data_4Z36 # _entry.id 4Z36 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4Z36 WWPDB D_1000208429 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details TargetTrack GPCR-235 unspecified . PDB 4Z34 unspecified . PDB 4Z35 unspecified . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4Z36 _pdbx_database_status.recvd_initial_deposition_date 2015-03-30 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chrencik, J.E.' 1 'Roth, C.B.' 2 'Terakado, M.' 3 'Kurata, H.' 4 'Omi, R.' 5 'Kihara, Y.' 6 'Warshaviak, D.' 7 'Nakade, S.' 8 'Asmar-Rovira, G.' 9 'Mileni, M.' 10 'Mizuno, H.' 11 'Griffith, M.T.' 12 'Rodgers, C.' 13 'Han, G.W.' 14 'Velasquez, J.' 15 'Chun, J.' 16 'Stevens, R.C.' 17 'Hanson, M.A.' 18 'GPCR Network (GPCR)' 19 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Cell _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1097-4172 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 161 _citation.language ? _citation.page_first 1633 _citation.page_last 1643 _citation.title 'Crystal Structure of Antagonist Bound Human Lysophosphatidic Acid Receptor 1.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.cell.2015.06.002 _citation.pdbx_database_id_PubMed 26091040 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Chrencik, J.E.' 1 primary 'Roth, C.B.' 2 primary 'Terakado, M.' 3 primary 'Kurata, H.' 4 primary 'Omi, R.' 5 primary 'Kihara, Y.' 6 primary 'Warshaviak, D.' 7 primary 'Nakade, S.' 8 primary 'Asmar-Rovira, G.' 9 primary 'Mileni, M.' 10 primary 'Mizuno, H.' 11 primary 'Griffith, M.T.' 12 primary 'Rodgers, C.' 13 primary 'Han, G.W.' 14 primary 'Velasquez, J.' 15 primary 'Chun, J.' 16 primary 'Stevens, R.C.' 17 primary 'Hanson, M.A.' 18 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 4Z36 _cell.details ? _cell.formula_units_Z ? _cell.length_a 34.350 _cell.length_a_esd ? _cell.length_b 111.930 _cell.length_b_esd ? _cell.length_c 153.960 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4Z36 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Lysophosphatidic acid receptor 1,Soluble cytochrome b562' 51842.332 1 ? 'M1007W, H1102I, R1106L' 'unp residues 2-232; unp residues 23-64; unp residues 78-127; unp residues 249-327' ? 2 non-polymer syn ;1-(4-{[(2S,3R)-2-(2,3-dihydro-1H-inden-2-yloxy)-3-(3,5-dimethoxy-4-methylphenyl)-3-hydroxypropyl]oxy}phenyl)cyclopropanecarboxylic acid ; 518.597 1 ? ? ? ? 3 non-polymer syn '(2S)-2,3-dihydroxypropyl (7Z)-tetradec-7-enoate' 300.434 1 ? ? ? ? 4 water nat water 18.015 3 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'LPA-1,Lysophosphatidic acid receptor Edg-2,Cytochrome b-562,Cytochrome b-562,LPA-1,Lysophosphatidic acid receptor Edg-2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKTIIALSYIFCLVFAGAPAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVCIF IMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLLAI AIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIENCSNMAPLYSCSYLVFWAIFNLVTFVVMV VLYAHIFGYVADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKGGSGGSDSPEMKDFRHGFDILVGQIDDA LKLANEGKVKEAQAAAEQLKTTRNAYIQKYLRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDCCCPQCDVLAYEKFF LLLAEFNSAMNPIIYSYRDKEMSATFRQILGRPLEVLFQGPHHHHHHHHHHDYKDDDDK ; _entity_poly.pdbx_seq_one_letter_code_can ;MKTIIALSYIFCLVFAGAPAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVCIF IMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLLAI AIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIENCSNMAPLYSCSYLVFWAIFNLVTFVVMV VLYAHIFGYVADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKGGSGGSDSPEMKDFRHGFDILVGQIDDA LKLANEGKVKEAQAAAEQLKTTRNAYIQKYLRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDCCCPQCDVLAYEKFF LLLAEFNSAMNPIIYSYRDKEMSATFRQILGRPLEVLFQGPHHHHHHHHHHDYKDDDDK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier GPCR-235 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 THR n 1 4 ILE n 1 5 ILE n 1 6 ALA n 1 7 LEU n 1 8 SER n 1 9 TYR n 1 10 ILE n 1 11 PHE n 1 12 CYS n 1 13 LEU n 1 14 VAL n 1 15 PHE n 1 16 ALA n 1 17 GLY n 1 18 ALA n 1 19 PRO n 1 20 ALA n 1 21 ALA n 1 22 ILE n 1 23 SER n 1 24 THR n 1 25 SER n 1 26 ILE n 1 27 PRO n 1 28 VAL n 1 29 ILE n 1 30 SER n 1 31 GLN n 1 32 PRO n 1 33 GLN n 1 34 PHE n 1 35 THR n 1 36 ALA n 1 37 MET n 1 38 ASN n 1 39 GLU n 1 40 PRO n 1 41 GLN n 1 42 CYS n 1 43 PHE n 1 44 TYR n 1 45 ASN n 1 46 GLU n 1 47 SER n 1 48 ILE n 1 49 ALA n 1 50 PHE n 1 51 PHE n 1 52 TYR n 1 53 ASN n 1 54 ARG n 1 55 SER n 1 56 GLY n 1 57 LYS n 1 58 HIS n 1 59 LEU n 1 60 ALA n 1 61 THR n 1 62 GLU n 1 63 TRP n 1 64 ASN n 1 65 THR n 1 66 VAL n 1 67 SER n 1 68 LYS n 1 69 LEU n 1 70 VAL n 1 71 MET n 1 72 GLY n 1 73 LEU n 1 74 GLY n 1 75 ILE n 1 76 THR n 1 77 VAL n 1 78 CYS n 1 79 ILE n 1 80 PHE n 1 81 ILE n 1 82 MET n 1 83 LEU n 1 84 ALA n 1 85 ASN n 1 86 LEU n 1 87 LEU n 1 88 VAL n 1 89 MET n 1 90 VAL n 1 91 ALA n 1 92 ILE n 1 93 TYR n 1 94 VAL n 1 95 ASN n 1 96 ARG n 1 97 ARG n 1 98 PHE n 1 99 HIS n 1 100 PHE n 1 101 PRO n 1 102 ILE n 1 103 TYR n 1 104 TYR n 1 105 LEU n 1 106 MET n 1 107 ALA n 1 108 ASN n 1 109 LEU n 1 110 ALA n 1 111 ALA n 1 112 ALA n 1 113 ASP n 1 114 PHE n 1 115 PHE n 1 116 ALA n 1 117 GLY n 1 118 LEU n 1 119 ALA n 1 120 TYR n 1 121 PHE n 1 122 TYR n 1 123 LEU n 1 124 MET n 1 125 PHE n 1 126 ASN n 1 127 THR n 1 128 GLY n 1 129 PRO n 1 130 ASN n 1 131 THR n 1 132 ARG n 1 133 ARG n 1 134 LEU n 1 135 THR n 1 136 VAL n 1 137 SER n 1 138 THR n 1 139 TRP n 1 140 LEU n 1 141 LEU n 1 142 ARG n 1 143 GLN n 1 144 GLY n 1 145 LEU n 1 146 ILE n 1 147 ASP n 1 148 THR n 1 149 SER n 1 150 LEU n 1 151 THR n 1 152 ALA n 1 153 SER n 1 154 VAL n 1 155 ALA n 1 156 ASN n 1 157 LEU n 1 158 LEU n 1 159 ALA n 1 160 ILE n 1 161 ALA n 1 162 ILE n 1 163 GLU n 1 164 ARG n 1 165 HIS n 1 166 ILE n 1 167 THR n 1 168 VAL n 1 169 PHE n 1 170 ARG n 1 171 MET n 1 172 GLN n 1 173 LEU n 1 174 HIS n 1 175 THR n 1 176 ARG n 1 177 MET n 1 178 SER n 1 179 ASN n 1 180 ARG n 1 181 ARG n 1 182 VAL n 1 183 VAL n 1 184 VAL n 1 185 VAL n 1 186 ILE n 1 187 VAL n 1 188 VAL n 1 189 ILE n 1 190 TRP n 1 191 THR n 1 192 MET n 1 193 ALA n 1 194 ILE n 1 195 VAL n 1 196 MET n 1 197 GLY n 1 198 ALA n 1 199 ILE n 1 200 PRO n 1 201 SER n 1 202 VAL n 1 203 GLY n 1 204 TRP n 1 205 ASN n 1 206 CYS n 1 207 ILE n 1 208 CYS n 1 209 ASP n 1 210 ILE n 1 211 GLU n 1 212 ASN n 1 213 CYS n 1 214 SER n 1 215 ASN n 1 216 MET n 1 217 ALA n 1 218 PRO n 1 219 LEU n 1 220 TYR n 1 221 SER n 1 222 CYS n 1 223 SER n 1 224 TYR n 1 225 LEU n 1 226 VAL n 1 227 PHE n 1 228 TRP n 1 229 ALA n 1 230 ILE n 1 231 PHE n 1 232 ASN n 1 233 LEU n 1 234 VAL n 1 235 THR n 1 236 PHE n 1 237 VAL n 1 238 VAL n 1 239 MET n 1 240 VAL n 1 241 VAL n 1 242 LEU n 1 243 TYR n 1 244 ALA n 1 245 HIS n 1 246 ILE n 1 247 PHE n 1 248 GLY n 1 249 TYR n 1 250 VAL n 1 251 ALA n 1 252 ASP n 1 253 LEU n 1 254 GLU n 1 255 ASP n 1 256 ASN n 1 257 TRP n 1 258 GLU n 1 259 THR n 1 260 LEU n 1 261 ASN n 1 262 ASP n 1 263 ASN n 1 264 LEU n 1 265 LYS n 1 266 VAL n 1 267 ILE n 1 268 GLU n 1 269 LYS n 1 270 ALA n 1 271 ASP n 1 272 ASN n 1 273 ALA n 1 274 ALA n 1 275 GLN n 1 276 VAL n 1 277 LYS n 1 278 ASP n 1 279 ALA n 1 280 LEU n 1 281 THR n 1 282 LYS n 1 283 MET n 1 284 ARG n 1 285 ALA n 1 286 ALA n 1 287 ALA n 1 288 LEU n 1 289 ASP n 1 290 ALA n 1 291 GLN n 1 292 LYS n 1 293 GLY n 1 294 GLY n 1 295 SER n 1 296 GLY n 1 297 GLY n 1 298 SER n 1 299 ASP n 1 300 SER n 1 301 PRO n 1 302 GLU n 1 303 MET n 1 304 LYS n 1 305 ASP n 1 306 PHE n 1 307 ARG n 1 308 HIS n 1 309 GLY n 1 310 PHE n 1 311 ASP n 1 312 ILE n 1 313 LEU n 1 314 VAL n 1 315 GLY n 1 316 GLN n 1 317 ILE n 1 318 ASP n 1 319 ASP n 1 320 ALA n 1 321 LEU n 1 322 LYS n 1 323 LEU n 1 324 ALA n 1 325 ASN n 1 326 GLU n 1 327 GLY n 1 328 LYS n 1 329 VAL n 1 330 LYS n 1 331 GLU n 1 332 ALA n 1 333 GLN n 1 334 ALA n 1 335 ALA n 1 336 ALA n 1 337 GLU n 1 338 GLN n 1 339 LEU n 1 340 LYS n 1 341 THR n 1 342 THR n 1 343 ARG n 1 344 ASN n 1 345 ALA n 1 346 TYR n 1 347 ILE n 1 348 GLN n 1 349 LYS n 1 350 TYR n 1 351 LEU n 1 352 ARG n 1 353 ASN n 1 354 ARG n 1 355 ASP n 1 356 THR n 1 357 MET n 1 358 MET n 1 359 SER n 1 360 LEU n 1 361 LEU n 1 362 LYS n 1 363 THR n 1 364 VAL n 1 365 VAL n 1 366 ILE n 1 367 VAL n 1 368 LEU n 1 369 GLY n 1 370 ALA n 1 371 PHE n 1 372 ILE n 1 373 ILE n 1 374 CYS n 1 375 TRP n 1 376 THR n 1 377 PRO n 1 378 GLY n 1 379 LEU n 1 380 VAL n 1 381 LEU n 1 382 LEU n 1 383 LEU n 1 384 LEU n 1 385 ASP n 1 386 CYS n 1 387 CYS n 1 388 CYS n 1 389 PRO n 1 390 GLN n 1 391 CYS n 1 392 ASP n 1 393 VAL n 1 394 LEU n 1 395 ALA n 1 396 TYR n 1 397 GLU n 1 398 LYS n 1 399 PHE n 1 400 PHE n 1 401 LEU n 1 402 LEU n 1 403 LEU n 1 404 ALA n 1 405 GLU n 1 406 PHE n 1 407 ASN n 1 408 SER n 1 409 ALA n 1 410 MET n 1 411 ASN n 1 412 PRO n 1 413 ILE n 1 414 ILE n 1 415 TYR n 1 416 SER n 1 417 TYR n 1 418 ARG n 1 419 ASP n 1 420 LYS n 1 421 GLU n 1 422 MET n 1 423 SER n 1 424 ALA n 1 425 THR n 1 426 PHE n 1 427 ARG n 1 428 GLN n 1 429 ILE n 1 430 LEU n 1 431 GLY n 1 432 ARG n 1 433 PRO n 1 434 LEU n 1 435 GLU n 1 436 VAL n 1 437 LEU n 1 438 PHE n 1 439 GLN n 1 440 GLY n 1 441 PRO n 1 442 HIS n 1 443 HIS n 1 444 HIS n 1 445 HIS n 1 446 HIS n 1 447 HIS n 1 448 HIS n 1 449 HIS n 1 450 HIS n 1 451 HIS n 1 452 ASP n 1 453 TYR n 1 454 LYS n 1 455 ASP n 1 456 ASP n 1 457 ASP n 1 458 ASP n 1 459 LYS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 250 Human ? 'LPAR1, EDG2, LPA1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? sf9 CRL-1711 ? ? ? ? plasmid ? ? ? pFASTBAC ? ? 1 2 sample 'Biological sequence' 251 292 ? ? cybC ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? sf9 CRL-1711 ? ? ? ? plasmid ? ? ? pFASTBAC ? ? 1 3 sample 'Biological sequence' 301 351 ? ? cybC ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? sf9 CRL-1711 ? ? ? ? plasmid ? ? ? pFASTBAC ? ? 1 4 sample 'Biological sequence' 352 459 Human ? 'LPAR1, EDG2, LPA1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? sf9 CRL-1711 ? ? ? ? plasmid ? ? ? pFASTBAC ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP LPAR1_HUMAN Q92633 ? 1 ;AAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVCIFIMLANLLVMVAIYVNRRFH FPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSN RRVVVVIVVIWTMAIVMGAIPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYV ; 2 2 UNP C562_ECOLX P0ABE7 ? 1 ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQK 23 3 UNP C562_ECOLX P0ABE7 ? 1 PEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKY 78 4 UNP LPAR1_HUMAN Q92633 Q92633-2 1 RNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLAEFNSAMNPIIYSYRDKEMSATFRQIL 249 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4Z36 A 20 ? 250 ? Q92633 2 ? 232 ? 2 232 2 2 4Z36 A 251 ? 292 ? P0ABE7 23 ? 64 ? 1001 1042 3 3 4Z36 A 301 ? 350 ? P0ABE7 78 ? 127 ? 1056 1105 4 4 4Z36 A 352 ? 430 ? Q92633 249 ? 327 ? 248 326 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4Z36 MET A 1 ? UNP Q92633 ? ? 'initiating methionine' -17 1 1 4Z36 LYS A 2 ? UNP Q92633 ? ? 'expression tag' -16 2 1 4Z36 THR A 3 ? UNP Q92633 ? ? 'expression tag' -15 3 1 4Z36 ILE A 4 ? UNP Q92633 ? ? 'expression tag' -14 4 1 4Z36 ILE A 5 ? UNP Q92633 ? ? 'expression tag' -13 5 1 4Z36 ALA A 6 ? UNP Q92633 ? ? 'expression tag' -12 6 1 4Z36 LEU A 7 ? UNP Q92633 ? ? 'expression tag' -11 7 1 4Z36 SER A 8 ? UNP Q92633 ? ? 'expression tag' -10 8 1 4Z36 TYR A 9 ? UNP Q92633 ? ? 'expression tag' -9 9 1 4Z36 ILE A 10 ? UNP Q92633 ? ? 'expression tag' -8 10 1 4Z36 PHE A 11 ? UNP Q92633 ? ? 'expression tag' -7 11 1 4Z36 CYS A 12 ? UNP Q92633 ? ? 'expression tag' -6 12 1 4Z36 LEU A 13 ? UNP Q92633 ? ? 'expression tag' -5 13 1 4Z36 VAL A 14 ? UNP Q92633 ? ? 'expression tag' -4 14 1 4Z36 PHE A 15 ? UNP Q92633 ? ? 'expression tag' -3 15 1 4Z36 ALA A 16 ? UNP Q92633 ? ? 'expression tag' -2 16 1 4Z36 GLY A 17 ? UNP Q92633 ? ? 'expression tag' -1 17 1 4Z36 ALA A 18 ? UNP Q92633 ? ? 'expression tag' 0 18 1 4Z36 PRO A 19 ? UNP Q92633 ? ? 'expression tag' 1 19 1 4Z36 CYS A 222 ? UNP Q92633 ASP 204 'engineered mutation' 204 20 2 4Z36 TRP A 257 ? UNP P0ABE7 MET 29 'engineered mutation' 1007 21 2 4Z36 GLY A 293 ? UNP P0ABE7 ? ? linker 1043 22 2 4Z36 GLY A 294 ? UNP P0ABE7 ? ? linker 1049 23 2 4Z36 SER A 295 ? UNP P0ABE7 ? ? linker 1050 24 2 4Z36 GLY A 296 ? UNP P0ABE7 ? ? linker 1051 25 2 4Z36 GLY A 297 ? UNP P0ABE7 ? ? linker 1052 26 2 4Z36 SER A 298 ? UNP P0ABE7 ? ? linker 1053 27 2 4Z36 ASP A 299 ? UNP P0ABE7 ? ? linker 1054 28 2 4Z36 SER A 300 ? UNP P0ABE7 ? ? linker 1055 29 3 4Z36 ILE A 347 ? UNP P0ABE7 HIS 124 'engineered mutation' 1102 30 3 4Z36 LEU A 351 ? UNP P0ABE7 ? ? linker 1106 31 4 4Z36 CYS A 386 ? UNP Q92633 VAL 283 conflict 282 32 4 4Z36 GLY A 431 ? UNP Q92633 ? ? 'expression tag' 327 33 4 4Z36 ARG A 432 ? UNP Q92633 ? ? 'expression tag' 328 34 4 4Z36 PRO A 433 ? UNP Q92633 ? ? 'expression tag' 329 35 4 4Z36 LEU A 434 ? UNP Q92633 ? ? 'expression tag' 330 36 4 4Z36 GLU A 435 ? UNP Q92633 ? ? 'expression tag' 331 37 4 4Z36 VAL A 436 ? UNP Q92633 ? ? 'expression tag' 332 38 4 4Z36 LEU A 437 ? UNP Q92633 ? ? 'expression tag' 333 39 4 4Z36 PHE A 438 ? UNP Q92633 ? ? 'expression tag' 334 40 4 4Z36 GLN A 439 ? UNP Q92633 ? ? 'expression tag' 335 41 4 4Z36 GLY A 440 ? UNP Q92633 ? ? 'expression tag' 336 42 4 4Z36 PRO A 441 ? UNP Q92633 ? ? 'expression tag' 337 43 4 4Z36 HIS A 442 ? UNP Q92633 ? ? 'expression tag' 338 44 4 4Z36 HIS A 443 ? UNP Q92633 ? ? 'expression tag' 339 45 4 4Z36 HIS A 444 ? UNP Q92633 ? ? 'expression tag' 340 46 4 4Z36 HIS A 445 ? UNP Q92633 ? ? 'expression tag' 341 47 4 4Z36 HIS A 446 ? UNP Q92633 ? ? 'expression tag' 342 48 4 4Z36 HIS A 447 ? UNP Q92633 ? ? 'expression tag' 343 49 4 4Z36 HIS A 448 ? UNP Q92633 ? ? 'expression tag' 344 50 4 4Z36 HIS A 449 ? UNP Q92633 ? ? 'expression tag' 345 51 4 4Z36 HIS A 450 ? UNP Q92633 ? ? 'expression tag' 346 52 4 4Z36 HIS A 451 ? UNP Q92633 ? ? 'expression tag' 347 53 4 4Z36 ASP A 452 ? UNP Q92633 ? ? 'expression tag' 348 54 4 4Z36 TYR A 453 ? UNP Q92633 ? ? 'expression tag' 349 55 4 4Z36 LYS A 454 ? UNP Q92633 ? ? 'expression tag' 350 56 4 4Z36 ASP A 455 ? UNP Q92633 ? ? 'expression tag' 351 57 4 4Z36 ASP A 456 ? UNP Q92633 ? ? 'expression tag' 352 58 4 4Z36 ASP A 457 ? UNP Q92633 ? ? 'expression tag' 353 59 4 4Z36 ASP A 458 ? UNP Q92633 ? ? 'expression tag' 354 60 4 4Z36 LYS A 459 ? UNP Q92633 ? ? 'expression tag' 355 61 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 1WV non-polymer . '(2S)-2,3-dihydroxypropyl (7Z)-tetradec-7-enoate' ? 'C17 H32 O4' 300.434 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 ON3 non-polymer . ;1-(4-{[(2S,3R)-2-(2,3-dihydro-1H-inden-2-yloxy)-3-(3,5-dimethoxy-4-methylphenyl)-3-hydroxypropyl]oxy}phenyl)cyclopropanecarboxylic acid ; ONO-3080573 'C31 H34 O7' 518.597 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4Z36 _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.89 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.47 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'LIPIDIC CUBIC PHASE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M sodium citrate (pH 5.5), 34 - 38% (v/v) PEG400 and 200 mM ammonium acetate ; _exptl_crystal_grow.pdbx_pH_range ? # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt ? 100 ? ? 1 ? ? ? 1 ? ? ? ? ? ? ? 100 ? ? 1 ? ? ? 2 ? ? ? ? ? ? # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date ? CCD 1 'MARMOSAIC 300 mm CCD' ? ? ? ? 2013-11-10 ? CCD 2 'MARMOSAIC 300 mm CCD' ? ? ? ? 2013-11-30 # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? Mirrors ? ? ? ? ? 1 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 2 ? ? Mirrors ? ? ? ? ? 2 M ? ? 'SINGLE WAVELENGTH' ? x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.033 1.0 2 . 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? SYNCHROTRON ? 'APS BEAMLINE 23-ID-D' ? ? 1.033 ? 23-ID-D APS ? ? 2 ? ? SYNCHROTRON ? 'APS BEAMLINE 23-ID-B' ? ? 1.033 ? 23-ID-B APS # _reflns.B_iso_Wilson_estimate 66.40 _reflns.entry_id 4Z36 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.90 _reflns.d_resolution_low 47 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12701 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.4 _reflns.pdbx_Rmerge_I_obs 0.13 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.9 _reflns_shell.d_res_low 3.1 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 80 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.59 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 11.8945 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -7.1017 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -4.7928 _refine.B_iso_max ? _refine.B_iso_mean 95.32 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.8849 _refine.correlation_coeff_Fo_to_Fc_free 0.8480 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4Z36 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.90 _refine.ls_d_res_low 30.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12660 _refine.ls_number_reflns_R_free 625 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 91.11 _refine.ls_percent_reflns_R_free 4.94 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2728 _refine.ls_R_factor_R_free 0.2921 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2718 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.429 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.426 _refine.pdbx_overall_SU_R_Blow_DPI 4.569 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 2.352 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 4Z36 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.684 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 3015 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 56 _refine_hist.number_atoms_solvent 3 _refine_hist.number_atoms_total 3074 _refine_hist.d_res_high 2.90 _refine_hist.d_res_low 30.00 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 3141 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 0.87 ? 4267 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1445 ? t_dihedral_angle_d 4.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 62 ? t_trig_c_planes 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 476 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 3141 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 1.58 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 2.61 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 419 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 3662 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.90 _refine_ls_shell.d_res_low 3.18 _refine_ls_shell.number_reflns_all 2593 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 117 _refine_ls_shell.number_reflns_R_work 2476 _refine_ls_shell.percent_reflns_obs 91.11 _refine_ls_shell.percent_reflns_R_free 4.51 _refine_ls_shell.R_factor_all 0.2572 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2793 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2562 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 4Z36 _struct.title 'Crystal Structure of Human Lysophosphatidic Acid Receptor 1 in complex with ONO-3080573' _struct.pdbx_descriptor 'Lysophosphatidic Acid Receptor 1, cytochrome b562 (BRIL) chimera construct' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4Z36 _struct_keywords.text ;human lysophosphatidic acid receptor 1 (LPA1), G-protein coupled receptor (GPCR), membrane protein, antagonist, endogenous ligand, PSI-biology, structural genomics, GPCR network, lipidic cubic phase (LCP), novel disulfide bond engineering, compound design, polypharmacology, lipid receptor, TRANSPORT PROTEIN-inhibitor complex ; _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN/inhibitor' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details 'authors have indicated that the biological unit is unknown' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 47 ? SER A 55 ? SER A 29 SER A 37 1 ? 9 HELX_P HELX_P2 AA2 ASN A 64 ? ASN A 95 ? ASN A 46 ASN A 77 1 ? 32 HELX_P HELX_P3 AA3 ARG A 96 ? HIS A 99 ? ARG A 78 HIS A 81 5 ? 4 HELX_P HELX_P4 AA4 PHE A 100 ? PHE A 125 ? PHE A 82 PHE A 107 1 ? 26 HELX_P HELX_P5 AA5 ASN A 126 ? ARG A 132 ? ASN A 108 ARG A 114 5 ? 7 HELX_P HELX_P6 AA6 THR A 135 ? ARG A 170 ? THR A 117 ARG A 152 1 ? 36 HELX_P HELX_P7 AA7 THR A 175 ? GLY A 197 ? THR A 157 GLY A 179 1 ? 23 HELX_P HELX_P8 AA8 ALA A 198 ? VAL A 202 ? ALA A 180 VAL A 184 5 ? 5 HELX_P HELX_P9 AA9 ASP A 209 ? CYS A 213 ? ASP A 191 CYS A 195 5 ? 5 HELX_P HELX_P10 AB1 SER A 221 ? LYS A 269 ? SER A 203 LYS A 1019 1 ? 49 HELX_P HELX_P11 AB2 ASN A 272 ? GLN A 291 ? ASN A 1022 GLN A 1041 1 ? 20 HELX_P HELX_P12 AB3 PHE A 306 ? GLY A 327 ? PHE A 1061 GLY A 1082 1 ? 22 HELX_P HELX_P13 AB4 LYS A 328 ? ASN A 344 ? LYS A 1083 ASN A 1099 1 ? 17 HELX_P HELX_P14 AB5 ASN A 353 ? CYS A 388 ? ASN A 249 CYS A 284 1 ? 36 HELX_P HELX_P15 AB6 GLU A 397 ? ASP A 419 ? GLU A 293 ASP A 315 1 ? 23 HELX_P HELX_P16 AB7 ASP A 419 ? GLY A 431 ? ASP A 315 GLY A 327 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 42 SG ? ? ? 1_555 A CYS 208 SG ? ? A CYS 24 A CYS 190 1_555 ? ? ? ? ? ? ? 2.035 ? disulf2 disulf ? ? A CYS 206 SG ? ? ? 1_555 A CYS 213 SG ? ? A CYS 188 A CYS 195 1_555 ? ? ? ? ? ? ? 2.035 ? disulf3 disulf ? ? A CYS 222 SG ? ? ? 1_555 A CYS 386 SG ? ? A CYS 204 A CYS 282 1_555 ? ? ? ? ? ? ? 2.037 ? disulf4 disulf ? ? A CYS 388 SG ? ? ? 1_555 A CYS 391 SG ? ? A CYS 284 A CYS 287 1_555 ? ? ? ? ? ? ? 2.035 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ON3 2000 ? 13 'binding site for residue ON3 A 2000' AC2 Software A 1WV 2001 ? 5 'binding site for residue 1WV A 2001' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 VAL A 70 ? VAL A 52 . ? 1_555 ? 2 AC1 13 THR A 127 ? THR A 109 . ? 1_555 ? 3 AC1 13 GLN A 143 ? GLN A 125 . ? 1_555 ? 4 AC1 13 ILE A 146 ? ILE A 128 . ? 1_555 ? 5 AC1 13 ASP A 147 ? ASP A 129 . ? 1_555 ? 6 AC1 13 TRP A 228 ? TRP A 210 . ? 1_555 ? 7 AC1 13 TRP A 375 ? TRP A 271 . ? 1_555 ? 8 AC1 13 GLY A 378 ? GLY A 274 . ? 1_555 ? 9 AC1 13 LEU A 382 ? LEU A 278 . ? 1_555 ? 10 AC1 13 GLU A 397 ? GLU A 293 . ? 1_555 ? 11 AC1 13 LYS A 398 ? LYS A 294 . ? 1_555 ? 12 AC1 13 PHE A 400 ? PHE A 296 . ? 1_555 ? 13 AC1 13 LEU A 401 ? LEU A 297 . ? 1_555 ? 14 AC2 5 LEU A 69 ? LEU A 51 . ? 1_655 ? 15 AC2 5 LEU A 140 ? LEU A 122 . ? 1_555 ? 16 AC2 5 THR A 148 ? THR A 130 . ? 1_555 ? 17 AC2 5 GLY A 197 ? GLY A 179 . ? 1_555 ? 18 AC2 5 SER A 201 ? SER A 183 . ? 1_555 ? # _atom_sites.entry_id 4Z36 _atom_sites.fract_transf_matrix[1][1] 0.029112 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008934 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006495 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -17 ? ? ? A . n A 1 2 LYS 2 -16 ? ? ? A . n A 1 3 THR 3 -15 ? ? ? A . n A 1 4 ILE 4 -14 ? ? ? A . n A 1 5 ILE 5 -13 ? ? ? A . n A 1 6 ALA 6 -12 ? ? ? A . n A 1 7 LEU 7 -11 ? ? ? A . n A 1 8 SER 8 -10 ? ? ? A . n A 1 9 TYR 9 -9 ? ? ? A . n A 1 10 ILE 10 -8 ? ? ? A . n A 1 11 PHE 11 -7 ? ? ? A . n A 1 12 CYS 12 -6 ? ? ? A . n A 1 13 LEU 13 -5 ? ? ? A . n A 1 14 VAL 14 -4 ? ? ? A . n A 1 15 PHE 15 -3 ? ? ? A . n A 1 16 ALA 16 -2 ? ? ? A . n A 1 17 GLY 17 -1 ? ? ? A . n A 1 18 ALA 18 0 ? ? ? A . n A 1 19 PRO 19 1 ? ? ? A . n A 1 20 ALA 20 2 ? ? ? A . n A 1 21 ALA 21 3 ? ? ? A . n A 1 22 ILE 22 4 ? ? ? A . n A 1 23 SER 23 5 ? ? ? A . n A 1 24 THR 24 6 ? ? ? A . n A 1 25 SER 25 7 ? ? ? A . n A 1 26 ILE 26 8 ? ? ? A . n A 1 27 PRO 27 9 ? ? ? A . n A 1 28 VAL 28 10 ? ? ? A . n A 1 29 ILE 29 11 ? ? ? A . n A 1 30 SER 30 12 ? ? ? A . n A 1 31 GLN 31 13 ? ? ? A . n A 1 32 PRO 32 14 ? ? ? A . n A 1 33 GLN 33 15 ? ? ? A . n A 1 34 PHE 34 16 ? ? ? A . n A 1 35 THR 35 17 ? ? ? A . n A 1 36 ALA 36 18 ? ? ? A . n A 1 37 MET 37 19 ? ? ? A . n A 1 38 ASN 38 20 ? ? ? A . n A 1 39 GLU 39 21 ? ? ? A . n A 1 40 PRO 40 22 ? ? ? A . n A 1 41 GLN 41 23 23 GLN GLN A . n A 1 42 CYS 42 24 24 CYS CYS A . n A 1 43 PHE 43 25 25 PHE PHE A . n A 1 44 TYR 44 26 26 TYR TYR A . n A 1 45 ASN 45 27 27 ASN ASN A . n A 1 46 GLU 46 28 28 GLU GLU A . n A 1 47 SER 47 29 29 SER SER A . n A 1 48 ILE 48 30 30 ILE ILE A . n A 1 49 ALA 49 31 31 ALA ALA A . n A 1 50 PHE 50 32 32 PHE PHE A . n A 1 51 PHE 51 33 33 PHE PHE A . n A 1 52 TYR 52 34 34 TYR TYR A . n A 1 53 ASN 53 35 35 ASN ASN A . n A 1 54 ARG 54 36 36 ARG ARG A . n A 1 55 SER 55 37 37 SER SER A . n A 1 56 GLY 56 38 38 GLY GLY A . n A 1 57 LYS 57 39 39 LYS LYS A . n A 1 58 HIS 58 40 40 HIS HIS A . n A 1 59 LEU 59 41 41 LEU LEU A . n A 1 60 ALA 60 42 42 ALA ALA A . n A 1 61 THR 61 43 43 THR THR A . n A 1 62 GLU 62 44 44 GLU GLU A . n A 1 63 TRP 63 45 45 TRP TRP A . n A 1 64 ASN 64 46 46 ASN ASN A . n A 1 65 THR 65 47 47 THR THR A . n A 1 66 VAL 66 48 48 VAL VAL A . n A 1 67 SER 67 49 49 SER SER A . n A 1 68 LYS 68 50 50 LYS LYS A . n A 1 69 LEU 69 51 51 LEU LEU A . n A 1 70 VAL 70 52 52 VAL VAL A . n A 1 71 MET 71 53 53 MET MET A . n A 1 72 GLY 72 54 54 GLY GLY A . n A 1 73 LEU 73 55 55 LEU LEU A . n A 1 74 GLY 74 56 56 GLY GLY A . n A 1 75 ILE 75 57 57 ILE ILE A . n A 1 76 THR 76 58 58 THR THR A . n A 1 77 VAL 77 59 59 VAL VAL A . n A 1 78 CYS 78 60 60 CYS CYS A . n A 1 79 ILE 79 61 61 ILE ILE A . n A 1 80 PHE 80 62 62 PHE PHE A . n A 1 81 ILE 81 63 63 ILE ILE A . n A 1 82 MET 82 64 64 MET MET A . n A 1 83 LEU 83 65 65 LEU LEU A . n A 1 84 ALA 84 66 66 ALA ALA A . n A 1 85 ASN 85 67 67 ASN ASN A . n A 1 86 LEU 86 68 68 LEU LEU A . n A 1 87 LEU 87 69 69 LEU LEU A . n A 1 88 VAL 88 70 70 VAL VAL A . n A 1 89 MET 89 71 71 MET MET A . n A 1 90 VAL 90 72 72 VAL VAL A . n A 1 91 ALA 91 73 73 ALA ALA A . n A 1 92 ILE 92 74 74 ILE ILE A . n A 1 93 TYR 93 75 75 TYR TYR A . n A 1 94 VAL 94 76 76 VAL VAL A . n A 1 95 ASN 95 77 77 ASN ASN A . n A 1 96 ARG 96 78 78 ARG ARG A . n A 1 97 ARG 97 79 79 ARG ARG A . n A 1 98 PHE 98 80 80 PHE PHE A . n A 1 99 HIS 99 81 81 HIS HIS A . n A 1 100 PHE 100 82 82 PHE PHE A . n A 1 101 PRO 101 83 83 PRO PRO A . n A 1 102 ILE 102 84 84 ILE ILE A . n A 1 103 TYR 103 85 85 TYR TYR A . n A 1 104 TYR 104 86 86 TYR TYR A . n A 1 105 LEU 105 87 87 LEU LEU A . n A 1 106 MET 106 88 88 MET MET A . n A 1 107 ALA 107 89 89 ALA ALA A . n A 1 108 ASN 108 90 90 ASN ASN A . n A 1 109 LEU 109 91 91 LEU LEU A . n A 1 110 ALA 110 92 92 ALA ALA A . n A 1 111 ALA 111 93 93 ALA ALA A . n A 1 112 ALA 112 94 94 ALA ALA A . n A 1 113 ASP 113 95 95 ASP ASP A . n A 1 114 PHE 114 96 96 PHE PHE A . n A 1 115 PHE 115 97 97 PHE PHE A . n A 1 116 ALA 116 98 98 ALA ALA A . n A 1 117 GLY 117 99 99 GLY GLY A . n A 1 118 LEU 118 100 100 LEU LEU A . n A 1 119 ALA 119 101 101 ALA ALA A . n A 1 120 TYR 120 102 102 TYR TYR A . n A 1 121 PHE 121 103 103 PHE PHE A . n A 1 122 TYR 122 104 104 TYR TYR A . n A 1 123 LEU 123 105 105 LEU LEU A . n A 1 124 MET 124 106 106 MET MET A . n A 1 125 PHE 125 107 107 PHE PHE A . n A 1 126 ASN 126 108 108 ASN ASN A . n A 1 127 THR 127 109 109 THR THR A . n A 1 128 GLY 128 110 110 GLY GLY A . n A 1 129 PRO 129 111 111 PRO PRO A . n A 1 130 ASN 130 112 112 ASN ASN A . n A 1 131 THR 131 113 113 THR THR A . n A 1 132 ARG 132 114 114 ARG ARG A . n A 1 133 ARG 133 115 115 ARG ARG A . n A 1 134 LEU 134 116 116 LEU LEU A . n A 1 135 THR 135 117 117 THR THR A . n A 1 136 VAL 136 118 118 VAL VAL A . n A 1 137 SER 137 119 119 SER SER A . n A 1 138 THR 138 120 120 THR THR A . n A 1 139 TRP 139 121 121 TRP TRP A . n A 1 140 LEU 140 122 122 LEU LEU A . n A 1 141 LEU 141 123 123 LEU LEU A . n A 1 142 ARG 142 124 124 ARG ARG A . n A 1 143 GLN 143 125 125 GLN GLN A . n A 1 144 GLY 144 126 126 GLY GLY A . n A 1 145 LEU 145 127 127 LEU LEU A . n A 1 146 ILE 146 128 128 ILE ILE A . n A 1 147 ASP 147 129 129 ASP ASP A . n A 1 148 THR 148 130 130 THR THR A . n A 1 149 SER 149 131 131 SER SER A . n A 1 150 LEU 150 132 132 LEU LEU A . n A 1 151 THR 151 133 133 THR THR A . n A 1 152 ALA 152 134 134 ALA ALA A . n A 1 153 SER 153 135 135 SER SER A . n A 1 154 VAL 154 136 136 VAL VAL A . n A 1 155 ALA 155 137 137 ALA ALA A . n A 1 156 ASN 156 138 138 ASN ASN A . n A 1 157 LEU 157 139 139 LEU LEU A . n A 1 158 LEU 158 140 140 LEU LEU A . n A 1 159 ALA 159 141 141 ALA ALA A . n A 1 160 ILE 160 142 142 ILE ILE A . n A 1 161 ALA 161 143 143 ALA ALA A . n A 1 162 ILE 162 144 144 ILE ILE A . n A 1 163 GLU 163 145 145 GLU GLU A . n A 1 164 ARG 164 146 146 ARG ARG A . n A 1 165 HIS 165 147 147 HIS HIS A . n A 1 166 ILE 166 148 148 ILE ILE A . n A 1 167 THR 167 149 149 THR THR A . n A 1 168 VAL 168 150 150 VAL VAL A . n A 1 169 PHE 169 151 151 PHE PHE A . n A 1 170 ARG 170 152 152 ARG ARG A . n A 1 171 MET 171 153 153 MET MET A . n A 1 172 GLN 172 154 154 GLN GLN A . n A 1 173 LEU 173 155 155 LEU LEU A . n A 1 174 HIS 174 156 156 HIS HIS A . n A 1 175 THR 175 157 157 THR THR A . n A 1 176 ARG 176 158 158 ARG ARG A . n A 1 177 MET 177 159 159 MET MET A . n A 1 178 SER 178 160 160 SER SER A . n A 1 179 ASN 179 161 161 ASN ASN A . n A 1 180 ARG 180 162 162 ARG ARG A . n A 1 181 ARG 181 163 163 ARG ARG A . n A 1 182 VAL 182 164 164 VAL VAL A . n A 1 183 VAL 183 165 165 VAL VAL A . n A 1 184 VAL 184 166 166 VAL VAL A . n A 1 185 VAL 185 167 167 VAL VAL A . n A 1 186 ILE 186 168 168 ILE ILE A . n A 1 187 VAL 187 169 169 VAL VAL A . n A 1 188 VAL 188 170 170 VAL VAL A . n A 1 189 ILE 189 171 171 ILE ILE A . n A 1 190 TRP 190 172 172 TRP TRP A . n A 1 191 THR 191 173 173 THR THR A . n A 1 192 MET 192 174 174 MET MET A . n A 1 193 ALA 193 175 175 ALA ALA A . n A 1 194 ILE 194 176 176 ILE ILE A . n A 1 195 VAL 195 177 177 VAL VAL A . n A 1 196 MET 196 178 178 MET MET A . n A 1 197 GLY 197 179 179 GLY GLY A . n A 1 198 ALA 198 180 180 ALA ALA A . n A 1 199 ILE 199 181 181 ILE ILE A . n A 1 200 PRO 200 182 182 PRO PRO A . n A 1 201 SER 201 183 183 SER SER A . n A 1 202 VAL 202 184 184 VAL VAL A . n A 1 203 GLY 203 185 185 GLY GLY A . n A 1 204 TRP 204 186 186 TRP TRP A . n A 1 205 ASN 205 187 187 ASN ASN A . n A 1 206 CYS 206 188 188 CYS CYS A . n A 1 207 ILE 207 189 189 ILE ILE A . n A 1 208 CYS 208 190 190 CYS CYS A . n A 1 209 ASP 209 191 191 ASP ASP A . n A 1 210 ILE 210 192 192 ILE ILE A . n A 1 211 GLU 211 193 193 GLU GLU A . n A 1 212 ASN 212 194 194 ASN ASN A . n A 1 213 CYS 213 195 195 CYS CYS A . n A 1 214 SER 214 196 196 SER SER A . n A 1 215 ASN 215 197 197 ASN ASN A . n A 1 216 MET 216 198 198 MET MET A . n A 1 217 ALA 217 199 199 ALA ALA A . n A 1 218 PRO 218 200 200 PRO PRO A . n A 1 219 LEU 219 201 201 LEU LEU A . n A 1 220 TYR 220 202 202 TYR TYR A . n A 1 221 SER 221 203 203 SER SER A . n A 1 222 CYS 222 204 204 CYS CYS A . n A 1 223 SER 223 205 205 SER SER A . n A 1 224 TYR 224 206 206 TYR TYR A . n A 1 225 LEU 225 207 207 LEU LEU A . n A 1 226 VAL 226 208 208 VAL VAL A . n A 1 227 PHE 227 209 209 PHE PHE A . n A 1 228 TRP 228 210 210 TRP TRP A . n A 1 229 ALA 229 211 211 ALA ALA A . n A 1 230 ILE 230 212 212 ILE ILE A . n A 1 231 PHE 231 213 213 PHE PHE A . n A 1 232 ASN 232 214 214 ASN ASN A . n A 1 233 LEU 233 215 215 LEU LEU A . n A 1 234 VAL 234 216 216 VAL VAL A . n A 1 235 THR 235 217 217 THR THR A . n A 1 236 PHE 236 218 218 PHE PHE A . n A 1 237 VAL 237 219 219 VAL VAL A . n A 1 238 VAL 238 220 220 VAL VAL A . n A 1 239 MET 239 221 221 MET MET A . n A 1 240 VAL 240 222 222 VAL VAL A . n A 1 241 VAL 241 223 223 VAL VAL A . n A 1 242 LEU 242 224 224 LEU LEU A . n A 1 243 TYR 243 225 225 TYR TYR A . n A 1 244 ALA 244 226 226 ALA ALA A . n A 1 245 HIS 245 227 227 HIS HIS A . n A 1 246 ILE 246 228 228 ILE ILE A . n A 1 247 PHE 247 229 229 PHE PHE A . n A 1 248 GLY 248 230 230 GLY GLY A . n A 1 249 TYR 249 231 231 TYR TYR A . n A 1 250 VAL 250 232 232 VAL VAL A . n A 1 251 ALA 251 1001 1001 ALA ALA A . n A 1 252 ASP 252 1002 1002 ASP ASP A . n A 1 253 LEU 253 1003 1003 LEU LEU A . n A 1 254 GLU 254 1004 1004 GLU GLU A . n A 1 255 ASP 255 1005 1005 ASP ASP A . n A 1 256 ASN 256 1006 1006 ASN ASN A . n A 1 257 TRP 257 1007 1007 TRP TRP A . n A 1 258 GLU 258 1008 1008 GLU GLU A . n A 1 259 THR 259 1009 1009 THR THR A . n A 1 260 LEU 260 1010 1010 LEU LEU A . n A 1 261 ASN 261 1011 1011 ASN ASN A . n A 1 262 ASP 262 1012 1012 ASP ASP A . n A 1 263 ASN 263 1013 1013 ASN ASN A . n A 1 264 LEU 264 1014 1014 LEU LEU A . n A 1 265 LYS 265 1015 1015 LYS LYS A . n A 1 266 VAL 266 1016 1016 VAL VAL A . n A 1 267 ILE 267 1017 1017 ILE ILE A . n A 1 268 GLU 268 1018 1018 GLU GLU A . n A 1 269 LYS 269 1019 1019 LYS LYS A . n A 1 270 ALA 270 1020 1020 ALA ALA A . n A 1 271 ASP 271 1021 1021 ASP ASP A . n A 1 272 ASN 272 1022 1022 ASN ASN A . n A 1 273 ALA 273 1023 1023 ALA ALA A . n A 1 274 ALA 274 1024 1024 ALA ALA A . n A 1 275 GLN 275 1025 1025 GLN GLN A . n A 1 276 VAL 276 1026 1026 VAL VAL A . n A 1 277 LYS 277 1027 1027 LYS LYS A . n A 1 278 ASP 278 1028 1028 ASP ASP A . n A 1 279 ALA 279 1029 1029 ALA ALA A . n A 1 280 LEU 280 1030 1030 LEU LEU A . n A 1 281 THR 281 1031 1031 THR THR A . n A 1 282 LYS 282 1032 1032 LYS LYS A . n A 1 283 MET 283 1033 1033 MET MET A . n A 1 284 ARG 284 1034 1034 ARG ARG A . n A 1 285 ALA 285 1035 1035 ALA ALA A . n A 1 286 ALA 286 1036 1036 ALA ALA A . n A 1 287 ALA 287 1037 1037 ALA ALA A . n A 1 288 LEU 288 1038 1038 LEU LEU A . n A 1 289 ASP 289 1039 1039 ASP ASP A . n A 1 290 ALA 290 1040 1040 ALA ALA A . n A 1 291 GLN 291 1041 1041 GLN GLN A . n A 1 292 LYS 292 1042 1042 LYS LYS A . n A 1 293 GLY 293 1043 1043 GLY GLY A . n A 1 294 GLY 294 1049 ? ? ? A . n A 1 295 SER 295 1050 ? ? ? A . n A 1 296 GLY 296 1051 ? ? ? A . n A 1 297 GLY 297 1052 ? ? ? A . n A 1 298 SER 298 1053 ? ? ? A . n A 1 299 ASP 299 1054 ? ? ? A . n A 1 300 SER 300 1055 ? ? ? A . n A 1 301 PRO 301 1056 ? ? ? A . n A 1 302 GLU 302 1057 ? ? ? A . n A 1 303 MET 303 1058 1058 MET MET A . n A 1 304 LYS 304 1059 1059 LYS LYS A . n A 1 305 ASP 305 1060 1060 ASP ASP A . n A 1 306 PHE 306 1061 1061 PHE PHE A . n A 1 307 ARG 307 1062 1062 ARG ARG A . n A 1 308 HIS 308 1063 1063 HIS HIS A . n A 1 309 GLY 309 1064 1064 GLY GLY A . n A 1 310 PHE 310 1065 1065 PHE PHE A . n A 1 311 ASP 311 1066 1066 ASP ASP A . n A 1 312 ILE 312 1067 1067 ILE ILE A . n A 1 313 LEU 313 1068 1068 LEU LEU A . n A 1 314 VAL 314 1069 1069 VAL VAL A . n A 1 315 GLY 315 1070 1070 GLY GLY A . n A 1 316 GLN 316 1071 1071 GLN GLN A . n A 1 317 ILE 317 1072 1072 ILE ILE A . n A 1 318 ASP 318 1073 1073 ASP ASP A . n A 1 319 ASP 319 1074 1074 ASP ASP A . n A 1 320 ALA 320 1075 1075 ALA ALA A . n A 1 321 LEU 321 1076 1076 LEU LEU A . n A 1 322 LYS 322 1077 1077 LYS LYS A . n A 1 323 LEU 323 1078 1078 LEU LEU A . n A 1 324 ALA 324 1079 1079 ALA ALA A . n A 1 325 ASN 325 1080 1080 ASN ASN A . n A 1 326 GLU 326 1081 1081 GLU GLU A . n A 1 327 GLY 327 1082 1082 GLY GLY A . n A 1 328 LYS 328 1083 1083 LYS LYS A . n A 1 329 VAL 329 1084 1084 VAL VAL A . n A 1 330 LYS 330 1085 1085 LYS LYS A . n A 1 331 GLU 331 1086 1086 GLU GLU A . n A 1 332 ALA 332 1087 1087 ALA ALA A . n A 1 333 GLN 333 1088 1088 GLN GLN A . n A 1 334 ALA 334 1089 1089 ALA ALA A . n A 1 335 ALA 335 1090 1090 ALA ALA A . n A 1 336 ALA 336 1091 1091 ALA ALA A . n A 1 337 GLU 337 1092 1092 GLU GLU A . n A 1 338 GLN 338 1093 1093 GLN GLN A . n A 1 339 LEU 339 1094 1094 LEU LEU A . n A 1 340 LYS 340 1095 1095 LYS LYS A . n A 1 341 THR 341 1096 1096 THR THR A . n A 1 342 THR 342 1097 1097 THR THR A . n A 1 343 ARG 343 1098 1098 ARG ARG A . n A 1 344 ASN 344 1099 1099 ASN ASN A . n A 1 345 ALA 345 1100 1100 ALA ALA A . n A 1 346 TYR 346 1101 1101 TYR TYR A . n A 1 347 ILE 347 1102 1102 ILE ILE A . n A 1 348 GLN 348 1103 1103 GLN GLN A . n A 1 349 LYS 349 1104 1104 LYS LYS A . n A 1 350 TYR 350 1105 1105 TYR TYR A . n A 1 351 LEU 351 1106 1106 LEU LEU A . n A 1 352 ARG 352 248 248 ARG ARG A . n A 1 353 ASN 353 249 249 ASN ASN A . n A 1 354 ARG 354 250 250 ARG ARG A . n A 1 355 ASP 355 251 251 ASP ASP A . n A 1 356 THR 356 252 252 THR THR A . n A 1 357 MET 357 253 253 MET MET A . n A 1 358 MET 358 254 254 MET MET A . n A 1 359 SER 359 255 255 SER SER A . n A 1 360 LEU 360 256 256 LEU LEU A . n A 1 361 LEU 361 257 257 LEU LEU A . n A 1 362 LYS 362 258 258 LYS LYS A . n A 1 363 THR 363 259 259 THR THR A . n A 1 364 VAL 364 260 260 VAL VAL A . n A 1 365 VAL 365 261 261 VAL VAL A . n A 1 366 ILE 366 262 262 ILE ILE A . n A 1 367 VAL 367 263 263 VAL VAL A . n A 1 368 LEU 368 264 264 LEU LEU A . n A 1 369 GLY 369 265 265 GLY GLY A . n A 1 370 ALA 370 266 266 ALA ALA A . n A 1 371 PHE 371 267 267 PHE PHE A . n A 1 372 ILE 372 268 268 ILE ILE A . n A 1 373 ILE 373 269 269 ILE ILE A . n A 1 374 CYS 374 270 270 CYS CYS A . n A 1 375 TRP 375 271 271 TRP TRP A . n A 1 376 THR 376 272 272 THR THR A . n A 1 377 PRO 377 273 273 PRO PRO A . n A 1 378 GLY 378 274 274 GLY GLY A . n A 1 379 LEU 379 275 275 LEU LEU A . n A 1 380 VAL 380 276 276 VAL VAL A . n A 1 381 LEU 381 277 277 LEU LEU A . n A 1 382 LEU 382 278 278 LEU LEU A . n A 1 383 LEU 383 279 279 LEU LEU A . n A 1 384 LEU 384 280 280 LEU LEU A . n A 1 385 ASP 385 281 281 ASP ASP A . n A 1 386 CYS 386 282 282 CYS CYS A . n A 1 387 CYS 387 283 283 CYS CYS A . n A 1 388 CYS 388 284 284 CYS CYS A . n A 1 389 PRO 389 285 285 PRO PRO A . n A 1 390 GLN 390 286 286 GLN GLN A . n A 1 391 CYS 391 287 287 CYS CYS A . n A 1 392 ASP 392 288 288 ASP ASP A . n A 1 393 VAL 393 289 289 VAL VAL A . n A 1 394 LEU 394 290 290 LEU LEU A . n A 1 395 ALA 395 291 291 ALA ALA A . n A 1 396 TYR 396 292 292 TYR TYR A . n A 1 397 GLU 397 293 293 GLU GLU A . n A 1 398 LYS 398 294 294 LYS LYS A . n A 1 399 PHE 399 295 295 PHE PHE A . n A 1 400 PHE 400 296 296 PHE PHE A . n A 1 401 LEU 401 297 297 LEU LEU A . n A 1 402 LEU 402 298 298 LEU LEU A . n A 1 403 LEU 403 299 299 LEU LEU A . n A 1 404 ALA 404 300 300 ALA ALA A . n A 1 405 GLU 405 301 301 GLU GLU A . n A 1 406 PHE 406 302 302 PHE PHE A . n A 1 407 ASN 407 303 303 ASN ASN A . n A 1 408 SER 408 304 304 SER SER A . n A 1 409 ALA 409 305 305 ALA ALA A . n A 1 410 MET 410 306 306 MET MET A . n A 1 411 ASN 411 307 307 ASN ASN A . n A 1 412 PRO 412 308 308 PRO PRO A . n A 1 413 ILE 413 309 309 ILE ILE A . n A 1 414 ILE 414 310 310 ILE ILE A . n A 1 415 TYR 415 311 311 TYR TYR A . n A 1 416 SER 416 312 312 SER SER A . n A 1 417 TYR 417 313 313 TYR TYR A . n A 1 418 ARG 418 314 314 ARG ARG A . n A 1 419 ASP 419 315 315 ASP ASP A . n A 1 420 LYS 420 316 316 LYS LYS A . n A 1 421 GLU 421 317 317 GLU GLU A . n A 1 422 MET 422 318 318 MET MET A . n A 1 423 SER 423 319 319 SER SER A . n A 1 424 ALA 424 320 320 ALA ALA A . n A 1 425 THR 425 321 321 THR THR A . n A 1 426 PHE 426 322 322 PHE PHE A . n A 1 427 ARG 427 323 323 ARG ARG A . n A 1 428 GLN 428 324 324 GLN GLN A . n A 1 429 ILE 429 325 325 ILE ILE A . n A 1 430 LEU 430 326 326 LEU LEU A . n A 1 431 GLY 431 327 327 GLY GLY A . n A 1 432 ARG 432 328 ? ? ? A . n A 1 433 PRO 433 329 ? ? ? A . n A 1 434 LEU 434 330 ? ? ? A . n A 1 435 GLU 435 331 ? ? ? A . n A 1 436 VAL 436 332 ? ? ? A . n A 1 437 LEU 437 333 ? ? ? A . n A 1 438 PHE 438 334 ? ? ? A . n A 1 439 GLN 439 335 ? ? ? A . n A 1 440 GLY 440 336 ? ? ? A . n A 1 441 PRO 441 337 ? ? ? A . n A 1 442 HIS 442 338 ? ? ? A . n A 1 443 HIS 443 339 ? ? ? A . n A 1 444 HIS 444 340 ? ? ? A . n A 1 445 HIS 445 341 ? ? ? A . n A 1 446 HIS 446 342 ? ? ? A . n A 1 447 HIS 447 343 ? ? ? A . n A 1 448 HIS 448 344 ? ? ? A . n A 1 449 HIS 449 345 ? ? ? A . n A 1 450 HIS 450 346 ? ? ? A . n A 1 451 HIS 451 347 ? ? ? A . n A 1 452 ASP 452 348 ? ? ? A . n A 1 453 TYR 453 349 ? ? ? A . n A 1 454 LYS 454 350 ? ? ? A . n A 1 455 ASP 455 351 ? ? ? A . n A 1 456 ASP 456 352 ? ? ? A . n A 1 457 ASP 457 353 ? ? ? A . n A 1 458 ASP 458 354 ? ? ? A . n A 1 459 LYS 459 355 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name PSI:Biology _pdbx_SG_project.full_name_of_center 'GPCR Network' _pdbx_SG_project.initial_of_center GPCR # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ON3 1 2000 2000 ON3 ESO A . C 3 1WV 1 2001 2001 1WV OLB A . D 4 HOH 1 2101 2004 HOH HOH A . D 4 HOH 2 2102 2002 HOH HOH A . D 4 HOH 3 2103 2003 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-06-03 2 'Structure model' 1 1 2015-07-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -0.3047 _pdbx_refine_tls.origin_y -18.8188 _pdbx_refine_tls.origin_z 30.2925 _pdbx_refine_tls.T[1][1] -0.1899 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.1437 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0055 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.1980 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0353 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.1326 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.7166 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.6523 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.2160 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.8696 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.7267 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.3715 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0088 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0203 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.1395 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.1020 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.1233 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0956 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0382 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0319 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.1145 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '{ A|* }' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.0 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 24 ? ? -68.95 95.78 2 1 MET A 153 ? ? 64.90 -59.83 3 1 ASP A 191 ? ? -143.41 52.06 4 1 ASN A 194 ? ? -99.26 38.69 5 1 GLN A 286 ? ? 84.08 0.97 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 23 ? CG ? A GLN 41 CG 2 1 Y 1 A GLN 23 ? CD ? A GLN 41 CD 3 1 Y 1 A GLN 23 ? OE1 ? A GLN 41 OE1 4 1 Y 1 A GLN 23 ? NE2 ? A GLN 41 NE2 5 1 Y 1 A ARG 152 ? CG ? A ARG 170 CG 6 1 Y 1 A ARG 152 ? CD ? A ARG 170 CD 7 1 Y 1 A ARG 152 ? NE ? A ARG 170 NE 8 1 Y 1 A ARG 152 ? CZ ? A ARG 170 CZ 9 1 Y 1 A ARG 152 ? NH1 ? A ARG 170 NH1 10 1 Y 1 A ARG 152 ? NH2 ? A ARG 170 NH2 11 1 Y 1 A ARG 1062 ? CG ? A ARG 307 CG 12 1 Y 1 A ARG 1062 ? CD ? A ARG 307 CD 13 1 Y 1 A ARG 1062 ? NE ? A ARG 307 NE 14 1 Y 1 A ARG 1062 ? CZ ? A ARG 307 CZ 15 1 Y 1 A ARG 1062 ? NH1 ? A ARG 307 NH1 16 1 Y 1 A ARG 1062 ? NH2 ? A ARG 307 NH2 17 1 Y 1 A LEU 1106 ? CG ? A LEU 351 CG 18 1 Y 1 A LEU 1106 ? CD1 ? A LEU 351 CD1 19 1 Y 1 A LEU 1106 ? CD2 ? A LEU 351 CD2 20 1 Y 1 A GLN 286 ? CG ? A GLN 390 CG 21 1 Y 1 A GLN 286 ? CD ? A GLN 390 CD 22 1 Y 1 A GLN 286 ? OE1 ? A GLN 390 OE1 23 1 Y 1 A GLN 286 ? NE2 ? A GLN 390 NE2 24 1 N 1 A 1WV 2001 ? C4 ? C 1WV 1 C4 25 1 N 1 A 1WV 2001 ? C5 ? C 1WV 1 C5 26 1 N 1 A 1WV 2001 ? C6 ? C 1WV 1 C6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -17 ? A MET 1 2 1 Y 1 A LYS -16 ? A LYS 2 3 1 Y 1 A THR -15 ? A THR 3 4 1 Y 1 A ILE -14 ? A ILE 4 5 1 Y 1 A ILE -13 ? A ILE 5 6 1 Y 1 A ALA -12 ? A ALA 6 7 1 Y 1 A LEU -11 ? A LEU 7 8 1 Y 1 A SER -10 ? A SER 8 9 1 Y 1 A TYR -9 ? A TYR 9 10 1 Y 1 A ILE -8 ? A ILE 10 11 1 Y 1 A PHE -7 ? A PHE 11 12 1 Y 1 A CYS -6 ? A CYS 12 13 1 Y 1 A LEU -5 ? A LEU 13 14 1 Y 1 A VAL -4 ? A VAL 14 15 1 Y 1 A PHE -3 ? A PHE 15 16 1 Y 1 A ALA -2 ? A ALA 16 17 1 Y 1 A GLY -1 ? A GLY 17 18 1 Y 1 A ALA 0 ? A ALA 18 19 1 Y 1 A PRO 1 ? A PRO 19 20 1 Y 1 A ALA 2 ? A ALA 20 21 1 Y 1 A ALA 3 ? A ALA 21 22 1 Y 1 A ILE 4 ? A ILE 22 23 1 Y 1 A SER 5 ? A SER 23 24 1 Y 1 A THR 6 ? A THR 24 25 1 Y 1 A SER 7 ? A SER 25 26 1 Y 1 A ILE 8 ? A ILE 26 27 1 Y 1 A PRO 9 ? A PRO 27 28 1 Y 1 A VAL 10 ? A VAL 28 29 1 Y 1 A ILE 11 ? A ILE 29 30 1 Y 1 A SER 12 ? A SER 30 31 1 Y 1 A GLN 13 ? A GLN 31 32 1 Y 1 A PRO 14 ? A PRO 32 33 1 Y 1 A GLN 15 ? A GLN 33 34 1 Y 1 A PHE 16 ? A PHE 34 35 1 Y 1 A THR 17 ? A THR 35 36 1 Y 1 A ALA 18 ? A ALA 36 37 1 Y 1 A MET 19 ? A MET 37 38 1 Y 1 A ASN 20 ? A ASN 38 39 1 Y 1 A GLU 21 ? A GLU 39 40 1 Y 1 A PRO 22 ? A PRO 40 41 1 Y 1 A GLY 1049 ? A GLY 294 42 1 Y 1 A SER 1050 ? A SER 295 43 1 Y 1 A GLY 1051 ? A GLY 296 44 1 Y 1 A GLY 1052 ? A GLY 297 45 1 Y 1 A SER 1053 ? A SER 298 46 1 Y 1 A ASP 1054 ? A ASP 299 47 1 Y 1 A SER 1055 ? A SER 300 48 1 Y 1 A PRO 1056 ? A PRO 301 49 1 Y 1 A GLU 1057 ? A GLU 302 50 1 Y 1 A ARG 328 ? A ARG 432 51 1 Y 1 A PRO 329 ? A PRO 433 52 1 Y 1 A LEU 330 ? A LEU 434 53 1 Y 1 A GLU 331 ? A GLU 435 54 1 Y 1 A VAL 332 ? A VAL 436 55 1 Y 1 A LEU 333 ? A LEU 437 56 1 Y 1 A PHE 334 ? A PHE 438 57 1 Y 1 A GLN 335 ? A GLN 439 58 1 Y 1 A GLY 336 ? A GLY 440 59 1 Y 1 A PRO 337 ? A PRO 441 60 1 Y 1 A HIS 338 ? A HIS 442 61 1 Y 1 A HIS 339 ? A HIS 443 62 1 Y 1 A HIS 340 ? A HIS 444 63 1 Y 1 A HIS 341 ? A HIS 445 64 1 Y 1 A HIS 342 ? A HIS 446 65 1 Y 1 A HIS 343 ? A HIS 447 66 1 Y 1 A HIS 344 ? A HIS 448 67 1 Y 1 A HIS 345 ? A HIS 449 68 1 Y 1 A HIS 346 ? A HIS 450 69 1 Y 1 A HIS 347 ? A HIS 451 70 1 Y 1 A ASP 348 ? A ASP 452 71 1 Y 1 A TYR 349 ? A TYR 453 72 1 Y 1 A LYS 350 ? A LYS 454 73 1 Y 1 A ASP 351 ? A ASP 455 74 1 Y 1 A ASP 352 ? A ASP 456 75 1 Y 1 A ASP 353 ? A ASP 457 76 1 Y 1 A ASP 354 ? A ASP 458 77 1 Y 1 A LYS 355 ? A LYS 459 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;1-(4-{[(2S,3R)-2-(2,3-dihydro-1H-inden-2-yloxy)-3-(3,5-dimethoxy-4-methylphenyl)-3-hydroxypropyl]oxy}phenyl)cyclopropanecarboxylic acid ; ON3 3 '(2S)-2,3-dihydroxypropyl (7Z)-tetradec-7-enoate' 1WV 4 water HOH #