 3 HOH 73 873 59 HOH HOH A . C 3 HOH 74 874 61 HOH HOH A . C 3 HOH 75 875 62 HOH HOH A . C 3 HOH 76 876 67 HOH HOH A . C 3 HOH 77 877 68 HOH HOH A . C 3 HOH 78 878 69 HOH HOH A . C 3 HOH 79 879 70 HOH HOH A . C 3 HOH 80 880 71 HOH HOH A . C 3 HOH 81 881 72 HOH HOH A . C 3 HOH 82 882 73 HOH HOH A . C 3 HOH 83 883 74 HOH HOH A . C 3 HOH 84 884 82 HOH HOH A . C 3 HOH 85 885 83 HOH HOH A . C 3 HOH 86 886 85 HOH HOH A . C 3 HOH 87 887 86 HOH HOH A . C 3 HOH 88 888 87 HOH HOH A . C 3 HOH 89 889 90 HOH HOH A . C 3 HOH 90 890 96 HOH HOH A . C 3 HOH 91 891 98 HOH HOH A . C 3 HOH 92 892 103 HOH HOH A . C 3 HOH 93 893 107 HOH HOH A . C 3 HOH 94 894 108 HOH HOH A . C 3 HOH 95 895 112 HOH HOH A . C 3 HOH 96 896 115 HOH HOH A . C 3 HOH 97 897 117 HOH HOH A . C 3 HOH 98 898 118 HOH HOH A . C 3 HOH 99 899 119 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6260 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id IMD _pdbx_struct_special_symmetry.auth_seq_id 701 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id IMD _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-03-04 2 'Structure model' 1 1 2015-03-18 3 'Structure model' 1 2 2023-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' 6 3 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' entity_src_gen 5 3 'Structure model' pdbx_initial_refinement_model 6 3 'Structure model' pdbx_struct_oper_list 7 3 'Structure model' pdbx_struct_special_symmetry # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 4 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.8.4_1496)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 520 ? OG ? A SER 4 OG 2 1 Y 1 A GLU 522 ? CG ? A GLU 6 CG 3 1 Y 1 A GLU 522 ? CD ? A GLU 6 CD 4 1 Y 1 A GLU 522 ? OE1 ? A GLU 6 OE1 5 1 Y 1 A GLU 522 ? OE2 ? A GLU 6 OE2 6 1 Y 1 A ASP 523 ? CG ? A ASP 7 CG 7 1 Y 1 A ASP 523 ? OD1 ? A ASP 7 OD1 8 1 Y 1 A ASP 523 ? OD2 ? A ASP 7 OD2 9 1 Y 1 A GLN 526 ? CG ? A GLN 10 CG 10 1 Y 1 A GLN 526 ? CD ? A GLN 10 CD 11 1 Y 1 A GLN 526 ? OE1 ? A GLN 10 OE1 12 1 Y 1 A GLN 526 ? NE2 ? A GLN 10 NE2 13 1 Y 1 A ARG 536 ? CD ? A ARG 20 CD 14 1 Y 1 A ARG 536 ? NE ? A ARG 20 NE 15 1 Y 1 A ARG 536 ? CZ ? A ARG 20 CZ 16 1 Y 1 A ARG 536 ? NH1 ? A ARG 20 NH1 17 1 Y 1 A ARG 536 ? NH2 ? A ARG 20 NH2 18 1 Y 1 A GLU 554 ? CG ? A GLU 38 CG 19 1 Y 1 A GLU 554 ? CD ? A GLU 38 CD 20 1 Y 1 A GLU 554 ? OE1 ? A GLU 38 OE1 21 1 Y 1 A GLU 554 ? OE2 ? A GLU 38 OE2 22 1 Y 1 A ASN 555 ? CG ? A ASN 39 CG 23 1 Y 1 A ASN 555 ? OD1 ? A ASN 39 OD1 24 1 Y 1 A ASN 555 ? ND2 ? A ASN 39 ND2 25 1 Y 1 A ARG 572 ? NE ? A ARG 56 NE 26 1 Y 1 A ARG 572 ? CZ ? A ARG 56 CZ 27 1 Y 1 A ARG 572 ? NH1 ? A ARG 56 NH1 28 1 Y 1 A ARG 572 ? NH2 ? A ARG 56 NH2 29 1 Y 1 A LYS 613 ? CD ? A LYS 97 CD 30 1 Y 1 A LYS 613 ? CE ? A LYS 97 CE 31 1 Y 1 A LYS 613 ? NZ ? A LYS 97 NZ 32 1 Y 1 A GLU 614 ? CD ? A GLU 98 CD 33 1 Y 1 A GLU 614 ? OE1 ? A GLU 98 OE1 34 1 Y 1 A GLU 614 ? OE2 ? A GLU 98 OE2 35 1 Y 1 A ARG 626 ? CD ? A ARG 110 CD 36 1 Y 1 A ARG 626 ? NE ? A ARG 110 NE 37 1 Y 1 A ARG 626 ? CZ ? A ARG 110 CZ 38 1 Y 1 A ARG 626 ? NH1 ? A ARG 110 NH1 39 1 Y 1 A ARG 626 ? NH2 ? A ARG 110 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 517 ? A GLY 1 2 1 Y 1 A PRO 518 ? A PRO 2 3 1 Y 1 A GLY 519 ? A GLY 3 4 1 Y 1 A PRO 630 ? A PRO 114 5 1 Y 1 A ILE 631 ? A ILE 115 6 1 Y 1 A ALA 632 ? A ALA 116 7 1 Y 1 A LEU 633 ? A LEU 117 8 1 Y 1 A SER 634 ? A SER 118 9 1 Y 1 A GLU 635 ? A GLU 119 10 1 Y 1 A MET 636 ? A MET 120 11 1 Y 1 A ASP 637 ? A ASP 121 12 1 Y 1 A SER 638 ? A SER 122 13 1 Y 1 A LEU 639 ? A LEU 123 14 1 Y 1 A ASP 640 ? A ASP 124 15 1 Y 1 A ILE 641 ? A ILE 125 16 1 Y 1 A ASN 642 ? A ASN 126 17 1 Y 1 A ASP 643 ? A ASP 127 18 1 Y 1 A LEU 644 ? A LEU 128 19 1 Y 1 A GLU 645 ? A GLU 129 20 1 Y 1 A LEU 646 ? A LEU 130 21 1 Y 1 A THR 647 ? A THR 131 22 1 Y 1 A GLU 648 ? A GLU 132 23 1 Y 1 A LYS 649 ? A LYS 133 24 1 Y 1 A PRO 650 ? A PRO 134 25 1 Y 1 A HIS 651 ? A HIS 135 26 1 Y 1 A ILE 652 ? A ILE 136 27 1 Y 1 A ASP 653 ? A ASP 137 28 1 Y 1 A LEU 654 ? A LEU 138 29 1 Y 1 A GLY 655 ? A GLY 139 30 1 Y 1 A GLU 656 ? A GLU 140 31 1 Y 1 A PHE 657 ? A PHE 141 32 1 Y 1 A ILE 658 ? A ILE 142 33 1 Y 1 A GLY 659 ? A GLY 143 34 1 Y 1 A SER 660 ? A SER 144 35 1 Y 1 A SER 661 ? A SER 145 36 1 Y 1 A GLU 662 ? A GLU 146 37 1 Y 1 A THR 663 ? A THR 147 38 1 Y 1 A GLU 664 ? A GLU 148 39 1 Y 1 A ASP 665 ? A ASP 149 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 IMD N1 N Y N 183 IMD C2 C Y N 184 IMD N3 N Y N 185 IMD C4 C Y N 186 IMD C5 C Y N 187 IMD HN1 H N N 188 IMD H2 H N N 189 IMD HN3 H N N 190 IMD H4 H N N 191 IMD H5 H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 PHE N N N N 260 PHE CA C N S 261 PHE C C N N 262 PHE O O N N 263 PHE CB C N N 264 PHE CG C Y N 265 PHE CD1 C Y N 266 PHE CD2 C Y N 267 PHE CE1 C Y N 268 PHE CE2 C Y N 269 PHE CZ C Y N 270 PHE OXT O N N 271 PHE H H N N 272 PHE H2 H N N 273 PHE HA H N N 274 PHE HB2 H N N 275 PHE HB3 H N N 276 PHE HD1 H N N 277 PHE HD2 H N N 278 PHE HE1 H N N 279 PHE HE2 H N N 280 PHE HZ H N N 281 PHE HXT H N N 282 PRO N N N N 283 PRO CA C N S 284 PRO C C N N 285 PRO O O N N 286 PRO CB C N N 287 PRO CG C N N 288 PRO CD C N N 289 PRO OXT O N N 290 PRO H H N N 291 PRO HA H N N 292 PRO HB2 H N N 293 PRO HB3 H N N 294 PRO HG2 H N N 295 PRO HG3 H N N 296 PRO HD2 H N N 297 PRO HD3 H N N 298 PRO HXT H N N 299 SER N N N N 300 SER CA C N S 301 SER C C N N 302 SER O O N N 303 SER CB C N N 304 SER OG O N N 305 SER OXT O N N 306 SER H H N N 307 SER H2 H N N 308 SER HA H N N 309 SER HB2 H N N 310 SER HB3 H N N 311 SER HG H N N 312 SER HXT H N N 313 THR N N N N 314 THR CA C N S 315 THR C C N N 316 THR O O N N 317 THR CB C N R 318 THR OG1 O N N 319 THR CG2 C N N 320 THR OXT O N N 321 THR H H N N 322 THR H2 H N N 323 THR HA H N N 324 THR HB H N N 325 THR HG1 H N N 326 THR HG21 H N N 327 THR HG22 H N N 328 THR HG23 H N N 329 THR HXT H N N 330 TRP N N N N 331 TRP CA C N S 332 TRP C C N N 333 TRP O O N N 334 TRP CB C N N 335 TRP CG C Y N 336 TRP CD1 C Y N 337 TRP CD2 C Y N 338 TRP NE1 N Y N 339 TRP CE2 C Y N 340 TRP CE3 C Y N 341 TRP CZ2 C Y N 342 TRP CZ3 C Y N 343 TRP CH2 C Y N 344 TRP OXT O N N 345 TRP H H N N 346 TRP H2 H N N 347 TRP HA H N N 348 TRP HB2 H N N 349 TRP HB3 H N N 350 TRP HD1 H N N 351 TRP HE1 H N N 352 TRP HE3 H N N 353 TRP HZ2 H N N 354 TRP HZ3 H N N 355 TRP HH2 H N N 356 TRP HXT H N N 357 TYR N N N N 358 TYR CA C N S 359 TYR C C N N 360 TYR O O N N 361 TYR CB C N N 362 TYR CG C Y N 363 TYR CD1 C Y N 364 TYR CD2 C Y N 365 TYR CE1 C Y N 366 TYR CE2 C Y N 367 TYR CZ C Y N 368 TYR OH O N N 369 TYR OXT O N N 370 TYR H H N N 371 TYR H2 H N N 372 TYR HA H N N 373 TYR HB2 H N N 374 TYR HB3 H N N 375 TYR HD1 H N N 376 TYR HD2 H N N 377 TYR HE1 H N N 378 TYR HE2 H N N 379 TYR HH H N N 380 TYR HXT H N N 381 VAL N N N N 382 VAL CA C N S 383 VAL C C N N 384 VAL O O N N 385 VAL CB C N N 386 VAL CG1 C N N 387 VAL CG2 C N N 388 VAL OXT O N N 389 VAL H H N N 390 VAL H2 H N N 391 VAL HA H N N 392 VAL HB H N N 393 VAL HG11 H N N 394 VAL HG12 H N N 395 VAL HG13 H N N 396 VAL HG21 H N N 397 VAL HG22 H N N 398 VAL HG23 H N N 399 VAL HXT H N N 400 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 IMD N1 C2 sing Y N 173 IMD N1 C5 sing Y N 174 IMD N1 HN1 sing N N 175 IMD C2 N3 doub Y N 176 IMD C2 H2 sing N N 177 IMD N3 C4 sing Y N 178 IMD N3 HN3 sing N N 179 IMD C4 C5 doub Y N 180 IMD C4 H4 sing N N 181 IMD C5 H5 sing N N 182 LEU N CA sing N N 183 LEU N H sing N N 184 LEU N H2 sing N N 185 LEU CA C sing N N 186 LEU CA CB sing N N 187 LEU CA HA sing N N 188 LEU C O doub N N 189 LEU C OXT sing N N 190 LEU CB CG sing N N 191 LEU CB HB2 sing N N 192 LEU CB HB3 sing N N 193 LEU CG CD1 sing N N 194 LEU CG CD2 sing N N 195 LEU CG HG sing N N 196 LEU CD1 HD11 sing N N 197 LEU CD1 HD12 sing N N 198 LEU CD1 HD13 sing N N 199 LEU CD2 HD21 sing N N 200 LEU CD2 HD22 sing N N 201 LEU CD2 HD23 sing N N 202 LEU OXT HXT sing N N 203 LYS N CA sing N N 204 LYS N H sing N N 205 LYS N H2 sing N N 206 LYS CA C sing N N 207 LYS CA CB sing N N 208 LYS CA HA sing N N 209 LYS C O doub N N 210 LYS C OXT sing N N 211 LYS CB CG sing N N 212 LYS CB HB2 sing N N 213 LYS CB HB3 sing N N 214 LYS CG CD sing N N 215 LYS CG HG2 sing N N 216 LYS CG HG3 sing N N 217 LYS CD CE sing N N 218 LYS CD HD2 sing N N 219 LYS CD HD3 sing N N 220 LYS CE NZ sing N N 221 LYS CE HE2 sing N N 222 LYS CE HE3 sing N N 223 LYS NZ HZ1 sing N N 224 LYS NZ HZ2 sing N N 225 LYS NZ HZ3 sing N N 226 LYS OXT HXT sing N N 227 MET N CA sing N N 228 MET N H sing N N 229 MET N H2 sing N N 230 MET CA C sing N N 231 MET CA CB sing N N 232 MET CA HA sing N N 233 MET C O doub N N 234 MET C OXT sing N N 235 MET CB CG sing N N 236 MET CB HB2 sing N N 237 MET CB HB3 sing N N 238 MET CG SD sing N N 239 MET CG HG2 sing N N 240 MET CG HG3 sing N N 241 MET SD CE sing N N 242 MET CE HE1 sing N N 243 MET CE HE2 sing N N 244 MET CE HE3 sing N N 245 MET OXT HXT sing N N 246 PHE N CA sing N N 247 PHE N H sing N N 248 PHE N H2 sing N N 249 PHE CA C sing N N 250 PHE CA CB sing N N 251 PHE CA HA sing N N 252 PHE C O doub N N 253 PHE C OXT sing N N 254 PHE CB CG sing N N 255 PHE CB HB2 sing N N 256 PHE CB HB3 sing N N 257 PHE CG CD1 doub Y N 258 PHE CG CD2 sing Y N 259 PHE CD1 CE1 sing Y N 260 PHE CD1 HD1 sing N N 261 PHE CD2 CE2 doub Y N 262 PHE CD2 HD2 sing N N 263 PHE CE1 CZ doub Y N 264 PHE CE1 HE1 sing N N 265 PHE CE2 CZ sing Y N 266 PHE CE2 HE2 sing N N 267 PHE CZ HZ sing N N 268 PHE OXT HXT sing N N 269 PRO N CA sing N N 270 PRO N CD sing N N 271 PRO N H sing N N 272 PRO CA C sing N N 273 PRO CA CB sing N N 274 PRO CA HA sing N N 275 PRO C O doub N N 276 PRO C OXT sing N N 277 PRO CB CG sing N N 278 PRO CB HB2 sing N N 279 PRO CB HB3 sing N N 280 PRO CG CD sing N N 281 PRO CG HG2 sing N N 282 PRO CG HG3 sing N N 283 PRO CD HD2 sing N N 284 PRO CD HD3 sing N N 285 PRO OXT HXT sing N N 286 SER N CA sing N N 287 SER N H sing N N 288 SER N H2 sing N N 289 SER CA C sing N N 290 SER CA CB sing N N 291 SER CA HA sing N N 292 SER C O doub N N 293 SER C OXT sing N N 294 SER CB OG sing N N 295 SER CB HB2 sing N N 296 SER CB HB3 sing N N 297 SER OG HG sing N N 298 SER OXT HXT sing N N 299 THR N CA sing N N 300 THR N H sing N N 301 THR N H2 sing N N 302 THR CA C sing N N 303 THR CA CB sing N N 304 THR CA HA sing N N 305 THR C O doub N N 306 THR C OXT sing N N 307 THR CB OG1 sing N N 308 THR CB CG2 sing N N 309 THR CB HB sing N N 310 THR OG1 HG1 sing N N 311 THR CG2 HG21 sing N N 312 THR CG2 HG22 sing N N 313 THR CG2 HG23 sing N N 314 THR OXT HXT sing N N 315 TRP N CA sing N N 316 TRP N H sing N N 317 TRP N H2 sing N N 318 TRP CA C sing N N 319 TRP CA CB sing N N 320 TRP CA HA sing N N 321 TRP C O doub N N 322 TRP C OXT sing N N 323 TRP CB CG sing N N 324 TRP CB HB2 sing N N 325 TRP CB HB3 sing N N 326 TRP CG CD1 doub Y N 327 TRP CG CD2 sing Y N 328 TRP CD1 NE1 sing Y N 329 TRP CD1 HD1 sing N N 330 TRP CD2 CE2 doub Y N 331 TRP CD2 CE3 sing Y N 332 TRP NE1 CE2 sing Y N 333 TRP NE1 HE1 sing N N 334 TRP CE2 CZ2 sing Y N 335 TRP CE3 CZ3 doub Y N 336 TRP CE3 HE3 sing N N 337 TRP CZ2 CH2 doub Y N 338 TRP CZ2 HZ2 sing N N 339 TRP CZ3 CH2 sing Y N 340 TRP CZ3 HZ3 sing N N 341 TRP CH2 HH2 sing N N 342 TRP OXT HXT sing N N 343 TYR N CA sing N N 344 TYR N H sing N N 345 TYR N H2 sing N N 346 TYR CA C sing N N 347 TYR CA CB sing N N 348 TYR CA HA sing N N 349 TYR C O doub N N 350 TYR C OXT sing N N 351 TYR CB CG sing N N 352 TYR CB HB2 sing N N 353 TYR CB HB3 sing N N 354 TYR CG CD1 doub Y N 355 TYR CG CD2 sing Y N 356 TYR CD1 CE1 sing Y N 357 TYR CD1 HD1 sing N N 358 TYR CD2 CE2 doub Y N 359 TYR CD2 HD2 sing N N 360 TYR CE1 CZ doub Y N 361 TYR CE1 HE1 sing N N 362 TYR CE2 CZ sing Y N 363 TYR CE2 HE2 sing N N 364 TYR CZ OH sing N N 365 TYR OH HH sing N N 366 TYR OXT HXT sing N N 367 VAL N CA sing N N 368 VAL N H sing N N 369 VAL N H2 sing N N 370 VAL CA C sing N N 371 VAL CA CB sing N N 372 VAL CA HA sing N N 373 VAL C O doub N N 374 VAL C OXT sing N N 375 VAL CB CG1 sing N N 376 VAL CB CG2 sing N N 377 VAL CB HB sing N N 378 VAL CG1 HG11 sing N N 379 VAL CG1 HG12 sing N N 380 VAL CG1 HG13 sing N N 381 VAL CG2 HG21 sing N N 382 VAL CG2 HG22 sing N N 383 VAL CG2 HG23 sing N N 384 VAL OXT HXT sing N N 385 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 IMIDAZOLE IMD 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3JXT _pdbx_initial_refinement_model.details ? #