data_4ZQA # _entry.id 4ZQA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4ZQA pdb_00004zqa 10.2210/pdb4zqa/pdb WWPDB D_1000209700 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-07-15 2 'Structure model' 1 1 2015-07-29 3 'Structure model' 1 2 2017-09-27 4 'Structure model' 1 3 2019-12-25 5 'Structure model' 1 4 2024-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' 6 3 'Structure model' 'Source and taxonomy' 7 4 'Structure model' 'Author supporting evidence' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' entity_src_gen 3 3 'Structure model' pdbx_audit_support 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' software 6 4 'Structure model' pdbx_audit_support 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 3 3 'Structure model' '_pdbx_audit_support.funding_organization' 4 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 5 3 'Structure model' '_software.classification' 6 4 'Structure model' '_pdbx_audit_support.funding_organization' 7 5 'Structure model' '_database_2.pdbx_DOI' 8 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4ZQA _pdbx_database_status.recvd_initial_deposition_date 2015-05-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chan, C.W.' 1 'Mondragon, A.' 2 'Clark, M.' 3 'Radhakrishnan, I.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 112 _citation.language ? _citation.page_first E3669 _citation.page_last E3678 _citation.title 'Structural insights into the assembly of the histone deacetylase-associated Sin3L/Rpd3L corepressor complex.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1504021112 _citation.pdbx_database_id_PubMed 26124119 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Clark, M.D.' 1 ? primary 'Marcum, R.' 2 ? primary 'Graveline, R.' 3 ? primary 'Chan, C.W.' 4 ? primary 'Xie, T.' 5 ? primary 'Chen, Z.' 6 ? primary 'Ding, Y.' 7 ? primary 'Zhang, Y.' 8 ? primary 'Mondragon, A.' 9 ? primary 'David, G.' 10 ? primary 'Radhakrishnan, I.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Sin3 histone deacetylase corepressor complex component SDS3' 10396.940 1 ? ? 'UNP residues 90-172' ? 2 water nat water 18.015 120 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Suppressor of defective silencing 3 protein homolog' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SNAGTLQEYQKRMKKLDQQYRERIRNAELFLQLETEQVERNYIKEKKAAVKEFEDKKVELKENLIAELEEKKKMIENEKL TMELTG ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAGTLQEYQKRMKKLDQQYRERIRNAELFLQLETEQVERNYIKEKKAAVKEFEDKKVELKENLIAELEEKKKMIENEKL TMELTG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 GLY n 1 5 THR n 1 6 LEU n 1 7 GLN n 1 8 GLU n 1 9 TYR n 1 10 GLN n 1 11 LYS n 1 12 ARG n 1 13 MET n 1 14 LYS n 1 15 LYS n 1 16 LEU n 1 17 ASP n 1 18 GLN n 1 19 GLN n 1 20 TYR n 1 21 ARG n 1 22 GLU n 1 23 ARG n 1 24 ILE n 1 25 ARG n 1 26 ASN n 1 27 ALA n 1 28 GLU n 1 29 LEU n 1 30 PHE n 1 31 LEU n 1 32 GLN n 1 33 LEU n 1 34 GLU n 1 35 THR n 1 36 GLU n 1 37 GLN n 1 38 VAL n 1 39 GLU n 1 40 ARG n 1 41 ASN n 1 42 TYR n 1 43 ILE n 1 44 LYS n 1 45 GLU n 1 46 LYS n 1 47 LYS n 1 48 ALA n 1 49 ALA n 1 50 VAL n 1 51 LYS n 1 52 GLU n 1 53 PHE n 1 54 GLU n 1 55 ASP n 1 56 LYS n 1 57 LYS n 1 58 VAL n 1 59 GLU n 1 60 LEU n 1 61 LYS n 1 62 GLU n 1 63 ASN n 1 64 LEU n 1 65 ILE n 1 66 ALA n 1 67 GLU n 1 68 LEU n 1 69 GLU n 1 70 GLU n 1 71 LYS n 1 72 LYS n 1 73 LYS n 1 74 MET n 1 75 ILE n 1 76 GLU n 1 77 ASN n 1 78 GLU n 1 79 LYS n 1 80 LEU n 1 81 THR n 1 82 MET n 1 83 GLU n 1 84 LEU n 1 85 THR n 1 86 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 86 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Suds3, Sds3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 2 2 SER SER A . n A 1 2 ASN 2 3 3 ASN ASN A . n A 1 3 ALA 3 4 4 ALA ALA A . n A 1 4 GLY 4 5 5 GLY GLY A . n A 1 5 THR 5 6 6 THR THR A . n A 1 6 LEU 6 7 7 LEU LEU A . n A 1 7 GLN 7 8 8 GLN GLN A . n A 1 8 GLU 8 9 9 GLU GLU A . n A 1 9 TYR 9 10 10 TYR TYR A . n A 1 10 GLN 10 11 11 GLN GLN A . n A 1 11 LYS 11 12 12 LYS LYS A . n A 1 12 ARG 12 13 13 ARG ARG A . n A 1 13 MET 13 14 14 MET MET A . n A 1 14 LYS 14 15 15 LYS LYS A . n A 1 15 LYS 15 16 16 LYS LYS A . n A 1 16 LEU 16 17 17 LEU LEU A . n A 1 17 ASP 17 18 18 ASP ASP A . n A 1 18 GLN 18 19 19 GLN GLN A . n A 1 19 GLN 19 20 20 GLN GLN A . n A 1 20 TYR 20 21 21 TYR TYR A . n A 1 21 ARG 21 22 22 ARG ARG A . n A 1 22 GLU 22 23 23 GLU GLU A . n A 1 23 ARG 23 24 24 ARG ARG A . n A 1 24 ILE 24 25 25 ILE ILE A . n A 1 25 ARG 25 26 26 ARG ARG A . n A 1 26 ASN 26 27 27 ASN ASN A . n A 1 27 ALA 27 28 28 ALA ALA A . n A 1 28 GLU 28 29 29 GLU GLU A . n A 1 29 LEU 29 30 30 LEU LEU A . n A 1 30 PHE 30 31 31 PHE PHE A . n A 1 31 LEU 31 32 32 LEU LEU A . n A 1 32 GLN 32 33 33 GLN GLN A . n A 1 33 LEU 33 34 34 LEU LEU A . n A 1 34 GLU 34 35 35 GLU GLU A . n A 1 35 THR 35 36 36 THR THR A . n A 1 36 GLU 36 37 37 GLU GLU A . n A 1 37 GLN 37 38 38 GLN GLN A . n A 1 38 VAL 38 39 39 VAL VAL A . n A 1 39 GLU 39 40 40 GLU GLU A . n A 1 40 ARG 40 41 41 ARG ARG A . n A 1 41 ASN 41 42 42 ASN ASN A . n A 1 42 TYR 42 43 43 TYR TYR A . n A 1 43 ILE 43 44 44 ILE ILE A . n A 1 44 LYS 44 45 45 LYS LYS A . n A 1 45 GLU 45 46 46 GLU GLU A . n A 1 46 LYS 46 47 47 LYS LYS A . n A 1 47 LYS 47 48 48 LYS LYS A . n A 1 48 ALA 48 49 49 ALA ALA A . n A 1 49 ALA 49 50 50 ALA ALA A . n A 1 50 VAL 50 51 51 VAL VAL A . n A 1 51 LYS 51 52 52 LYS LYS A . n A 1 52 GLU 52 53 53 GLU GLU A . n A 1 53 PHE 53 54 54 PHE PHE A . n A 1 54 GLU 54 55 55 GLU GLU A . n A 1 55 ASP 55 56 56 ASP ASP A . n A 1 56 LYS 56 57 57 LYS LYS A . n A 1 57 LYS 57 58 58 LYS LYS A . n A 1 58 VAL 58 59 59 VAL VAL A . n A 1 59 GLU 59 60 60 GLU GLU A . n A 1 60 LEU 60 61 61 LEU LEU A . n A 1 61 LYS 61 62 62 LYS LYS A . n A 1 62 GLU 62 63 63 GLU GLU A . n A 1 63 ASN 63 64 64 ASN ASN A . n A 1 64 LEU 64 65 65 LEU LEU A . n A 1 65 ILE 65 66 66 ILE ILE A . n A 1 66 ALA 66 67 67 ALA ALA A . n A 1 67 GLU 67 68 68 GLU GLU A . n A 1 68 LEU 68 69 69 LEU LEU A . n A 1 69 GLU 69 70 70 GLU GLU A . n A 1 70 GLU 70 71 71 GLU GLU A . n A 1 71 LYS 71 72 72 LYS LYS A . n A 1 72 LYS 72 73 73 LYS LYS A . n A 1 73 LYS 73 74 74 LYS LYS A . n A 1 74 MET 74 75 75 MET MET A . n A 1 75 ILE 75 76 76 ILE ILE A . n A 1 76 GLU 76 77 77 GLU GLU A . n A 1 77 ASN 77 78 78 ASN ASN A . n A 1 78 GLU 78 79 79 GLU GLU A . n A 1 79 LYS 79 80 80 LYS LYS A . n A 1 80 LEU 80 81 81 LEU LEU A . n A 1 81 THR 81 82 82 THR THR A . n A 1 82 MET 82 83 83 MET MET A . n A 1 83 GLU 83 84 84 GLU GLU A . n A 1 84 LEU 84 85 85 LEU LEU A . n A 1 85 THR 85 86 86 THR THR A . n A 1 86 GLY 86 87 87 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 101 49 HOH HOH A . B 2 HOH 2 102 89 HOH HOH A . B 2 HOH 3 103 112 HOH HOH A . B 2 HOH 4 104 62 HOH HOH A . B 2 HOH 5 105 66 HOH HOH A . B 2 HOH 6 106 40 HOH HOH A . B 2 HOH 7 107 8 HOH HOH A . B 2 HOH 8 108 38 HOH HOH A . B 2 HOH 9 109 94 HOH HOH A . B 2 HOH 10 110 68 HOH HOH A . B 2 HOH 11 111 46 HOH HOH A . B 2 HOH 12 112 14 HOH HOH A . B 2 HOH 13 113 64 HOH HOH A . B 2 HOH 14 114 88 HOH HOH A . B 2 HOH 15 115 98 HOH HOH A . B 2 HOH 16 116 15 HOH HOH A . B 2 HOH 17 117 101 HOH HOH A . B 2 HOH 18 118 78 HOH HOH A . B 2 HOH 19 119 17 HOH HOH A . B 2 HOH 20 120 75 HOH HOH A . B 2 HOH 21 121 26 HOH HOH A . B 2 HOH 22 122 86 HOH HOH A . B 2 HOH 23 123 63 HOH HOH A . B 2 HOH 24 124 11 HOH HOH A . B 2 HOH 25 125 74 HOH HOH A . B 2 HOH 26 126 25 HOH HOH A . B 2 HOH 27 127 36 HOH HOH A . B 2 HOH 28 128 110 HOH HOH A . B 2 HOH 29 129 114 HOH HOH A . B 2 HOH 30 130 90 HOH HOH A . B 2 HOH 31 131 4 HOH HOH A . B 2 HOH 32 132 45 HOH HOH A . B 2 HOH 33 133 42 HOH HOH A . B 2 HOH 34 134 2 HOH HOH A . B 2 HOH 35 135 6 HOH HOH A . B 2 HOH 36 136 118 HOH HOH A . B 2 HOH 37 137 97 HOH HOH A . B 2 HOH 38 138 41 HOH HOH A . B 2 HOH 39 139 107 HOH HOH A . B 2 HOH 40 140 31 HOH HOH A . B 2 HOH 41 141 59 HOH HOH A . B 2 HOH 42 142 56 HOH HOH A . B 2 HOH 43 143 92 HOH HOH A . B 2 HOH 44 144 9 HOH HOH A . B 2 HOH 45 145 7 HOH HOH A . B 2 HOH 46 146 83 HOH HOH A . B 2 HOH 47 147 5 HOH HOH A . B 2 HOH 48 148 1 HOH HOH A . B 2 HOH 49 149 13 HOH HOH A . B 2 HOH 50 150 115 HOH HOH A . B 2 HOH 51 151 12 HOH HOH A . B 2 HOH 52 152 51 HOH HOH A . B 2 HOH 53 153 10 HOH HOH A . B 2 HOH 54 154 34 HOH HOH A . B 2 HOH 55 155 3 HOH HOH A . B 2 HOH 56 156 65 HOH HOH A . B 2 HOH 57 157 28 HOH HOH A . B 2 HOH 58 158 108 HOH HOH A . B 2 HOH 59 159 79 HOH HOH A . B 2 HOH 60 160 77 HOH HOH A . B 2 HOH 61 161 16 HOH HOH A . B 2 HOH 62 162 43 HOH HOH A . B 2 HOH 63 163 116 HOH HOH A . B 2 HOH 64 164 22 HOH HOH A . B 2 HOH 65 165 85 HOH HOH A . B 2 HOH 66 166 104 HOH HOH A . B 2 HOH 67 167 102 HOH HOH A . B 2 HOH 68 168 119 HOH HOH A . B 2 HOH 69 169 50 HOH HOH A . B 2 HOH 70 170 81 HOH HOH A . B 2 HOH 71 171 111 HOH HOH A . B 2 HOH 72 172 37 HOH HOH A . B 2 HOH 73 173 67 HOH HOH A . B 2 HOH 74 174 20 HOH HOH A . B 2 HOH 75 175 52 HOH HOH A . B 2 HOH 76 176 32 HOH HOH A . B 2 HOH 77 177 80 HOH HOH A . B 2 HOH 78 178 53 HOH HOH A . B 2 HOH 79 179 61 HOH HOH A . B 2 HOH 80 180 33 HOH HOH A . B 2 HOH 81 181 106 HOH HOH A . B 2 HOH 82 182 105 HOH HOH A . B 2 HOH 83 183 84 HOH HOH A . B 2 HOH 84 184 96 HOH HOH A . B 2 HOH 85 185 30 HOH HOH A . B 2 HOH 86 186 54 HOH HOH A . B 2 HOH 87 187 91 HOH HOH A . B 2 HOH 88 188 109 HOH HOH A . B 2 HOH 89 189 71 HOH HOH A . B 2 HOH 90 190 44 HOH HOH A . B 2 HOH 91 191 24 HOH HOH A . B 2 HOH 92 192 19 HOH HOH A . B 2 HOH 93 193 82 HOH HOH A . B 2 HOH 94 194 47 HOH HOH A . B 2 HOH 95 195 99 HOH HOH A . B 2 HOH 96 196 60 HOH HOH A . B 2 HOH 97 197 29 HOH HOH A . B 2 HOH 98 198 69 HOH HOH A . B 2 HOH 99 199 100 HOH HOH A . B 2 HOH 100 200 23 HOH HOH A . B 2 HOH 101 201 72 HOH HOH A . B 2 HOH 102 202 76 HOH HOH A . B 2 HOH 103 203 35 HOH HOH A . B 2 HOH 104 204 113 HOH HOH A . B 2 HOH 105 205 39 HOH HOH A . B 2 HOH 106 206 57 HOH HOH A . B 2 HOH 107 207 70 HOH HOH A . B 2 HOH 108 208 93 HOH HOH A . B 2 HOH 109 209 117 HOH HOH A . B 2 HOH 110 210 55 HOH HOH A . B 2 HOH 111 211 27 HOH HOH A . B 2 HOH 112 212 103 HOH HOH A . B 2 HOH 113 213 58 HOH HOH A . B 2 HOH 114 214 21 HOH HOH A . B 2 HOH 115 215 73 HOH HOH A . B 2 HOH 116 216 120 HOH HOH A . B 2 HOH 117 217 48 HOH HOH A . B 2 HOH 118 218 87 HOH HOH A . B 2 HOH 119 219 18 HOH HOH A . B 2 HOH 120 220 95 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0073 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHARP ? ? ? . 4 # _cell.entry_id 4ZQA _cell.length_a 44.460 _cell.length_b 49.390 _cell.length_c 106.510 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4ZQA _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4ZQA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.81 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.26 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 287 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '15% ethanol (v/v), 200 mM MgCl2, and 100 mM imidazole' _exptl_crystal_grow.pdbx_pH_range 7.2-7.8 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-06-09 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97856 1.0 2 0.97872 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-G' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list '0.97856, 0.97872' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-G _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4ZQA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.65 _reflns.d_resolution_low 35.5 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13534 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.9 _reflns.pdbx_Rmerge_I_obs 0.045 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.Rmerge_I_obs 0.246 _reflns_shell.d_res_high 1.65 _reflns_shell.d_res_low 1.68 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_sigI_obs 2.8 _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_gt ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all 667 _reflns_shell.number_unique_gt ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_redundancy 3.8 _reflns_shell.pdbx_rejects ? _reflns_shell.percent_possible_all 96.5 _reflns_shell.percent_possible_gt ? _reflns_shell.percent_possible_obs ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4ZQA _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 12803 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 33.00 _refine.ls_d_res_high 1.65 _refine.ls_percent_reflns_obs 93.07 _refine.ls_R_factor_obs 0.16257 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.15998 _refine.ls_R_factor_R_free 0.20896 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 685 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.972 _refine.correlation_coeff_Fo_to_Fc_free 0.956 _refine.B_iso_mean 37.075 _refine.aniso_B[1][1] 1.22 _refine.aniso_B[2][2] 2.57 _refine.aniso_B[3][3] -3.79 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SIRAS _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.114 _refine.pdbx_overall_ESU_R_Free 0.093 _refine.overall_SU_ML 0.076 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 5.328 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 726 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 120 _refine_hist.number_atoms_total 846 _refine_hist.d_res_high 1.65 _refine_hist.d_res_low 33.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.013 0.019 ? 753 'X-RAY DIFFRACTION' ? r_bond_other_d 0.001 0.020 ? 775 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.307 2.001 ? 1001 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.781 3.000 ? 1799 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 4.509 5.000 ? 91 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 35.661 25.952 ? 42 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 13.954 15.000 ? 183 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 15.809 15.000 ? 6 'X-RAY DIFFRACTION' ? r_chiral_restr 0.063 0.200 ? 108 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.005 0.020 ? 830 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 156 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 2.422 1.705 ? 349 'X-RAY DIFFRACTION' ? r_mcbond_other 2.280 1.692 ? 348 'X-RAY DIFFRACTION' ? r_mcangle_it 3.199 2.551 ? 436 'X-RAY DIFFRACTION' ? r_mcangle_other 3.211 2.554 ? 437 'X-RAY DIFFRACTION' ? r_scbond_it 4.801 2.351 ? 404 'X-RAY DIFFRACTION' ? r_scbond_other 4.797 2.353 ? 405 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other 5.713 3.261 ? 563 'X-RAY DIFFRACTION' ? r_long_range_B_refined 5.981 16.641 ? 977 'X-RAY DIFFRACTION' ? r_long_range_B_other 5.418 14.639 ? 910 'X-RAY DIFFRACTION' ? r_rigid_bond_restr 2.956 3.000 ? 1528 'X-RAY DIFFRACTION' ? r_sphericity_free 39.751 5.000 ? 33 'X-RAY DIFFRACTION' ? r_sphericity_bonded 15.064 5.000 ? 1608 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.650 _refine_ls_shell.d_res_low 1.693 _refine_ls_shell.number_reflns_R_work 950 _refine_ls_shell.R_factor_R_work 0.238 _refine_ls_shell.percent_reflns_obs 95.49 _refine_ls_shell.R_factor_R_free 0.293 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 46 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 4ZQA _struct.title 'Crystal Structure of the Sds3 Dimerization Domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4ZQA _struct_keywords.text 'transcription repression, histone deacetylase complex, coiled-coil, corepressor complex, TRANSCRIPTION REPRESSOR' _struct_keywords.pdbx_keywords 'TRANSCRIPTION REPRESSOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.db_code SDS3_MOUSE _struct_ref.db_name UNP _struct_ref.details ? _struct_ref.entity_id 1 _struct_ref.id 1 _struct_ref.seq_align ? _struct_ref.seq_dif ? _struct_ref.pdbx_db_accession Q8BR65 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ;GTLQEYQKRMKKLDQQYRERIRNAELFLQLETEQVERNYIKEKKAAVKEFEDKKVELKENLIAELEEKKKMIENEKLTME LTG ; _struct_ref.pdbx_align_begin 90 _struct_ref.pdbx_align_end ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4ZQA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 86 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8BR65 _struct_ref_seq.db_align_beg 90 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 172 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 87 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4ZQA SER A 1 ? UNP Q8BR65 ? ? 'expression tag' 2 1 1 4ZQA ASN A 2 ? UNP Q8BR65 ? ? 'expression tag' 3 2 1 4ZQA ALA A 3 ? UNP Q8BR65 ? ? 'expression tag' 4 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3590 ? 1 MORE -30 ? 1 'SSA (A^2)' 13930 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_554 -x,y,-z-1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -53.2550000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 2 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id THR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 85 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 3 _struct_conf.end_auth_comp_id THR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 86 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 84 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 22 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 A _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 101 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.18 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 136 ? ? 1_555 O A HOH 209 ? ? 3_554 1.24 2 1 O A HOH 119 ? ? 1_555 O A HOH 207 ? ? 3_554 2.10 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -5.1788 -9.3765 -72.6208 0.1259 0.1781 0.1598 0.0105 0.0368 0.0030 18.2776 10.9989 37.6322 2.6812 6.9872 2.5758 0.1062 0.7876 -0.1521 -0.4999 0.0580 -0.1572 -0.1699 0.8248 -0.1642 'X-RAY DIFFRACTION' 2 ? refined -0.4023 -12.7338 -48.6122 0.0614 0.1246 0.1347 -0.0094 -0.0007 -0.0053 2.6264 0.5822 11.2683 -0.5242 4.4039 -0.9311 0.0749 0.1939 -0.0500 -0.0639 -0.0306 0.0398 0.1822 0.2387 -0.0443 'X-RAY DIFFRACTION' 3 ? refined 9.6032 -9.2313 -6.8288 0.0809 0.1120 0.1381 -0.0026 0.0050 0.0060 1.3287 0.4513 14.4930 0.3977 3.5320 1.8238 0.0076 0.0992 -0.0234 -0.0844 0.0893 -0.0477 -0.2403 0.2292 -0.0969 'X-RAY DIFFRACTION' 4 ? refined 11.2569 2.5077 29.6652 0.2035 0.1474 0.1792 0.0046 -0.0028 -0.0019 1.6005 9.8046 23.9263 -3.8160 -6.0053 15.3078 -0.1631 0.0261 -0.0974 0.2502 0.0457 0.0763 0.4383 0.0500 0.1174 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 2 ? ? A 9 ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 10 ? ? A 36 ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 37 ? ? A 67 ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 68 ? ? A 87 ? ? ? ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HOH O O N N 123 HOH H1 H N N 124 HOH H2 H N N 125 ILE N N N N 126 ILE CA C N S 127 ILE C C N N 128 ILE O O N N 129 ILE CB C N S 130 ILE CG1 C N N 131 ILE CG2 C N N 132 ILE CD1 C N N 133 ILE OXT O N N 134 ILE H H N N 135 ILE H2 H N N 136 ILE HA H N N 137 ILE HB H N N 138 ILE HG12 H N N 139 ILE HG13 H N N 140 ILE HG21 H N N 141 ILE HG22 H N N 142 ILE HG23 H N N 143 ILE HD11 H N N 144 ILE HD12 H N N 145 ILE HD13 H N N 146 ILE HXT H N N 147 LEU N N N N 148 LEU CA C N S 149 LEU C C N N 150 LEU O O N N 151 LEU CB C N N 152 LEU CG C N N 153 LEU CD1 C N N 154 LEU CD2 C N N 155 LEU OXT O N N 156 LEU H H N N 157 LEU H2 H N N 158 LEU HA H N N 159 LEU HB2 H N N 160 LEU HB3 H N N 161 LEU HG H N N 162 LEU HD11 H N N 163 LEU HD12 H N N 164 LEU HD13 H N N 165 LEU HD21 H N N 166 LEU HD22 H N N 167 LEU HD23 H N N 168 LEU HXT H N N 169 LYS N N N N 170 LYS CA C N S 171 LYS C C N N 172 LYS O O N N 173 LYS CB C N N 174 LYS CG C N N 175 LYS CD C N N 176 LYS CE C N N 177 LYS NZ N N N 178 LYS OXT O N N 179 LYS H H N N 180 LYS H2 H N N 181 LYS HA H N N 182 LYS HB2 H N N 183 LYS HB3 H N N 184 LYS HG2 H N N 185 LYS HG3 H N N 186 LYS HD2 H N N 187 LYS HD3 H N N 188 LYS HE2 H N N 189 LYS HE3 H N N 190 LYS HZ1 H N N 191 LYS HZ2 H N N 192 LYS HZ3 H N N 193 LYS HXT H N N 194 MET N N N N 195 MET CA C N S 196 MET C C N N 197 MET O O N N 198 MET CB C N N 199 MET CG C N N 200 MET SD S N N 201 MET CE C N N 202 MET OXT O N N 203 MET H H N N 204 MET H2 H N N 205 MET HA H N N 206 MET HB2 H N N 207 MET HB3 H N N 208 MET HG2 H N N 209 MET HG3 H N N 210 MET HE1 H N N 211 MET HE2 H N N 212 MET HE3 H N N 213 MET HXT H N N 214 PHE N N N N 215 PHE CA C N S 216 PHE C C N N 217 PHE O O N N 218 PHE CB C N N 219 PHE CG C Y N 220 PHE CD1 C Y N 221 PHE CD2 C Y N 222 PHE CE1 C Y N 223 PHE CE2 C Y N 224 PHE CZ C Y N 225 PHE OXT O N N 226 PHE H H N N 227 PHE H2 H N N 228 PHE HA H N N 229 PHE HB2 H N N 230 PHE HB3 H N N 231 PHE HD1 H N N 232 PHE HD2 H N N 233 PHE HE1 H N N 234 PHE HE2 H N N 235 PHE HZ H N N 236 PHE HXT H N N 237 SER N N N N 238 SER CA C N S 239 SER C C N N 240 SER O O N N 241 SER CB C N N 242 SER OG O N N 243 SER OXT O N N 244 SER H H N N 245 SER H2 H N N 246 SER HA H N N 247 SER HB2 H N N 248 SER HB3 H N N 249 SER HG H N N 250 SER HXT H N N 251 THR N N N N 252 THR CA C N S 253 THR C C N N 254 THR O O N N 255 THR CB C N R 256 THR OG1 O N N 257 THR CG2 C N N 258 THR OXT O N N 259 THR H H N N 260 THR H2 H N N 261 THR HA H N N 262 THR HB H N N 263 THR HG1 H N N 264 THR HG21 H N N 265 THR HG22 H N N 266 THR HG23 H N N 267 THR HXT H N N 268 TYR N N N N 269 TYR CA C N S 270 TYR C C N N 271 TYR O O N N 272 TYR CB C N N 273 TYR CG C Y N 274 TYR CD1 C Y N 275 TYR CD2 C Y N 276 TYR CE1 C Y N 277 TYR CE2 C Y N 278 TYR CZ C Y N 279 TYR OH O N N 280 TYR OXT O N N 281 TYR H H N N 282 TYR H2 H N N 283 TYR HA H N N 284 TYR HB2 H N N 285 TYR HB3 H N N 286 TYR HD1 H N N 287 TYR HD2 H N N 288 TYR HE1 H N N 289 TYR HE2 H N N 290 TYR HH H N N 291 TYR HXT H N N 292 VAL N N N N 293 VAL CA C N S 294 VAL C C N N 295 VAL O O N N 296 VAL CB C N N 297 VAL CG1 C N N 298 VAL CG2 C N N 299 VAL OXT O N N 300 VAL H H N N 301 VAL H2 H N N 302 VAL HA H N N 303 VAL HB H N N 304 VAL HG11 H N N 305 VAL HG12 H N N 306 VAL HG13 H N N 307 VAL HG21 H N N 308 VAL HG22 H N N 309 VAL HG23 H N N 310 VAL HXT H N N 311 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HOH O H1 sing N N 116 HOH O H2 sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 MET N CA sing N N 184 MET N H sing N N 185 MET N H2 sing N N 186 MET CA C sing N N 187 MET CA CB sing N N 188 MET CA HA sing N N 189 MET C O doub N N 190 MET C OXT sing N N 191 MET CB CG sing N N 192 MET CB HB2 sing N N 193 MET CB HB3 sing N N 194 MET CG SD sing N N 195 MET CG HG2 sing N N 196 MET CG HG3 sing N N 197 MET SD CE sing N N 198 MET CE HE1 sing N N 199 MET CE HE2 sing N N 200 MET CE HE3 sing N N 201 MET OXT HXT sing N N 202 PHE N CA sing N N 203 PHE N H sing N N 204 PHE N H2 sing N N 205 PHE CA C sing N N 206 PHE CA CB sing N N 207 PHE CA HA sing N N 208 PHE C O doub N N 209 PHE C OXT sing N N 210 PHE CB CG sing N N 211 PHE CB HB2 sing N N 212 PHE CB HB3 sing N N 213 PHE CG CD1 doub Y N 214 PHE CG CD2 sing Y N 215 PHE CD1 CE1 sing Y N 216 PHE CD1 HD1 sing N N 217 PHE CD2 CE2 doub Y N 218 PHE CD2 HD2 sing N N 219 PHE CE1 CZ doub Y N 220 PHE CE1 HE1 sing N N 221 PHE CE2 CZ sing Y N 222 PHE CE2 HE2 sing N N 223 PHE CZ HZ sing N N 224 PHE OXT HXT sing N N 225 SER N CA sing N N 226 SER N H sing N N 227 SER N H2 sing N N 228 SER CA C sing N N 229 SER CA CB sing N N 230 SER CA HA sing N N 231 SER C O doub N N 232 SER C OXT sing N N 233 SER CB OG sing N N 234 SER CB HB2 sing N N 235 SER CB HB3 sing N N 236 SER OG HG sing N N 237 SER OXT HXT sing N N 238 THR N CA sing N N 239 THR N H sing N N 240 THR N H2 sing N N 241 THR CA C sing N N 242 THR CA CB sing N N 243 THR CA HA sing N N 244 THR C O doub N N 245 THR C OXT sing N N 246 THR CB OG1 sing N N 247 THR CB CG2 sing N N 248 THR CB HB sing N N 249 THR OG1 HG1 sing N N 250 THR CG2 HG21 sing N N 251 THR CG2 HG22 sing N N 252 THR CG2 HG23 sing N N 253 THR OXT HXT sing N N 254 TYR N CA sing N N 255 TYR N H sing N N 256 TYR N H2 sing N N 257 TYR CA C sing N N 258 TYR CA CB sing N N 259 TYR CA HA sing N N 260 TYR C O doub N N 261 TYR C OXT sing N N 262 TYR CB CG sing N N 263 TYR CB HB2 sing N N 264 TYR CB HB3 sing N N 265 TYR CG CD1 doub Y N 266 TYR CG CD2 sing Y N 267 TYR CD1 CE1 sing Y N 268 TYR CD1 HD1 sing N N 269 TYR CD2 CE2 doub Y N 270 TYR CD2 HD2 sing N N 271 TYR CE1 CZ doub Y N 272 TYR CE1 HE1 sing N N 273 TYR CE2 CZ sing Y N 274 TYR CE2 HE2 sing N N 275 TYR CZ OH sing N N 276 TYR OH HH sing N N 277 TYR OXT HXT sing N N 278 VAL N CA sing N N 279 VAL N H sing N N 280 VAL N H2 sing N N 281 VAL CA C sing N N 282 VAL CA CB sing N N 283 VAL CA HA sing N N 284 VAL C O doub N N 285 VAL C OXT sing N N 286 VAL CB CG1 sing N N 287 VAL CB CG2 sing N N 288 VAL CB HB sing N N 289 VAL CG1 HG11 sing N N 290 VAL CG1 HG12 sing N N 291 VAL CG1 HG13 sing N N 292 VAL CG2 HG21 sing N N 293 VAL CG2 HG22 sing N N 294 VAL CG2 HG23 sing N N 295 VAL OXT HXT sing N N 296 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM64715 1 'American Heart Association' 'United States' 14GRNT20170003 2 # _atom_sites.entry_id 4ZQA _atom_sites.fract_transf_matrix[1][1] 0.022492 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020247 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009389 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_