data_4YEQ # _entry.id 4YEQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4YEQ pdb_00004yeq 10.2210/pdb4yeq/pdb WWPDB D_1000207326 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-05-27 2 'Structure model' 1 1 2015-07-22 3 'Structure model' 1 2 2024-01-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4YEQ _pdbx_database_status.recvd_initial_deposition_date 2015-02-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details '4YEP corresponds to the same L4b domain lacking some terminal amino acids present in this entry.' _pdbx_database_related.db_id 4YEP _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Toot, M.' 1 'Gat, Y.' 2 'Fass, D.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Febs J.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1742-464X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 282 _citation.language ? _citation.page_first 2746 _citation.page_last 2757 _citation.title 'Laminin L4 domain structure resembles adhesion modules in ephrin receptor and other transmembrane glycoproteins.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/febs.13319 _citation.pdbx_database_id_PubMed 25962468 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Moran, T.' 1 ? primary 'Gat, Y.' 2 ? primary 'Fass, D.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Laminin subunit alpha-2' 23654.203 1 ? ? 'L4b Domain, UNP residues 1177-1379' ? 2 water nat water 18.015 15 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Laminin M chain,Laminin-12 subunit alpha,Laminin-2 subunit alpha,Laminin-4 subunit alpha,Merosin heavy chain' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EAKGLIRTWVTLKAEQTILPLVDEALQHTTTKGIVFQHPEIVAHMDLMREDLHLEPFYWKLPEQFEGKKLMAYGGKLKYA IYFEAREETGFSTYNPQVIIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRVHRTVTREDFLDILYDI HYILIKATYGNFMRQSRISEISMEVAEQGRGTTMTPPADLIEK ; _entity_poly.pdbx_seq_one_letter_code_can ;EAKGLIRTWVTLKAEQTILPLVDEALQHTTTKGIVFQHPEIVAHMDLMREDLHLEPFYWKLPEQFEGKKLMAYGGKLKYA IYFEAREETGFSTYNPQVIIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRVHRTVTREDFLDILYDI HYILIKATYGNFMRQSRISEISMEVAEQGRGTTMTPPADLIEK ; _entity_poly.pdbx_strand_id U _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ALA n 1 3 LYS n 1 4 GLY n 1 5 LEU n 1 6 ILE n 1 7 ARG n 1 8 THR n 1 9 TRP n 1 10 VAL n 1 11 THR n 1 12 LEU n 1 13 LYS n 1 14 ALA n 1 15 GLU n 1 16 GLN n 1 17 THR n 1 18 ILE n 1 19 LEU n 1 20 PRO n 1 21 LEU n 1 22 VAL n 1 23 ASP n 1 24 GLU n 1 25 ALA n 1 26 LEU n 1 27 GLN n 1 28 HIS n 1 29 THR n 1 30 THR n 1 31 THR n 1 32 LYS n 1 33 GLY n 1 34 ILE n 1 35 VAL n 1 36 PHE n 1 37 GLN n 1 38 HIS n 1 39 PRO n 1 40 GLU n 1 41 ILE n 1 42 VAL n 1 43 ALA n 1 44 HIS n 1 45 MET n 1 46 ASP n 1 47 LEU n 1 48 MET n 1 49 ARG n 1 50 GLU n 1 51 ASP n 1 52 LEU n 1 53 HIS n 1 54 LEU n 1 55 GLU n 1 56 PRO n 1 57 PHE n 1 58 TYR n 1 59 TRP n 1 60 LYS n 1 61 LEU n 1 62 PRO n 1 63 GLU n 1 64 GLN n 1 65 PHE n 1 66 GLU n 1 67 GLY n 1 68 LYS n 1 69 LYS n 1 70 LEU n 1 71 MET n 1 72 ALA n 1 73 TYR n 1 74 GLY n 1 75 GLY n 1 76 LYS n 1 77 LEU n 1 78 LYS n 1 79 TYR n 1 80 ALA n 1 81 ILE n 1 82 TYR n 1 83 PHE n 1 84 GLU n 1 85 ALA n 1 86 ARG n 1 87 GLU n 1 88 GLU n 1 89 THR n 1 90 GLY n 1 91 PHE n 1 92 SER n 1 93 THR n 1 94 TYR n 1 95 ASN n 1 96 PRO n 1 97 GLN n 1 98 VAL n 1 99 ILE n 1 100 ILE n 1 101 ARG n 1 102 GLY n 1 103 GLY n 1 104 THR n 1 105 PRO n 1 106 THR n 1 107 HIS n 1 108 ALA n 1 109 ARG n 1 110 ILE n 1 111 ILE n 1 112 VAL n 1 113 ARG n 1 114 HIS n 1 115 MET n 1 116 ALA n 1 117 ALA n 1 118 PRO n 1 119 LEU n 1 120 ILE n 1 121 GLY n 1 122 GLN n 1 123 LEU n 1 124 THR n 1 125 ARG n 1 126 HIS n 1 127 GLU n 1 128 ILE n 1 129 GLU n 1 130 MET n 1 131 THR n 1 132 GLU n 1 133 LYS n 1 134 GLU n 1 135 TRP n 1 136 LYS n 1 137 TYR n 1 138 TYR n 1 139 GLY n 1 140 ASP n 1 141 ASP n 1 142 PRO n 1 143 ARG n 1 144 VAL n 1 145 HIS n 1 146 ARG n 1 147 THR n 1 148 VAL n 1 149 THR n 1 150 ARG n 1 151 GLU n 1 152 ASP n 1 153 PHE n 1 154 LEU n 1 155 ASP n 1 156 ILE n 1 157 LEU n 1 158 TYR n 1 159 ASP n 1 160 ILE n 1 161 HIS n 1 162 TYR n 1 163 ILE n 1 164 LEU n 1 165 ILE n 1 166 LYS n 1 167 ALA n 1 168 THR n 1 169 TYR n 1 170 GLY n 1 171 ASN n 1 172 PHE n 1 173 MET n 1 174 ARG n 1 175 GLN n 1 176 SER n 1 177 ARG n 1 178 ILE n 1 179 SER n 1 180 GLU n 1 181 ILE n 1 182 SER n 1 183 MET n 1 184 GLU n 1 185 VAL n 1 186 ALA n 1 187 GLU n 1 188 GLN n 1 189 GLY n 1 190 ARG n 1 191 GLY n 1 192 THR n 1 193 THR n 1 194 MET n 1 195 THR n 1 196 PRO n 1 197 PRO n 1 198 ALA n 1 199 ASP n 1 200 LEU n 1 201 ILE n 1 202 GLU n 1 203 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 203 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'LAMA2, LAMM' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMal-c2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 2 ? ? ? U . n A 1 2 ALA 2 3 ? ? ? U . n A 1 3 LYS 3 4 ? ? ? U . n A 1 4 GLY 4 5 5 GLY GLY U . n A 1 5 LEU 5 6 6 LEU LEU U . n A 1 6 ILE 6 7 7 ILE ILE U . n A 1 7 ARG 7 8 8 ARG ARG U . n A 1 8 THR 8 9 9 THR THR U . n A 1 9 TRP 9 10 10 TRP TRP U . n A 1 10 VAL 10 11 11 VAL VAL U . n A 1 11 THR 11 12 12 THR THR U . n A 1 12 LEU 12 13 13 LEU LEU U . n A 1 13 LYS 13 14 14 LYS LYS U . n A 1 14 ALA 14 15 15 ALA ALA U . n A 1 15 GLU 15 16 16 GLU GLU U . n A 1 16 GLN 16 17 17 GLN GLN U . n A 1 17 THR 17 18 18 THR THR U . n A 1 18 ILE 18 19 19 ILE ILE U . n A 1 19 LEU 19 20 20 LEU LEU U . n A 1 20 PRO 20 21 21 PRO PRO U . n A 1 21 LEU 21 22 22 LEU LEU U . n A 1 22 VAL 22 23 23 VAL VAL U . n A 1 23 ASP 23 24 24 ASP ASP U . n A 1 24 GLU 24 25 25 GLU GLU U . n A 1 25 ALA 25 26 26 ALA ALA U . n A 1 26 LEU 26 27 27 LEU LEU U . n A 1 27 GLN 27 28 28 GLN GLN U . n A 1 28 HIS 28 29 29 HIS HIS U . n A 1 29 THR 29 30 30 THR THR U . n A 1 30 THR 30 31 31 THR THR U . n A 1 31 THR 31 32 32 THR THR U . n A 1 32 LYS 32 33 33 LYS LYS U . n A 1 33 GLY 33 34 34 GLY GLY U . n A 1 34 ILE 34 35 35 ILE ILE U . n A 1 35 VAL 35 36 36 VAL VAL U . n A 1 36 PHE 36 37 37 PHE PHE U . n A 1 37 GLN 37 38 38 GLN GLN U . n A 1 38 HIS 38 39 39 HIS HIS U . n A 1 39 PRO 39 40 40 PRO PRO U . n A 1 40 GLU 40 41 41 GLU GLU U . n A 1 41 ILE 41 42 42 ILE ILE U . n A 1 42 VAL 42 43 43 VAL VAL U . n A 1 43 ALA 43 44 44 ALA ALA U . n A 1 44 HIS 44 45 45 HIS HIS U . n A 1 45 MET 45 46 46 MET MET U . n A 1 46 ASP 46 47 47 ASP ASP U . n A 1 47 LEU 47 48 48 LEU LEU U . n A 1 48 MET 48 49 49 MET MET U . n A 1 49 ARG 49 50 50 ARG ARG U . n A 1 50 GLU 50 51 51 GLU GLU U . n A 1 51 ASP 51 52 52 ASP ASP U . n A 1 52 LEU 52 53 53 LEU LEU U . n A 1 53 HIS 53 54 54 HIS HIS U . n A 1 54 LEU 54 55 55 LEU LEU U . n A 1 55 GLU 55 56 56 GLU GLU U . n A 1 56 PRO 56 57 57 PRO PRO U . n A 1 57 PHE 57 58 58 PHE PHE U . n A 1 58 TYR 58 59 59 TYR TYR U . n A 1 59 TRP 59 60 60 TRP TRP U . n A 1 60 LYS 60 61 61 LYS LYS U . n A 1 61 LEU 61 62 62 LEU LEU U . n A 1 62 PRO 62 63 63 PRO PRO U . n A 1 63 GLU 63 64 64 GLU GLU U . n A 1 64 GLN 64 65 65 GLN GLN U . n A 1 65 PHE 65 66 66 PHE PHE U . n A 1 66 GLU 66 67 67 GLU GLU U . n A 1 67 GLY 67 68 68 GLY GLY U . n A 1 68 LYS 68 69 69 LYS LYS U . n A 1 69 LYS 69 70 70 LYS LYS U . n A 1 70 LEU 70 71 71 LEU LEU U . n A 1 71 MET 71 72 72 MET MET U . n A 1 72 ALA 72 73 73 ALA ALA U . n A 1 73 TYR 73 74 74 TYR TYR U . n A 1 74 GLY 74 75 75 GLY GLY U . n A 1 75 GLY 75 76 76 GLY GLY U . n A 1 76 LYS 76 77 77 LYS LYS U . n A 1 77 LEU 77 78 78 LEU LEU U . n A 1 78 LYS 78 79 79 LYS LYS U . n A 1 79 TYR 79 80 80 TYR TYR U . n A 1 80 ALA 80 81 81 ALA ALA U . n A 1 81 ILE 81 82 82 ILE ILE U . n A 1 82 TYR 82 83 83 TYR TYR U . n A 1 83 PHE 83 84 84 PHE PHE U . n A 1 84 GLU 84 85 85 GLU GLU U . n A 1 85 ALA 85 86 86 ALA ALA U . n A 1 86 ARG 86 87 87 ARG ARG U . n A 1 87 GLU 87 88 88 GLU GLU U . n A 1 88 GLU 88 89 89 GLU GLU U . n A 1 89 THR 89 90 90 THR THR U . n A 1 90 GLY 90 91 ? ? ? U . n A 1 91 PHE 91 92 ? ? ? U . n A 1 92 SER 92 93 ? ? ? U . n A 1 93 THR 93 94 ? ? ? U . n A 1 94 TYR 94 95 95 TYR TYR U . n A 1 95 ASN 95 96 96 ASN ASN U . n A 1 96 PRO 96 97 97 PRO PRO U . n A 1 97 GLN 97 98 98 GLN GLN U . n A 1 98 VAL 98 99 99 VAL VAL U . n A 1 99 ILE 99 100 100 ILE ILE U . n A 1 100 ILE 100 101 101 ILE ILE U . n A 1 101 ARG 101 102 102 ARG ARG U . n A 1 102 GLY 102 103 103 GLY GLY U . n A 1 103 GLY 103 104 104 GLY GLY U . n A 1 104 THR 104 105 105 THR THR U . n A 1 105 PRO 105 106 106 PRO PRO U . n A 1 106 THR 106 107 107 THR THR U . n A 1 107 HIS 107 108 108 HIS HIS U . n A 1 108 ALA 108 109 109 ALA ALA U . n A 1 109 ARG 109 110 110 ARG ARG U . n A 1 110 ILE 110 111 111 ILE ILE U . n A 1 111 ILE 111 112 112 ILE ILE U . n A 1 112 VAL 112 113 113 VAL VAL U . n A 1 113 ARG 113 114 114 ARG ARG U . n A 1 114 HIS 114 115 115 HIS HIS U . n A 1 115 MET 115 116 116 MET MET U . n A 1 116 ALA 116 117 117 ALA ALA U . n A 1 117 ALA 117 118 118 ALA ALA U . n A 1 118 PRO 118 119 119 PRO PRO U . n A 1 119 LEU 119 120 120 LEU LEU U . n A 1 120 ILE 120 121 121 ILE ILE U . n A 1 121 GLY 121 122 122 GLY GLY U . n A 1 122 GLN 122 123 123 GLN GLN U . n A 1 123 LEU 123 124 124 LEU LEU U . n A 1 124 THR 124 125 125 THR THR U . n A 1 125 ARG 125 126 126 ARG ARG U . n A 1 126 HIS 126 127 127 HIS HIS U . n A 1 127 GLU 127 128 128 GLU GLU U . n A 1 128 ILE 128 129 129 ILE ILE U . n A 1 129 GLU 129 130 130 GLU GLU U . n A 1 130 MET 130 131 131 MET MET U . n A 1 131 THR 131 132 132 THR THR U . n A 1 132 GLU 132 133 133 GLU GLU U . n A 1 133 LYS 133 134 134 LYS LYS U . n A 1 134 GLU 134 135 135 GLU GLU U . n A 1 135 TRP 135 136 136 TRP TRP U . n A 1 136 LYS 136 137 137 LYS LYS U . n A 1 137 TYR 137 138 138 TYR TYR U . n A 1 138 TYR 138 139 139 TYR TYR U . n A 1 139 GLY 139 140 140 GLY GLY U . n A 1 140 ASP 140 141 141 ASP ASP U . n A 1 141 ASP 141 142 142 ASP ASP U . n A 1 142 PRO 142 143 143 PRO PRO U . n A 1 143 ARG 143 144 144 ARG ARG U . n A 1 144 VAL 144 145 145 VAL VAL U . n A 1 145 HIS 145 146 146 HIS HIS U . n A 1 146 ARG 146 147 147 ARG ARG U . n A 1 147 THR 147 148 148 THR THR U . n A 1 148 VAL 148 149 149 VAL VAL U . n A 1 149 THR 149 150 150 THR THR U . n A 1 150 ARG 150 151 151 ARG ARG U . n A 1 151 GLU 151 152 152 GLU GLU U . n A 1 152 ASP 152 153 153 ASP ASP U . n A 1 153 PHE 153 154 154 PHE PHE U . n A 1 154 LEU 154 155 155 LEU LEU U . n A 1 155 ASP 155 156 156 ASP ASP U . n A 1 156 ILE 156 157 157 ILE ILE U . n A 1 157 LEU 157 158 158 LEU LEU U . n A 1 158 TYR 158 159 159 TYR TYR U . n A 1 159 ASP 159 160 160 ASP ASP U . n A 1 160 ILE 160 161 161 ILE ILE U . n A 1 161 HIS 161 162 162 HIS HIS U . n A 1 162 TYR 162 163 163 TYR TYR U . n A 1 163 ILE 163 164 164 ILE ILE U . n A 1 164 LEU 164 165 165 LEU LEU U . n A 1 165 ILE 165 166 166 ILE ILE U . n A 1 166 LYS 166 167 167 LYS LYS U . n A 1 167 ALA 167 168 168 ALA ALA U . n A 1 168 THR 168 169 169 THR THR U . n A 1 169 TYR 169 170 170 TYR TYR U . n A 1 170 GLY 170 171 171 GLY GLY U . n A 1 171 ASN 171 172 172 ASN ASN U . n A 1 172 PHE 172 173 173 PHE PHE U . n A 1 173 MET 173 174 174 MET MET U . n A 1 174 ARG 174 175 175 ARG ARG U . n A 1 175 GLN 175 176 176 GLN GLN U . n A 1 176 SER 176 177 177 SER SER U . n A 1 177 ARG 177 178 178 ARG ARG U . n A 1 178 ILE 178 179 179 ILE ILE U . n A 1 179 SER 179 180 180 SER SER U . n A 1 180 GLU 180 181 181 GLU GLU U . n A 1 181 ILE 181 182 182 ILE ILE U . n A 1 182 SER 182 183 183 SER SER U . n A 1 183 MET 183 184 184 MET MET U . n A 1 184 GLU 184 185 185 GLU GLU U . n A 1 185 VAL 185 186 186 VAL VAL U . n A 1 186 ALA 186 187 187 ALA ALA U . n A 1 187 GLU 187 188 188 GLU GLU U . n A 1 188 GLN 188 189 189 GLN GLN U . n A 1 189 GLY 189 190 ? ? ? U . n A 1 190 ARG 190 191 ? ? ? U . n A 1 191 GLY 191 192 ? ? ? U . n A 1 192 THR 192 193 ? ? ? U . n A 1 193 THR 193 194 ? ? ? U . n A 1 194 MET 194 195 ? ? ? U . n A 1 195 THR 195 196 ? ? ? U . n A 1 196 PRO 196 197 ? ? ? U . n A 1 197 PRO 197 198 ? ? ? U . n A 1 198 ALA 198 199 ? ? ? U . n A 1 199 ASP 199 200 ? ? ? U . n A 1 200 LEU 200 201 ? ? ? U . n A 1 201 ILE 201 202 ? ? ? U . n A 1 202 GLU 202 203 ? ? ? U . n A 1 203 LYS 203 204 ? ? ? U . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 20 HOH HOH U . B 2 HOH 2 302 32 HOH HOH U . B 2 HOH 3 303 1 HOH HOH U . B 2 HOH 4 304 17 HOH HOH U . B 2 HOH 5 305 37 HOH HOH U . B 2 HOH 6 306 7 HOH HOH U . B 2 HOH 7 307 2 HOH HOH U . B 2 HOH 8 308 4 HOH HOH U . B 2 HOH 9 309 6 HOH HOH U . B 2 HOH 10 310 30 HOH HOH U . B 2 HOH 11 311 31 HOH HOH U . B 2 HOH 12 312 33 HOH HOH U . B 2 HOH 13 313 34 HOH HOH U . B 2 HOH 14 314 35 HOH HOH U . B 2 HOH 15 315 36 HOH HOH U . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 U THR 90 ? OG1 ? A THR 89 OG1 2 1 Y 1 U THR 90 ? CG2 ? A THR 89 CG2 3 1 Y 1 U TYR 95 ? CG ? A TYR 94 CG 4 1 Y 1 U TYR 95 ? CD1 ? A TYR 94 CD1 5 1 Y 1 U TYR 95 ? CD2 ? A TYR 94 CD2 6 1 Y 1 U TYR 95 ? CE1 ? A TYR 94 CE1 7 1 Y 1 U TYR 95 ? CE2 ? A TYR 94 CE2 8 1 Y 1 U TYR 95 ? CZ ? A TYR 94 CZ 9 1 Y 1 U TYR 95 ? OH ? A TYR 94 OH 10 1 Y 1 U GLU 188 ? CG ? A GLU 187 CG 11 1 Y 1 U GLU 188 ? CD ? A GLU 187 CD 12 1 Y 1 U GLU 188 ? OE1 ? A GLU 187 OE1 13 1 Y 1 U GLU 188 ? OE2 ? A GLU 187 OE2 14 1 Y 1 U GLN 189 ? CG ? A GLN 188 CG 15 1 Y 1 U GLN 189 ? CD ? A GLN 188 CD 16 1 Y 1 U GLN 189 ? OE1 ? A GLN 188 OE1 17 1 Y 1 U GLN 189 ? NE2 ? A GLN 188 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.9_1688)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 4YEQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 161.107 _cell.length_a_esd ? _cell.length_b 161.107 _cell.length_b_esd ? _cell.length_c 78.929 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4YEQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4YEQ _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 6.25 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 80.32 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM sodium malonate, 100 mM MgCl2, 10% PEG 200, 100 mM Tris, pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt ? 100 ? ? 1 ? ? ? 1 ? ? ? ? ? ? ? 100 ? ? 1 ? ? ? 2 ? ? ? ? ? ? # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date ? CCD 1 'ADSC QUANTUM 315r' ? ? ? ? 2014-04-24 ? 'IMAGE PLATE' 2 'RIGAKU RAXIS IV++' ? ? ? ? 2014-03-05 # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? ? ? ? ? ? ? 1 M ? ? MAD ? x-ray ? 2 ? ? ? ? ? ? ? ? 2 M ? ? 'SINGLE WAVELENGTH' ? x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.979588 1.0 2 0.979804 1.0 3 0.977735 1.0 4 1.542 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? SYNCHROTRON ? 'ESRF BEAMLINE BM30A' ? ? '0.979588, 0.979804, 0.977735' ? BM30A ESRF ? ? 2 ? ? 'ROTATING ANODE' ? 'RIGAKU RUH3R' ? ? 1.542 ? ? ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4YEQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.2 _reflns.d_resolution_low 22.9 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10031 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.2 _reflns_shell.d_res_low 3.314 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 94.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 9.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4YEQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.200 _refine.ls_d_res_low 22.899 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10031 _refine.ls_number_reflns_R_free 697 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.64 _refine.ls_percent_reflns_R_free 6.95 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2162 _refine.ls_R_factor_R_free 0.2786 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2118 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4YEP _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.02 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.45 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1487 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 1502 _refine_hist.d_res_high 3.200 _refine_hist.d_res_low 22.899 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 ? 1523 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.367 ? 2060 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 17.552 ? 570 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.058 ? 226 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 260 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.2000 3.4463 . . 136 1811 96.00 . . . 0.3587 . 0.3018 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4463 3.7917 . . 131 1812 97.00 . . . 0.3186 . 0.2551 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7917 4.3372 . . 138 1869 97.00 . . . 0.3261 . 0.2124 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.3372 5.4522 . . 143 1873 97.00 . . . 0.2335 . 0.1894 . . . . . . . . . . 'X-RAY DIFFRACTION' 5.4522 22.9000 . . 149 1969 96.00 . . . 0.2492 . 0.1868 . . . . . . . . . . # _struct.entry_id 4YEQ _struct.title 'L4b Domain of Human Laminin alpha-2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4YEQ _struct_keywords.text 'carbohydrate binding fold, laminin, extracellular matrix, ephrin receptor, sugar binding protein' _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LAMA2_HUMAN _struct_ref.pdbx_db_accession P24043 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EAKGLIRTWVTLKAEQTILPLVDEALQHTTTKGIVFQHPEIVAHMDLMREDLHLEPFYWKLPEQFEGKKLMAYGGKLKYA IYFEAREETGFSTYNPQVIIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRVHRTVTREDFLDILYDI HYILIKATYGNFMRQSRISEISMEVAEQGRGTTMTPPADLIEK ; _struct_ref.pdbx_align_begin 1177 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4YEQ _struct_ref_seq.pdbx_strand_id U _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 203 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P24043 _struct_ref_seq.db_align_beg 1177 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1379 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 204 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 9780 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 46 ? GLU A 55 ? ASP U 47 GLU U 56 5 ? 10 HELX_P HELX_P2 AA2 PRO A 62 ? GLU A 66 ? PRO U 63 GLU U 67 5 ? 5 HELX_P HELX_P3 AA3 LYS A 69 ? GLY A 75 ? LYS U 70 GLY U 76 5 ? 7 HELX_P HELX_P4 AA4 THR A 149 ? TYR A 158 ? THR U 150 TYR U 159 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 HIS 38 A . ? HIS 39 U PRO 39 A ? PRO 40 U 1 0.72 2 GLU 55 A . ? GLU 56 U PRO 56 A ? PRO 57 U 1 5.74 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TRP A 9 ? THR A 11 ? TRP U 10 THR U 12 AA1 2 ASN A 171 ? GLU A 184 ? ASN U 172 GLU U 185 AA1 3 GLU A 40 ? HIS A 44 ? GLU U 41 HIS U 45 AA1 4 ILE A 34 ? GLN A 37 ? ILE U 35 GLN U 38 AA2 1 TRP A 9 ? THR A 11 ? TRP U 10 THR U 12 AA2 2 ASN A 171 ? GLU A 184 ? ASN U 172 GLU U 185 AA2 3 LEU A 77 ? GLU A 87 ? LEU U 78 GLU U 88 AA2 4 THR A 124 ? ILE A 128 ? THR U 125 ILE U 129 AA3 1 THR A 29 ? THR A 30 ? THR U 30 THR U 31 AA3 2 LEU A 21 ? VAL A 22 ? LEU U 22 VAL U 23 AA3 3 TYR A 58 ? LYS A 60 ? TYR U 59 LYS U 61 AA3 4 ILE A 160 ? LYS A 166 ? ILE U 161 LYS U 167 AA3 5 VAL A 98 ? GLY A 102 ? VAL U 99 GLY U 103 AA3 6 ARG A 109 ? ARG A 113 ? ARG U 110 ARG U 114 AA3 7 LYS A 136 ? TYR A 137 ? LYS U 137 TYR U 138 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 10 ? N VAL U 11 O MET A 183 ? O MET U 184 AA1 2 3 O SER A 176 ? O SER U 177 N ALA A 43 ? N ALA U 44 AA1 3 4 O VAL A 42 ? O VAL U 43 N VAL A 35 ? N VAL U 36 AA2 1 2 N VAL A 10 ? N VAL U 11 O MET A 183 ? O MET U 184 AA2 2 3 O ARG A 177 ? O ARG U 178 N TYR A 82 ? N TYR U 83 AA2 3 4 N ILE A 81 ? N ILE U 82 O THR A 124 ? O THR U 125 AA3 1 2 O THR A 30 ? O THR U 31 N LEU A 21 ? N LEU U 22 AA3 2 3 N VAL A 22 ? N VAL U 23 O TYR A 58 ? O TYR U 59 AA3 3 4 N TRP A 59 ? N TRP U 60 O ILE A 165 ? O ILE U 166 AA3 4 5 O HIS A 161 ? O HIS U 162 N ARG A 101 ? N ARG U 102 AA3 5 6 N ILE A 100 ? N ILE U 101 O ILE A 111 ? O ILE U 112 AA3 6 7 N VAL A 112 ? N VAL U 113 O LYS A 136 ? O LYS U 137 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU U 6 ? ? 72.95 43.86 2 1 GLN U 17 ? ? -62.22 96.91 3 1 LYS U 33 ? ? -44.61 -19.38 4 1 GLN U 38 ? ? -149.99 58.64 5 1 HIS U 39 ? ? -19.17 126.79 6 1 MET U 49 ? ? -147.02 17.29 7 1 LEU U 55 ? ? -61.80 13.76 8 1 LYS U 69 ? ? -61.95 91.56 9 1 LYS U 77 ? ? 59.03 91.75 10 1 PRO U 106 ? ? -28.21 -50.09 11 1 GLU U 133 ? ? -29.81 -33.76 12 1 PHE U 173 ? ? 54.69 84.61 13 1 VAL U 186 ? ? -130.33 -149.98 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 U GLU 2 ? A GLU 1 2 1 Y 1 U ALA 3 ? A ALA 2 3 1 Y 1 U LYS 4 ? A LYS 3 4 1 Y 1 U GLY 91 ? A GLY 90 5 1 Y 1 U PHE 92 ? A PHE 91 6 1 Y 1 U SER 93 ? A SER 92 7 1 Y 1 U THR 94 ? A THR 93 8 1 Y 1 U GLY 190 ? A GLY 189 9 1 Y 1 U ARG 191 ? A ARG 190 10 1 Y 1 U GLY 192 ? A GLY 191 11 1 Y 1 U THR 193 ? A THR 192 12 1 Y 1 U THR 194 ? A THR 193 13 1 Y 1 U MET 195 ? A MET 194 14 1 Y 1 U THR 196 ? A THR 195 15 1 Y 1 U PRO 197 ? A PRO 196 16 1 Y 1 U PRO 198 ? A PRO 197 17 1 Y 1 U ALA 199 ? A ALA 198 18 1 Y 1 U ASP 200 ? A ASP 199 19 1 Y 1 U LEU 201 ? A LEU 200 20 1 Y 1 U ILE 202 ? A ILE 201 21 1 Y 1 U GLU 203 ? A GLU 202 22 1 Y 1 U LYS 204 ? A LYS 203 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TRP N N N N 307 TRP CA C N S 308 TRP C C N N 309 TRP O O N N 310 TRP CB C N N 311 TRP CG C Y N 312 TRP CD1 C Y N 313 TRP CD2 C Y N 314 TRP NE1 N Y N 315 TRP CE2 C Y N 316 TRP CE3 C Y N 317 TRP CZ2 C Y N 318 TRP CZ3 C Y N 319 TRP CH2 C Y N 320 TRP OXT O N N 321 TRP H H N N 322 TRP H2 H N N 323 TRP HA H N N 324 TRP HB2 H N N 325 TRP HB3 H N N 326 TRP HD1 H N N 327 TRP HE1 H N N 328 TRP HE3 H N N 329 TRP HZ2 H N N 330 TRP HZ3 H N N 331 TRP HH2 H N N 332 TRP HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 VAL N N N N 358 VAL CA C N S 359 VAL C C N N 360 VAL O O N N 361 VAL CB C N N 362 VAL CG1 C N N 363 VAL CG2 C N N 364 VAL OXT O N N 365 VAL H H N N 366 VAL H2 H N N 367 VAL HA H N N 368 VAL HB H N N 369 VAL HG11 H N N 370 VAL HG12 H N N 371 VAL HG13 H N N 372 VAL HG21 H N N 373 VAL HG22 H N N 374 VAL HG23 H N N 375 VAL HXT H N N 376 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'European Research Council under the European Union Seventh Framework Programme' Israel 310649 1 'Kimmel Center for Macromolecular Assemblies' Israel . 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4YEP _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 4YEQ _atom_sites.fract_transf_matrix[1][1] 0.006207 _atom_sites.fract_transf_matrix[1][2] 0.003584 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007167 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012670 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_