data_4Y7T # _entry.id 4Y7T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4Y7T WWPDB D_1000204395 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4Y7T _pdbx_database_status.recvd_initial_deposition_date 2015-02-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Renner-Schneck, M.G.' 1 'Stehle, T.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 290 _citation.language ? _citation.page_first 10804 _citation.page_last 10813 _citation.title ;Crystal Structure of the N-Acetylmuramic Acid alpha-1-Phosphate (MurNAc-alpha 1-P) Uridylyltransferase MurU, a Minimal Sugar Nucleotidyltransferase and Potential Drug Target Enzyme in Gram-negative Pathogens. ; _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.M114.620989 _citation.pdbx_database_id_PubMed 25767118 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Renner-Schneck, M.' 1 primary 'Hinderberger, I.' 2 primary 'Gisin, J.' 3 primary 'Exner, T.' 4 primary 'Mayer, C.' 5 primary 'Stehle, T.' 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 4Y7T _cell.details ? _cell.formula_units_Z ? _cell.length_a 72.610 _cell.length_a_esd ? _cell.length_b 72.610 _cell.length_b_esd ? _cell.length_c 158.470 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4Y7T _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nucleotidyl transferase' 24913.369 1 ? ? ? ? 2 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 4 ? ? ? ? 4 water nat water 18.015 80 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name MurU # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKAMILAAGKGERMRPLTLHTPKPLVPVAGQPLIEYHLRALAAAGVTEVVINHAWLGQQIEDHLGDGSRFGLSIRYSPEG EPLETGGGIFKALPLLGDAPFLLVNGDVWTDYDFARLQAPLQGLAHLVLVDNPGHHGRGDFRLVGEQVVDGDDAPGTLTF SGISVLHPALFEGCQAGAFKLAPLLRQAMAAGKVSGEHYRGHWVDVGTLERLAEAESLIGERALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MKAMILAAGKGERMRPLTLHTPKPLVPVAGQPLIEYHLRALAAAGVTEVVINHAWLGQQIEDHLGDGSRFGLSIRYSPEG EPLETGGGIFKALPLLGDAPFLLVNGDVWTDYDFARLQAPLQGLAHLVLVDNPGHHGRGDFRLVGEQVVDGDDAPGTLTF SGISVLHPALFEGCQAGAFKLAPLLRQAMAAGKVSGEHYRGHWVDVGTLERLAEAESLIGERALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 ALA n 1 4 MET n 1 5 ILE n 1 6 LEU n 1 7 ALA n 1 8 ALA n 1 9 GLY n 1 10 LYS n 1 11 GLY n 1 12 GLU n 1 13 ARG n 1 14 MET n 1 15 ARG n 1 16 PRO n 1 17 LEU n 1 18 THR n 1 19 LEU n 1 20 HIS n 1 21 THR n 1 22 PRO n 1 23 LYS n 1 24 PRO n 1 25 LEU n 1 26 VAL n 1 27 PRO n 1 28 VAL n 1 29 ALA n 1 30 GLY n 1 31 GLN n 1 32 PRO n 1 33 LEU n 1 34 ILE n 1 35 GLU n 1 36 TYR n 1 37 HIS n 1 38 LEU n 1 39 ARG n 1 40 ALA n 1 41 LEU n 1 42 ALA n 1 43 ALA n 1 44 ALA n 1 45 GLY n 1 46 VAL n 1 47 THR n 1 48 GLU n 1 49 VAL n 1 50 VAL n 1 51 ILE n 1 52 ASN n 1 53 HIS n 1 54 ALA n 1 55 TRP n 1 56 LEU n 1 57 GLY n 1 58 GLN n 1 59 GLN n 1 60 ILE n 1 61 GLU n 1 62 ASP n 1 63 HIS n 1 64 LEU n 1 65 GLY n 1 66 ASP n 1 67 GLY n 1 68 SER n 1 69 ARG n 1 70 PHE n 1 71 GLY n 1 72 LEU n 1 73 SER n 1 74 ILE n 1 75 ARG n 1 76 TYR n 1 77 SER n 1 78 PRO n 1 79 GLU n 1 80 GLY n 1 81 GLU n 1 82 PRO n 1 83 LEU n 1 84 GLU n 1 85 THR n 1 86 GLY n 1 87 GLY n 1 88 GLY n 1 89 ILE n 1 90 PHE n 1 91 LYS n 1 92 ALA n 1 93 LEU n 1 94 PRO n 1 95 LEU n 1 96 LEU n 1 97 GLY n 1 98 ASP n 1 99 ALA n 1 100 PRO n 1 101 PHE n 1 102 LEU n 1 103 LEU n 1 104 VAL n 1 105 ASN n 1 106 GLY n 1 107 ASP n 1 108 VAL n 1 109 TRP n 1 110 THR n 1 111 ASP n 1 112 TYR n 1 113 ASP n 1 114 PHE n 1 115 ALA n 1 116 ARG n 1 117 LEU n 1 118 GLN n 1 119 ALA n 1 120 PRO n 1 121 LEU n 1 122 GLN n 1 123 GLY n 1 124 LEU n 1 125 ALA n 1 126 HIS n 1 127 LEU n 1 128 VAL n 1 129 LEU n 1 130 VAL n 1 131 ASP n 1 132 ASN n 1 133 PRO n 1 134 GLY n 1 135 HIS n 1 136 HIS n 1 137 GLY n 1 138 ARG n 1 139 GLY n 1 140 ASP n 1 141 PHE n 1 142 ARG n 1 143 LEU n 1 144 VAL n 1 145 GLY n 1 146 GLU n 1 147 GLN n 1 148 VAL n 1 149 VAL n 1 150 ASP n 1 151 GLY n 1 152 ASP n 1 153 ASP n 1 154 ALA n 1 155 PRO n 1 156 GLY n 1 157 THR n 1 158 LEU n 1 159 THR n 1 160 PHE n 1 161 SER n 1 162 GLY n 1 163 ILE n 1 164 SER n 1 165 VAL n 1 166 LEU n 1 167 HIS n 1 168 PRO n 1 169 ALA n 1 170 LEU n 1 171 PHE n 1 172 GLU n 1 173 GLY n 1 174 CYS n 1 175 GLN n 1 176 ALA n 1 177 GLY n 1 178 ALA n 1 179 PHE n 1 180 LYS n 1 181 LEU n 1 182 ALA n 1 183 PRO n 1 184 LEU n 1 185 LEU n 1 186 ARG n 1 187 GLN n 1 188 ALA n 1 189 MET n 1 190 ALA n 1 191 ALA n 1 192 GLY n 1 193 LYS n 1 194 VAL n 1 195 SER n 1 196 GLY n 1 197 GLU n 1 198 HIS n 1 199 TYR n 1 200 ARG n 1 201 GLY n 1 202 HIS n 1 203 TRP n 1 204 VAL n 1 205 ASP n 1 206 VAL n 1 207 GLY n 1 208 THR n 1 209 LEU n 1 210 GLU n 1 211 ARG n 1 212 LEU n 1 213 ALA n 1 214 GLU n 1 215 ALA n 1 216 GLU n 1 217 SER n 1 218 LEU n 1 219 ILE n 1 220 GLY n 1 221 GLU n 1 222 ARG n 1 223 ALA n 1 224 LEU n 1 225 GLU n 1 226 HIS n 1 227 HIS n 1 228 HIS n 1 229 HIS n 1 230 HIS n 1 231 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 231 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PPUBIRD1_0444 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain BIRD-1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas putida' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 931281 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET29b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code E4RE40_PSEPB _struct_ref.pdbx_db_accession E4RE40 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKAMILAAGKGERMRPLTLHTPKPLVPVAGQPLIEYHLRALAAAGVTEVVINHAWLGQQIEDHLGDGSRFGLSIRYSPEG EPLETGGGIFKALPLLGDAPFLLVNGDVWTDYDFARLQAPLQGLAHLVLVDNPGHHGRGDFRLVGEQVVDGDDAPGTLTF SGISVLHPALFEGCQAGAFKLAPLLRQAMAAGKVSGEHYRGHWVDVGTLERLAEAESLIGERA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4Y7T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 223 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession E4RE40 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 223 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 223 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4Y7T LEU A 224 ? UNP E4RE40 ? ? 'expression tag' 224 1 1 4Y7T GLU A 225 ? UNP E4RE40 ? ? 'expression tag' 225 2 1 4Y7T HIS A 226 ? UNP E4RE40 ? ? 'expression tag' 226 3 1 4Y7T HIS A 227 ? UNP E4RE40 ? ? 'expression tag' 227 4 1 4Y7T HIS A 228 ? UNP E4RE40 ? ? 'expression tag' 228 5 1 4Y7T HIS A 229 ? UNP E4RE40 ? ? 'expression tag' 229 6 1 4Y7T HIS A 230 ? UNP E4RE40 ? ? 'expression tag' 230 7 1 4Y7T HIS A 231 ? UNP E4RE40 ? ? 'expression tag' 231 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4Y7T _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.42 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.18 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '(NH4)2SO4, MES' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 93.2 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-07-10 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4Y7T _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.80 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23700 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.31 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 116.650 _refine.B_iso_mean 47.2600 _refine.B_iso_min 24.730 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4Y7T _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.8000 _refine.ls_d_res_low 40.4460 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23688 _refine.ls_number_reflns_R_free 1185 _refine.ls_number_reflns_R_work 22503 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8700 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2132 _refine.ls_R_factor_R_free 0.2455 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2114 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.040 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.0900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.7264 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.8000 _refine_hist.d_res_low 40.4460 _refine_hist.pdbx_number_atoms_ligand 62 _refine_hist.number_atoms_solvent 80 _refine_hist.number_atoms_total 1755 _refine_hist.pdbx_number_residues_total 218 _refine_hist.pdbx_B_iso_mean_ligand 64.66 _refine_hist.pdbx_B_iso_mean_solvent 49.96 _refine_hist.pdbx_number_atoms_protein 1613 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.015 ? 1764 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.526 ? 2405 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.066 ? 268 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 307 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.150 ? 652 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8000 1.8820 2860 . 143 2717 99.0000 . . . 0.3649 . 0.3190 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 1.8820 1.9812 2901 . 145 2756 100.0000 . . . 0.3535 . 0.2969 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 1.9812 2.1053 2894 . 145 2749 100.0000 . . . 0.3809 . 0.3184 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.1053 2.2678 2919 . 146 2773 100.0000 . . . 0.3070 . 0.2510 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.2678 2.4960 2930 . 146 2784 100.0000 . . . 0.2535 . 0.2324 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.4960 2.8571 2961 . 148 2813 100.0000 . . . 0.2838 . 0.2494 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.8571 3.5993 3005 . 151 2854 100.0000 . . . 0.2644 . 0.2165 . . . . . . 8 . . . 'X-RAY DIFFRACTION' 3.5993 40.4565 3218 . 161 3057 100.0000 . . . 0.1916 . 0.1684 . . . . . . 8 . . . # _struct.entry_id 4Y7T _struct.title 'Structural analysis of MurU' _struct.pdbx_descriptor MurU _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4Y7T _struct_keywords.text 'Nucleotidyltransferase family protein, uridyltransferase, Rossman fold, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 4 ? # _struct_biol.details 'biological unit is the same as asym.' _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.pdbx_formula_weight ? _struct_biol.pdbx_formula_weight_method ? _struct_biol.pdbx_aggregation_state ? _struct_biol.pdbx_assembly_method ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 11 ? ARG A 15 ? GLY A 11 ARG A 15 5 ? 5 HELX_P HELX_P2 AA2 PRO A 22 ? LEU A 25 ? PRO A 22 LEU A 25 5 ? 4 HELX_P HELX_P3 AA3 LEU A 33 ? ALA A 44 ? LEU A 33 ALA A 44 1 ? 12 HELX_P HELX_P4 AA4 LEU A 56 ? GLY A 65 ? LEU A 56 GLY A 65 1 ? 10 HELX_P HELX_P5 AA5 GLY A 67 ? GLY A 71 ? GLY A 67 GLY A 71 5 ? 5 HELX_P HELX_P6 AA6 LEU A 83 ? GLY A 97 ? LEU A 83 GLY A 97 1 ? 15 HELX_P HELX_P7 AA7 ASP A 113 ? ALA A 119 ? ASP A 113 ALA A 119 5 ? 7 HELX_P HELX_P8 AA8 PRO A 168 ? GLU A 172 ? PRO A 168 GLU A 172 5 ? 5 HELX_P HELX_P9 AA9 LEU A 181 ? ALA A 191 ? LEU A 181 ALA A 191 1 ? 11 HELX_P HELX_P10 AB1 THR A 208 ? ALA A 223 ? THR A 208 ALA A 223 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ARG 15 A . ? ARG 15 A PRO 16 A ? PRO 16 A 1 7.04 2 PRO 155 A . ? PRO 155 A GLY 156 A ? GLY 156 A 1 2.67 3 GLU 172 A . ? GLU 172 A GLY 173 A ? GLY 173 A 1 -3.46 4 GLY 173 A . ? GLY 173 A CYS 174 A ? CYS 174 A 1 -1.68 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 2 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 73 ? PRO A 78 ? SER A 73 PRO A 78 AA1 2 GLU A 48 ? HIS A 53 ? GLU A 48 HIS A 53 AA1 3 ALA A 3 ? ALA A 7 ? ALA A 3 ALA A 7 AA1 4 PHE A 101 ? ASN A 105 ? PHE A 101 ASN A 105 AA1 5 THR A 159 ? LEU A 166 ? THR A 159 LEU A 166 AA1 6 ALA A 125 ? VAL A 130 ? ALA A 125 VAL A 130 AA1 7 VAL A 194 ? HIS A 198 ? VAL A 194 HIS A 198 AA2 1 PRO A 27 ? VAL A 28 ? PRO A 27 VAL A 28 AA2 2 GLN A 31 ? PRO A 32 ? GLN A 31 PRO A 32 AA3 1 VAL A 108 ? THR A 110 ? VAL A 108 THR A 110 AA3 2 TRP A 203 ? ASP A 205 ? TRP A 203 ASP A 205 AA4 1 PHE A 141 ? VAL A 144 ? PHE A 141 VAL A 144 AA4 2 GLN A 147 ? ASP A 150 ? GLN A 147 ASP A 150 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O SER A 77 ? O SER A 77 N ILE A 51 ? N ILE A 51 AA1 2 3 O VAL A 50 ? O VAL A 50 N ILE A 5 ? N ILE A 5 AA1 3 4 N MET A 4 ? N MET A 4 O LEU A 102 ? O LEU A 102 AA1 4 5 N LEU A 103 ? N LEU A 103 O SER A 164 ? O SER A 164 AA1 5 6 O THR A 159 ? O THR A 159 N VAL A 130 ? N VAL A 130 AA1 6 7 N LEU A 129 ? N LEU A 129 O GLU A 197 ? O GLU A 197 AA2 1 2 N VAL A 28 ? N VAL A 28 O GLN A 31 ? O GLN A 31 AA3 1 2 N TRP A 109 ? N TRP A 109 O VAL A 204 ? O VAL A 204 AA4 1 2 N VAL A 144 ? N VAL A 144 O GLN A 147 ? O GLN A 147 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GOL 301 ? 6 'binding site for residue GOL A 301' AC2 Software A GOL 302 ? 6 'binding site for residue GOL A 302' AC3 Software A SO4 303 ? 5 'binding site for residue SO4 A 303' AC4 Software A SO4 304 ? 3 'binding site for residue SO4 A 304' AC5 Software A SO4 305 ? 5 'binding site for residue SO4 A 305' AC6 Software A SO4 306 ? 6 'binding site for residue SO4 A 306' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 LEU A 117 ? LEU A 117 . ? 1_555 ? 2 AC1 6 ALA A 119 ? ALA A 119 . ? 1_555 ? 3 AC1 6 PRO A 120 ? PRO A 120 . ? 1_555 ? 4 AC1 6 LEU A 121 ? LEU A 121 . ? 1_555 ? 5 AC1 6 GLN A 122 ? GLN A 122 . ? 12_555 ? 6 AC1 6 GLY A 123 ? GLY A 123 . ? 12_555 ? 7 AC2 6 GLN A 175 ? GLN A 175 . ? 7_555 ? 8 AC2 6 ALA A 178 ? ALA A 178 . ? 7_555 ? 9 AC2 6 PHE A 179 ? PHE A 179 . ? 7_555 ? 10 AC2 6 GLN A 187 ? GLN A 187 . ? 1_555 ? 11 AC2 6 ALA A 191 ? ALA A 191 . ? 1_555 ? 12 AC2 6 HOH H . ? HOH A 403 . ? 7_555 ? 13 AC3 5 THR A 85 ? THR A 85 . ? 1_555 ? 14 AC3 5 LYS A 180 ? LYS A 180 . ? 1_555 ? 15 AC3 5 LEU A 181 ? LEU A 181 . ? 1_555 ? 16 AC3 5 ALA A 182 ? ALA A 182 . ? 1_555 ? 17 AC3 5 HOH H . ? HOH A 457 . ? 1_555 ? 18 AC4 3 ARG A 211 ? ARG A 211 . ? 1_555 ? 19 AC4 3 GLU A 214 ? GLU A 214 . ? 1_555 ? 20 AC4 3 HOH H . ? HOH A 465 . ? 1_555 ? 21 AC5 5 GLY A 11 ? GLY A 11 . ? 1_555 ? 22 AC5 5 GLU A 12 ? GLU A 12 . ? 1_555 ? 23 AC5 5 ARG A 13 ? ARG A 13 . ? 1_555 ? 24 AC5 5 HOH H . ? HOH A 458 . ? 1_555 ? 25 AC5 5 HOH H . ? HOH A 464 . ? 1_555 ? 26 AC6 6 LEU A 64 ? LEU A 64 . ? 1_555 ? 27 AC6 6 ASP A 66 ? ASP A 66 . ? 1_555 ? 28 AC6 6 GLY A 67 ? GLY A 67 . ? 1_555 ? 29 AC6 6 SER A 68 ? SER A 68 . ? 1_555 ? 30 AC6 6 ARG A 69 ? ARG A 69 . ? 1_555 ? 31 AC6 6 ARG A 200 ? ARG A 200 . ? 8_565 ? # _atom_sites.entry_id 4Y7T _atom_sites.fract_transf_matrix[1][1] 0.013772 _atom_sites.fract_transf_matrix[1][2] 0.007951 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015903 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006310 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 TRP 55 55 55 TRP TRP A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 GLY 134 134 ? ? ? A . n A 1 135 HIS 135 135 ? ? ? A . n A 1 136 HIS 136 136 ? ? ? A . n A 1 137 GLY 137 137 ? ? ? A . n A 1 138 ARG 138 138 ? ? ? A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 ALA 154 154 ? ? ? A . n A 1 155 PRO 155 155 155 PRO PRO A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 THR 159 159 159 THR THR A . n A 1 160 PHE 160 160 160 PHE PHE A . n A 1 161 SER 161 161 161 SER SER A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 HIS 167 167 167 HIS HIS A . n A 1 168 PRO 168 168 168 PRO PRO A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 PHE 171 171 171 PHE PHE A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 CYS 174 174 174 CYS CYS A . n A 1 175 GLN 175 175 175 GLN GLN A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 PHE 179 179 179 PHE PHE A . n A 1 180 LYS 180 180 180 LYS LYS A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 PRO 183 183 183 PRO PRO A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 ARG 186 186 186 ARG ARG A . n A 1 187 GLN 187 187 187 GLN GLN A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 MET 189 189 189 MET MET A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 LYS 193 193 193 LYS LYS A . n A 1 194 VAL 194 194 194 VAL VAL A . n A 1 195 SER 195 195 195 SER SER A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 GLU 197 197 197 GLU GLU A . n A 1 198 HIS 198 198 198 HIS HIS A . n A 1 199 TYR 199 199 199 TYR TYR A . n A 1 200 ARG 200 200 200 ARG ARG A . n A 1 201 GLY 201 201 201 GLY GLY A . n A 1 202 HIS 202 202 202 HIS HIS A . n A 1 203 TRP 203 203 203 TRP TRP A . n A 1 204 VAL 204 204 204 VAL VAL A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 GLY 207 207 207 GLY GLY A . n A 1 208 THR 208 208 208 THR THR A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 GLU 210 210 210 GLU GLU A . n A 1 211 ARG 211 211 211 ARG ARG A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 ALA 213 213 213 ALA ALA A . n A 1 214 GLU 214 214 214 GLU GLU A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 GLU 216 216 216 GLU GLU A . n A 1 217 SER 217 217 217 SER SER A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 ARG 222 222 222 ARG ARG A . n A 1 223 ALA 223 223 223 ALA ALA A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 GLU 225 225 ? ? ? A . n A 1 226 HIS 226 226 ? ? ? A . n A 1 227 HIS 227 227 ? ? ? A . n A 1 228 HIS 228 228 ? ? ? A . n A 1 229 HIS 229 229 ? ? ? A . n A 1 230 HIS 230 230 ? ? ? A . n A 1 231 HIS 231 231 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 301 1 GOL GOL A . C 2 GOL 1 302 2 GOL GOL A . D 3 SO4 1 303 1 SO4 SO4 A . E 3 SO4 1 304 2 SO4 SO4 A . F 3 SO4 1 305 3 SO4 SO4 A . G 3 SO4 1 306 4 SO4 SO4 A . H 4 HOH 1 401 10 HOH HOH A . H 4 HOH 2 402 80 HOH HOH A . H 4 HOH 3 403 69 HOH HOH A . H 4 HOH 4 404 70 HOH HOH A . H 4 HOH 5 405 26 HOH HOH A . H 4 HOH 6 406 23 HOH HOH A . H 4 HOH 7 407 55 HOH HOH A . H 4 HOH 8 408 22 HOH HOH A . H 4 HOH 9 409 59 HOH HOH A . H 4 HOH 10 410 81 HOH HOH A . H 4 HOH 11 411 38 HOH HOH A . H 4 HOH 12 412 71 HOH HOH A . H 4 HOH 13 413 67 HOH HOH A . H 4 HOH 14 414 25 HOH HOH A . H 4 HOH 15 415 28 HOH HOH A . H 4 HOH 16 416 49 HOH HOH A . H 4 HOH 17 417 29 HOH HOH A . H 4 HOH 18 418 36 HOH HOH A . H 4 HOH 19 419 6 HOH HOH A . H 4 HOH 20 420 48 HOH HOH A . H 4 HOH 21 421 34 HOH HOH A . H 4 HOH 22 422 45 HOH HOH A . H 4 HOH 23 423 79 HOH HOH A . H 4 HOH 24 424 32 HOH HOH A . H 4 HOH 25 425 21 HOH HOH A . H 4 HOH 26 426 58 HOH HOH A . H 4 HOH 27 427 18 HOH HOH A . H 4 HOH 28 428 8 HOH HOH A . H 4 HOH 29 429 65 HOH HOH A . H 4 HOH 30 430 75 HOH HOH A . H 4 HOH 31 431 54 HOH HOH A . H 4 HOH 32 432 2 HOH HOH A . H 4 HOH 33 433 3 HOH HOH A . H 4 HOH 34 434 4 HOH HOH A . H 4 HOH 35 435 5 HOH HOH A . H 4 HOH 36 436 7 HOH HOH A . H 4 HOH 37 437 9 HOH HOH A . H 4 HOH 38 438 11 HOH HOH A . H 4 HOH 39 439 12 HOH HOH A . H 4 HOH 40 440 13 HOH HOH A . H 4 HOH 41 441 14 HOH HOH A . H 4 HOH 42 442 15 HOH HOH A . H 4 HOH 43 443 16 HOH HOH A . H 4 HOH 44 444 17 HOH HOH A . H 4 HOH 45 445 19 HOH HOH A . H 4 HOH 46 446 20 HOH HOH A . H 4 HOH 47 447 24 HOH HOH A . H 4 HOH 48 448 27 HOH HOH A . H 4 HOH 49 449 30 HOH HOH A . H 4 HOH 50 450 31 HOH HOH A . H 4 HOH 51 451 33 HOH HOH A . H 4 HOH 52 452 35 HOH HOH A . H 4 HOH 53 453 37 HOH HOH A . H 4 HOH 54 454 39 HOH HOH A . H 4 HOH 55 455 40 HOH HOH A . H 4 HOH 56 456 41 HOH HOH A . H 4 HOH 57 457 42 HOH HOH A . H 4 HOH 58 458 43 HOH HOH A . H 4 HOH 59 459 44 HOH HOH A . H 4 HOH 60 460 46 HOH HOH A . H 4 HOH 61 461 47 HOH HOH A . H 4 HOH 62 462 50 HOH HOH A . H 4 HOH 63 463 51 HOH HOH A . H 4 HOH 64 464 52 HOH HOH A . H 4 HOH 65 465 53 HOH HOH A . H 4 HOH 66 466 56 HOH HOH A . H 4 HOH 67 467 57 HOH HOH A . H 4 HOH 68 468 60 HOH HOH A . H 4 HOH 69 469 61 HOH HOH A . H 4 HOH 70 470 62 HOH HOH A . H 4 HOH 71 471 63 HOH HOH A . H 4 HOH 72 472 64 HOH HOH A . H 4 HOH 73 473 66 HOH HOH A . H 4 HOH 74 474 68 HOH HOH A . H 4 HOH 75 475 72 HOH HOH A . H 4 HOH 76 476 73 HOH HOH A . H 4 HOH 77 477 74 HOH HOH A . H 4 HOH 78 478 76 HOH HOH A . H 4 HOH 79 479 77 HOH HOH A . H 4 HOH 80 480 78 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1130 ? 1 MORE -52 ? 1 'SSA (A^2)' 10310 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-03-18 2 'Structure model' 1 1 2015-03-25 3 'Structure model' 1 2 2015-05-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 9.3485 31.0780 -0.4944 0.2430 ? 0.0250 ? -0.0326 ? 0.3851 ? 0.0267 ? 0.3149 ? 3.0413 ? -0.9994 ? 0.2965 ? 2.8321 ? -0.4716 ? 2.3903 ? 0.0904 ? 0.0342 ? -0.1942 ? -0.0477 ? -0.0047 ? 0.3363 ? -0.0019 ? -0.2403 ? -0.0917 ? 2 'X-RAY DIFFRACTION' ? refined 19.3956 27.5047 9.1526 0.2513 ? 0.0206 ? -0.0212 ? 0.3200 ? 0.0189 ? 0.3301 ? 4.2677 ? 2.1149 ? 0.7615 ? 2.8501 ? -0.0728 ? 3.3876 ? 0.1494 ? -0.0067 ? -0.0314 ? -0.0812 ? -0.1141 ? -0.0479 ? 0.2111 ? -0.1917 ? -0.0531 ? 3 'X-RAY DIFFRACTION' ? refined 26.7541 31.8259 17.1293 0.3225 ? -0.0175 ? -0.0206 ? 0.3982 ? 0.0055 ? 0.2469 ? 6.0215 ? 1.4388 ? 0.1495 ? 4.9133 ? -1.2787 ? 3.2223 ? 0.2668 ? -0.6461 ? 0.2467 ? 0.5948 ? -0.2518 ? -0.1869 ? -0.2602 ? 0.1066 ? -0.0441 ? 4 'X-RAY DIFFRACTION' ? refined 16.1434 27.0516 22.6646 0.3979 ? -0.1044 ? -0.0218 ? 0.7030 ? 0.0389 ? 0.3876 ? 3.2800 ? -3.1328 ? 3.5003 ? 4.7379 ? -0.9831 ? 6.9830 ? 0.3683 ? -1.1501 ? -0.1581 ? 0.3627 ? -0.2138 ? 0.6068 ? 0.1949 ? -1.1983 ? -0.0335 ? 5 'X-RAY DIFFRACTION' ? refined 24.3127 40.4535 2.9413 0.3706 ? -0.0335 ? -0.0066 ? 0.3861 ? 0.0899 ? 0.3323 ? 4.0964 ? -0.6166 ? 1.3340 ? 2.6373 ? 0.6123 ? 2.5693 ? -0.0285 ? 0.4330 ? 0.6273 ? -0.1841 ? -0.2399 ? -0.2423 ? -0.6994 ? 0.3518 ? 0.2332 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 1 ? ? A 79 ? '(chain A and resid 1:79)' 2 'X-RAY DIFFRACTION' 2 ? ? A 80 ? ? A 133 ? '(chain A and resid 80:133)' 3 'X-RAY DIFFRACTION' 3 ? ? A 139 ? ? A 171 ? '(chain A and resid 139:171)' 4 'X-RAY DIFFRACTION' 4 ? ? A 172 ? ? A 191 ? '(chain A and resid 172:191)' 5 'X-RAY DIFFRACTION' 5 ? ? A 192 ? ? A 224 ? '(chain A and resid 192:224)' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 3 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 402 ? ? 1_555 O A HOH 402 ? ? 7_555 2.05 2 1 O A HOH 402 ? ? 1_555 O A HOH 423 ? ? 7_555 2.13 3 1 O A HOH 424 ? ? 1_555 O A HOH 424 ? ? 12_555 2.16 4 1 O A HOH 423 ? ? 1_555 O A HOH 423 ? ? 7_555 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 7 ? ? -149.81 30.66 2 1 ALA A 54 ? ? -155.76 -80.18 3 1 GLU A 84 ? ? 63.28 168.09 4 1 PRO A 120 ? ? -49.49 105.12 5 1 PHE A 171 ? ? -103.34 56.19 6 1 CYS A 174 ? ? -154.60 -7.28 7 1 GLN A 175 ? ? 114.08 76.71 8 1 ALA A 178 ? ? 68.56 95.76 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 12 ? CD ? A GLU 12 CD 2 1 Y 1 A GLU 12 ? OE1 ? A GLU 12 OE1 3 1 Y 1 A GLU 12 ? OE2 ? A GLU 12 OE2 4 1 Y 1 A ASP 98 ? OD2 ? A ASP 98 OD2 5 1 Y 1 A GLN 118 ? OE1 ? A GLN 118 OE1 6 1 Y 1 A GLN 122 ? CG ? A GLN 122 CG 7 1 Y 1 A GLN 122 ? CD ? A GLN 122 CD 8 1 Y 1 A GLN 122 ? OE1 ? A GLN 122 OE1 9 1 Y 1 A GLN 122 ? NE2 ? A GLN 122 NE2 10 1 Y 1 A ASP 150 ? OD2 ? A ASP 150 OD2 11 1 Y 1 A ASP 152 ? CG ? A ASP 152 CG 12 1 Y 1 A ASP 152 ? OD1 ? A ASP 152 OD1 13 1 Y 1 A ASP 152 ? OD2 ? A ASP 152 OD2 14 1 Y 1 A ASP 153 ? CG ? A ASP 153 CG 15 1 Y 1 A ASP 153 ? OD1 ? A ASP 153 OD1 16 1 Y 1 A ASP 153 ? OD2 ? A ASP 153 OD2 17 1 Y 1 A GLU 172 ? CG ? A GLU 172 CG 18 1 Y 1 A GLU 172 ? CD ? A GLU 172 CD 19 1 Y 1 A GLU 172 ? OE1 ? A GLU 172 OE1 20 1 Y 1 A GLU 172 ? OE2 ? A GLU 172 OE2 21 1 Y 1 A GLU 221 ? CD ? A GLU 221 CD 22 1 Y 1 A GLU 221 ? OE1 ? A GLU 221 OE1 23 1 Y 1 A GLU 221 ? OE2 ? A GLU 221 OE2 24 1 Y 1 A ARG 222 ? CG ? A ARG 222 CG 25 1 Y 1 A ARG 222 ? CD ? A ARG 222 CD 26 1 Y 1 A ARG 222 ? NE ? A ARG 222 NE 27 1 Y 1 A ARG 222 ? CZ ? A ARG 222 CZ 28 1 Y 1 A ARG 222 ? NH1 ? A ARG 222 NH1 29 1 Y 1 A ARG 222 ? NH2 ? A ARG 222 NH2 30 1 Y 1 A LEU 224 ? CG ? A LEU 224 CG 31 1 Y 1 A LEU 224 ? CD1 ? A LEU 224 CD1 32 1 Y 1 A LEU 224 ? CD2 ? A LEU 224 CD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 134 ? A GLY 134 2 1 Y 1 A HIS 135 ? A HIS 135 3 1 Y 1 A HIS 136 ? A HIS 136 4 1 Y 1 A GLY 137 ? A GLY 137 5 1 Y 1 A ARG 138 ? A ARG 138 6 1 Y 1 A ALA 154 ? A ALA 154 7 1 Y 1 A GLU 225 ? A GLU 225 8 1 Y 1 A HIS 226 ? A HIS 226 9 1 Y 1 A HIS 227 ? A HIS 227 10 1 Y 1 A HIS 228 ? A HIS 228 11 1 Y 1 A HIS 229 ? A HIS 229 12 1 Y 1 A HIS 230 ? A HIS 230 13 1 Y 1 A HIS 231 ? A HIS 231 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 'SULFATE ION' SO4 4 water HOH #