data_4A4X # _entry.id 4A4X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4A4X PDBE EBI-50041 WWPDB D_1290050041 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2XKC unspecified 'STRUCTURE OF NEK2 BOUND TO AMINOPYRAZINE COMPOUND 14' PDB 2W5B unspecified 'HUMAN NEK2 KINASE ATPGAMMAS-BOUND' PDB 2XNP unspecified 'STRUCTURE OF NEK2 BOUND TO CCT244858' PDB 2WQO unspecified 'STRUCTURE OF NEK2 BOUND TO THE AMINOPYRIDINE CCT241950' PDB 2JAV unspecified 'HUMAN KINASE WITH PYRROLE-INDOLINONE LIGAND' PDB 2XKE unspecified 'STRUCTURE OF NEK2 BOUND TO AMINIPYRAZINE COMPOUND 5' PDB 2XKD unspecified 'STRUCTURE OF NEK2 BOUND TO AMINOPYRAZINE COMPOUND 12' PDB 2W5H unspecified 'HUMAN NEK2 KINASE APO' PDB 2XK7 unspecified 'STRUCTURE OF NEK2 BOUND TO AMINOPYRAZINE COMPOUND 23' PDB 2XKF unspecified 'STRUCTURE OF NEK2 BOUND TO AMINOPYRAZINE COMPOUND 2' PDB 2XK8 unspecified 'STRUCTURE OF NEK2 BOUND TO AMINOPYRAZINE COMPOUND 15' PDB 2XNO unspecified 'STRUCTURE OF NEK2 BOUND TO CCT243779' PDB 2XK6 unspecified 'STRUCTURE OF NEK2 BOUND TO AMINOPYRAZINE COMPOUND 36' PDB 2XNN unspecified 'STRUCTURE OF NEK2 BOUND TO CCT242430' PDB 2XK4 unspecified 'STRUCTURE OF NEK2 BOUND TO AMINOPYRAZINE COMPOUND 17' PDB 2XK3 unspecified 'STRUCTURE OF NEK2 BOUND TO AMINOPYRAZINE COMPOUND 35' PDB 2XNM unspecified 'STRUCTURE OF NEK2 BOUND TO CCT' PDB 2W5A unspecified 'HUMAN NEK2 KINASE ADP-BOUND' PDB 4AFE unspecified 'NEK2 BOUND TO HYBRID COMPOUND 21' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4A4X _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2011-10-20 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mas-Droux, C.' 1 'Bayliss, R.' 2 # _citation.id primary _citation.title ;Design of Potent and Selective Hybrid Inhibitors of the Mitotic Kinase Nek2: Structure-Activity Relationship, Structural Biology, and Cellular Activity. ; _citation.journal_abbrev J.Med.Chem. _citation.journal_volume 55 _citation.page_first 3228 _citation.page_last ? _citation.year 2012 _citation.journal_id_ASTM JMCMAR _citation.country US _citation.journal_id_ISSN 0022-2623 _citation.journal_id_CSD 0151 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22404346 _citation.pdbx_database_id_DOI 10.1021/JM201683B # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Innocenti, P.' 1 primary 'Cheung, K.M.' 2 primary 'Solanki, S.' 3 primary 'Mas-Droux, C.' 4 primary 'Rowan, F.' 5 primary 'Yeoh, S.' 6 primary 'Boxall, K.' 7 primary 'Westlake, M.' 8 primary 'Pickard, L.' 9 primary 'Hardy, T.' 10 primary 'Baxter, J.E.' 11 primary 'Aherne, G.W.' 12 primary 'Bayliss, R.' 13 primary 'Fry, A.M.' 14 primary 'Hoelder, S.' 15 # _cell.entry_id 4A4X _cell.length_a 101.223 _cell.length_b 56.909 _cell.length_c 74.408 _cell.angle_alpha 90.00 _cell.angle_beta 127.12 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4A4X _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SERINE/THREONINE-PROTEIN KINASE NEK2' 32746.506 1 2.7.11.1 YES 'CATALYTIC DOMAIN, RESIDUES 1- 271' ? 2 non-polymer syn '4-(2-AMINO-5-{4-[(DIMETHYLAMINO)METHYL]THIOPHEN-2-YL}PYRIDIN-3-YL)-2-{(1R)-1-[2-(TRIFLUOROMETHYL)PHENYL]ETHOXY}BENZAMIDE' 540.600 1 ? ? ? ? 3 water nat water 18.015 68 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HSPK 21, NEVER IN MITOSIS A-RELATED KINASE 2, NIMA-RELATED PROTEIN KINASE 2, NIMA-LIKE PROTEIN KINASE 1, NEK2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT TLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDF GLARILNHDEDFAKEFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY SDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT TLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDF GLARILNHDEDFAKEFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY SDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 SER n 1 4 ARG n 1 5 ALA n 1 6 GLU n 1 7 ASP n 1 8 TYR n 1 9 GLU n 1 10 VAL n 1 11 LEU n 1 12 TYR n 1 13 THR n 1 14 ILE n 1 15 GLY n 1 16 THR n 1 17 GLY n 1 18 SER n 1 19 TYR n 1 20 GLY n 1 21 ARG n 1 22 CYS n 1 23 GLN n 1 24 LYS n 1 25 ILE n 1 26 ARG n 1 27 ARG n 1 28 LYS n 1 29 SER n 1 30 ASP n 1 31 GLY n 1 32 LYS n 1 33 ILE n 1 34 LEU n 1 35 VAL n 1 36 TRP n 1 37 LYS n 1 38 GLU n 1 39 LEU n 1 40 ASP n 1 41 TYR n 1 42 GLY n 1 43 SER n 1 44 MET n 1 45 THR n 1 46 GLU n 1 47 ALA n 1 48 GLU n 1 49 LYS n 1 50 GLN n 1 51 MET n 1 52 LEU n 1 53 VAL n 1 54 SER n 1 55 GLU n 1 56 VAL n 1 57 ASN n 1 58 LEU n 1 59 LEU n 1 60 ARG n 1 61 GLU n 1 62 LEU n 1 63 LYS n 1 64 HIS n 1 65 PRO n 1 66 ASN n 1 67 ILE n 1 68 VAL n 1 69 ARG n 1 70 TYR n 1 71 TYR n 1 72 ASP n 1 73 ARG n 1 74 ILE n 1 75 ILE n 1 76 ASP n 1 77 ARG n 1 78 THR n 1 79 ASN n 1 80 THR n 1 81 THR n 1 82 LEU n 1 83 TYR n 1 84 ILE n 1 85 VAL n 1 86 MET n 1 87 GLU n 1 88 TYR n 1 89 CYS n 1 90 GLU n 1 91 GLY n 1 92 GLY n 1 93 ASP n 1 94 LEU n 1 95 ALA n 1 96 SER n 1 97 VAL n 1 98 ILE n 1 99 THR n 1 100 LYS n 1 101 GLY n 1 102 THR n 1 103 LYS n 1 104 GLU n 1 105 ARG n 1 106 GLN n 1 107 TYR n 1 108 LEU n 1 109 ASP n 1 110 GLU n 1 111 GLU n 1 112 PHE n 1 113 VAL n 1 114 LEU n 1 115 ARG n 1 116 VAL n 1 117 MET n 1 118 THR n 1 119 GLN n 1 120 LEU n 1 121 THR n 1 122 LEU n 1 123 ALA n 1 124 LEU n 1 125 LYS n 1 126 GLU n 1 127 CYS n 1 128 HIS n 1 129 ARG n 1 130 ARG n 1 131 SER n 1 132 ASP n 1 133 GLY n 1 134 GLY n 1 135 HIS n 1 136 THR n 1 137 VAL n 1 138 LEU n 1 139 HIS n 1 140 ARG n 1 141 ASP n 1 142 LEU n 1 143 LYS n 1 144 PRO n 1 145 ALA n 1 146 ASN n 1 147 VAL n 1 148 PHE n 1 149 LEU n 1 150 ASP n 1 151 GLY n 1 152 LYS n 1 153 GLN n 1 154 ASN n 1 155 VAL n 1 156 LYS n 1 157 LEU n 1 158 GLY n 1 159 ASP n 1 160 PHE n 1 161 GLY n 1 162 LEU n 1 163 ALA n 1 164 ARG n 1 165 ILE n 1 166 LEU n 1 167 ASN n 1 168 HIS n 1 169 ASP n 1 170 GLU n 1 171 ASP n 1 172 PHE n 1 173 ALA n 1 174 LYS n 1 175 GLU n 1 176 PHE n 1 177 VAL n 1 178 GLY n 1 179 THR n 1 180 PRO n 1 181 TYR n 1 182 TYR n 1 183 MET n 1 184 SER n 1 185 PRO n 1 186 GLU n 1 187 GLN n 1 188 MET n 1 189 ASN n 1 190 ARG n 1 191 MET n 1 192 SER n 1 193 TYR n 1 194 ASN n 1 195 GLU n 1 196 LYS n 1 197 SER n 1 198 ASP n 1 199 ILE n 1 200 TRP n 1 201 SER n 1 202 LEU n 1 203 GLY n 1 204 CYS n 1 205 LEU n 1 206 LEU n 1 207 TYR n 1 208 GLU n 1 209 LEU n 1 210 CYS n 1 211 ALA n 1 212 LEU n 1 213 MET n 1 214 PRO n 1 215 PRO n 1 216 PHE n 1 217 THR n 1 218 ALA n 1 219 PHE n 1 220 SER n 1 221 GLN n 1 222 LYS n 1 223 GLU n 1 224 LEU n 1 225 ALA n 1 226 GLY n 1 227 LYS n 1 228 ILE n 1 229 ARG n 1 230 GLU n 1 231 GLY n 1 232 LYS n 1 233 PHE n 1 234 ARG n 1 235 ARG n 1 236 ILE n 1 237 PRO n 1 238 TYR n 1 239 ARG n 1 240 TYR n 1 241 SER n 1 242 ASP n 1 243 GLU n 1 244 LEU n 1 245 ASN n 1 246 GLU n 1 247 ILE n 1 248 ILE n 1 249 THR n 1 250 ARG n 1 251 MET n 1 252 LEU n 1 253 ASN n 1 254 LEU n 1 255 LYS n 1 256 ASP n 1 257 TYR n 1 258 HIS n 1 259 ARG n 1 260 PRO n 1 261 SER n 1 262 VAL n 1 263 GLU n 1 264 GLU n 1 265 ILE n 1 266 LEU n 1 267 GLU n 1 268 ASN n 1 269 PRO n 1 270 LEU n 1 271 ILE n 1 272 LEU n 1 273 GLU n 1 274 HIS n 1 275 HIS n 1 276 HIS n 1 277 HIS n 1 278 HIS n 1 279 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant 'CODONPLUS RPIL' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NEK2_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P51955 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4A4X _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 271 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P51955 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 271 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 271 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4A4X LEU A 272 ? UNP P51955 ? ? 'expression tag' 272 1 1 4A4X GLU A 273 ? UNP P51955 ? ? 'expression tag' 273 2 1 4A4X HIS A 274 ? UNP P51955 ? ? 'expression tag' 274 3 1 4A4X HIS A 275 ? UNP P51955 ? ? 'expression tag' 275 4 1 4A4X HIS A 276 ? UNP P51955 ? ? 'expression tag' 276 5 1 4A4X HIS A 277 ? UNP P51955 ? ? 'expression tag' 277 6 1 4A4X HIS A 278 ? UNP P51955 ? ? 'expression tag' 278 7 1 4A4X HIS A 279 ? UNP P51955 ? ? 'expression tag' 279 8 1 4A4X GLU A 170 ? UNP P51955 THR 170 'engineered mutation' 170 9 1 4A4X ASP A 171 ? UNP P51955 SER 171 'engineered mutation' 171 10 1 4A4X GLU A 175 ? UNP P51955 THR 175 'engineered mutation' 175 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 JUP non-polymer . '4-(2-AMINO-5-{4-[(DIMETHYLAMINO)METHYL]THIOPHEN-2-YL}PYRIDIN-3-YL)-2-{(1R)-1-[2-(TRIFLUOROMETHYL)PHENYL]ETHOXY}BENZAMIDE' ? 'C28 H27 F3 N4 O2 S' 540.600 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4A4X _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.88 _exptl_crystal.density_percent_sol 57.29 _exptl_crystal.description NONE # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97914 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_wavelength 0.97914 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4A4X _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.38 _reflns.d_resolution_high 2.40 _reflns.number_obs 13251 _reflns.number_all ? _reflns.percent_possible_obs 99.4 _reflns.pdbx_Rmerge_I_obs 0.11 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 7.50 _reflns.B_iso_Wilson_estimate 29.50 _reflns.pdbx_redundancy 3.4 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4A4X _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 13251 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50.379 _refine.ls_d_res_high 2.400 _refine.ls_percent_reflns_obs 99.23 _refine.ls_R_factor_obs 0.2065 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2042 _refine.ls_R_factor_R_free 0.2469 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 665 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 37.85 _refine.aniso_B[1][1] 0.7290 _refine.aniso_B[2][2] -6.8889 _refine.aniso_B[3][3] 6.1598 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 16.3781 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.313 _refine.solvent_model_param_bsol 42.198 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.95 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct OTHER _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.34 _refine.pdbx_overall_phase_error 27.32 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2066 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 38 _refine_hist.number_atoms_solvent 68 _refine_hist.number_atoms_total 2172 _refine_hist.d_res_high 2.400 _refine_hist.d_res_low 50.379 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.016 ? ? 2148 'X-RAY DIFFRACTION' ? f_angle_d 1.597 ? ? 2899 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 19.224 ? ? 836 'X-RAY DIFFRACTION' ? f_chiral_restr 0.088 ? ? 309 'X-RAY DIFFRACTION' ? f_plane_restr 0.010 ? ? 369 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 2.4000 2.5853 2494 0.2417 100.00 0.3260 . . 124 . . 'X-RAY DIFFRACTION' . 2.5853 2.8455 2518 0.2431 99.00 0.3066 . . 135 . . 'X-RAY DIFFRACTION' . 2.8455 3.2571 2505 0.2009 99.00 0.2918 . . 121 . . 'X-RAY DIFFRACTION' . 3.2571 4.1034 2509 0.1866 99.00 0.2167 . . 144 . . 'X-RAY DIFFRACTION' . 4.1034 50.3898 2560 0.1949 99.00 0.2140 . . 141 . . # _struct.entry_id 4A4X _struct.title 'NEK2-EDE bound to CCT248662' _struct.pdbx_descriptor 'SERINE/THREONINE-PROTEIN KINASE NEK2 (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4A4X _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'TRANSFERASE, PROTEIN KINASE, MITOSIS' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 4 ? GLU A 6 ? ARG A 4 GLU A 6 5 ? 3 HELX_P HELX_P2 2 THR A 45 ? ARG A 60 ? THR A 45 ARG A 60 1 ? 16 HELX_P HELX_P3 3 LEU A 94 ? GLU A 104 ? LEU A 94 GLU A 104 1 ? 11 HELX_P HELX_P4 4 ASP A 109 ? ARG A 130 ? ASP A 109 ARG A 130 1 ? 22 HELX_P HELX_P5 5 LYS A 143 ? ALA A 145 ? LYS A 143 ALA A 145 5 ? 3 HELX_P HELX_P6 6 ASN A 194 ? LEU A 212 ? ASN A 194 LEU A 212 1 ? 19 HELX_P HELX_P7 7 SER A 220 ? GLY A 231 ? SER A 220 GLY A 231 1 ? 12 HELX_P HELX_P8 8 SER A 241 ? LEU A 252 ? SER A 241 LEU A 252 1 ? 12 HELX_P HELX_P9 9 LYS A 255 ? ARG A 259 ? LYS A 255 ARG A 259 5 ? 5 HELX_P HELX_P10 10 SER A 261 ? GLU A 267 ? SER A 261 GLU A 267 1 ? 7 HELX_P HELX_P11 11 LEU A 272 ? HIS A 276 ? LEU A 272 HIS A 276 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 17 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 17 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 SER _struct_mon_prot_cis.pdbx_label_seq_id_2 18 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 SER _struct_mon_prot_cis.pdbx_auth_seq_id_2 18 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.44 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 5 ? AB ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 TYR A 8 ? THR A 16 ? TYR A 8 THR A 16 AA 2 ARG A 21 ? ARG A 27 ? ARG A 21 ARG A 27 AA 3 ILE A 33 ? ASP A 40 ? ILE A 33 ASP A 40 AA 4 THR A 81 ? GLU A 87 ? THR A 81 GLU A 87 AA 5 TYR A 70 ? ASP A 76 ? TYR A 70 ASP A 76 AB 1 GLY A 92 ? ASP A 93 ? GLY A 92 ASP A 93 AB 2 VAL A 147 ? LEU A 149 ? VAL A 147 LEU A 149 AB 3 VAL A 155 ? LEU A 157 ? VAL A 155 LEU A 157 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ILE A 14 ? N ILE A 14 O CYS A 22 ? O CYS A 22 AA 2 3 N ILE A 25 ? N ILE A 25 O LEU A 34 ? O LEU A 34 AA 3 4 N LEU A 39 ? N LEU A 39 O LEU A 82 ? O LEU A 82 AA 4 5 O VAL A 85 ? O VAL A 85 N TYR A 71 ? N TYR A 71 AB 1 2 O GLY A 92 ? O GLY A 92 N LEU A 149 ? N LEU A 149 AB 2 3 N PHE A 148 ? N PHE A 148 O LYS A 156 ? O LYS A 156 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 14 _struct_site.details 'BINDING SITE FOR RESIDUE JUP A 1280' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 ILE A 14 ? ILE A 14 . ? 1_555 ? 2 AC1 14 GLY A 15 ? GLY A 15 . ? 1_555 ? 3 AC1 14 TYR A 19 ? TYR A 19 . ? 1_555 ? 4 AC1 14 CYS A 22 ? CYS A 22 . ? 1_555 ? 5 AC1 14 VAL A 35 ? VAL A 35 . ? 1_555 ? 6 AC1 14 MET A 86 ? MET A 86 . ? 1_555 ? 7 AC1 14 GLU A 87 ? GLU A 87 . ? 1_555 ? 8 AC1 14 TYR A 88 ? TYR A 88 . ? 1_555 ? 9 AC1 14 CYS A 89 ? CYS A 89 . ? 1_555 ? 10 AC1 14 ALA A 145 ? ALA A 145 . ? 1_555 ? 11 AC1 14 PHE A 148 ? PHE A 148 . ? 1_555 ? 12 AC1 14 GLY A 158 ? GLY A 158 . ? 1_555 ? 13 AC1 14 ASP A 159 ? ASP A 159 . ? 1_555 ? 14 AC1 14 PHE A 160 ? PHE A 160 . ? 1_555 ? # _database_PDB_matrix.entry_id 4A4X _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4A4X _atom_sites.fract_transf_matrix[1][1] 0.009879 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.007477 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017572 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016855 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 CYS 89 89 89 CYS CYS A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 TYR 107 107 107 TYR TYR A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 MET 117 117 117 MET MET A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 CYS 127 127 127 CYS CYS A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 ASP 132 132 ? ? ? A . n A 1 133 GLY 133 133 ? ? ? A . n A 1 134 GLY 134 134 ? ? ? A . n A 1 135 HIS 135 135 ? ? ? A . n A 1 136 THR 136 136 ? ? ? A . n A 1 137 VAL 137 137 ? ? ? A . n A 1 138 LEU 138 138 ? ? ? A . n A 1 139 HIS 139 139 139 HIS HIS A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 PHE 160 160 160 PHE PHE A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 ALA 163 163 ? ? ? A . n A 1 164 ARG 164 164 ? ? ? A . n A 1 165 ILE 165 165 ? ? ? A . n A 1 166 LEU 166 166 ? ? ? A . n A 1 167 ASN 167 167 ? ? ? A . n A 1 168 HIS 168 168 ? ? ? A . n A 1 169 ASP 169 169 ? ? ? A . n A 1 170 GLU 170 170 ? ? ? A . n A 1 171 ASP 171 171 ? ? ? A . n A 1 172 PHE 172 172 ? ? ? A . n A 1 173 ALA 173 173 ? ? ? A . n A 1 174 LYS 174 174 ? ? ? A . n A 1 175 GLU 175 175 ? ? ? A . n A 1 176 PHE 176 176 ? ? ? A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 PRO 180 180 180 PRO PRO A . n A 1 181 TYR 181 181 181 TYR TYR A . n A 1 182 TYR 182 182 182 TYR TYR A . n A 1 183 MET 183 183 183 MET MET A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 GLN 187 187 187 GLN GLN A . n A 1 188 MET 188 188 188 MET MET A . n A 1 189 ASN 189 189 189 ASN ASN A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 MET 191 191 ? ? ? A . n A 1 192 SER 192 192 ? ? ? A . n A 1 193 TYR 193 193 ? ? ? A . n A 1 194 ASN 194 194 194 ASN ASN A . n A 1 195 GLU 195 195 195 GLU GLU A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 ASP 198 198 198 ASP ASP A . n A 1 199 ILE 199 199 199 ILE ILE A . n A 1 200 TRP 200 200 200 TRP TRP A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 CYS 204 204 204 CYS CYS A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 TYR 207 207 207 TYR TYR A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 CYS 210 210 210 CYS CYS A . n A 1 211 ALA 211 211 211 ALA ALA A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 MET 213 213 213 MET MET A . n A 1 214 PRO 214 214 214 PRO PRO A . n A 1 215 PRO 215 215 215 PRO PRO A . n A 1 216 PHE 216 216 216 PHE PHE A . n A 1 217 THR 217 217 217 THR THR A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 PHE 219 219 219 PHE PHE A . n A 1 220 SER 220 220 220 SER SER A . n A 1 221 GLN 221 221 221 GLN GLN A . n A 1 222 LYS 222 222 222 LYS LYS A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 ALA 225 225 225 ALA ALA A . n A 1 226 GLY 226 226 226 GLY GLY A . n A 1 227 LYS 227 227 227 LYS LYS A . n A 1 228 ILE 228 228 228 ILE ILE A . n A 1 229 ARG 229 229 229 ARG ARG A . n A 1 230 GLU 230 230 230 GLU GLU A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 LYS 232 232 232 LYS LYS A . n A 1 233 PHE 233 233 233 PHE PHE A . n A 1 234 ARG 234 234 234 ARG ARG A . n A 1 235 ARG 235 235 235 ARG ARG A . n A 1 236 ILE 236 236 236 ILE ILE A . n A 1 237 PRO 237 237 237 PRO PRO A . n A 1 238 TYR 238 238 238 TYR TYR A . n A 1 239 ARG 239 239 239 ARG ARG A . n A 1 240 TYR 240 240 240 TYR TYR A . n A 1 241 SER 241 241 241 SER SER A . n A 1 242 ASP 242 242 242 ASP ASP A . n A 1 243 GLU 243 243 243 GLU GLU A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 ASN 245 245 245 ASN ASN A . n A 1 246 GLU 246 246 246 GLU GLU A . n A 1 247 ILE 247 247 247 ILE ILE A . n A 1 248 ILE 248 248 248 ILE ILE A . n A 1 249 THR 249 249 249 THR THR A . n A 1 250 ARG 250 250 250 ARG ARG A . n A 1 251 MET 251 251 251 MET MET A . n A 1 252 LEU 252 252 252 LEU LEU A . n A 1 253 ASN 253 253 253 ASN ASN A . n A 1 254 LEU 254 254 254 LEU LEU A . n A 1 255 LYS 255 255 255 LYS LYS A . n A 1 256 ASP 256 256 256 ASP ASP A . n A 1 257 TYR 257 257 257 TYR TYR A . n A 1 258 HIS 258 258 258 HIS HIS A . n A 1 259 ARG 259 259 259 ARG ARG A . n A 1 260 PRO 260 260 260 PRO PRO A . n A 1 261 SER 261 261 261 SER SER A . n A 1 262 VAL 262 262 262 VAL VAL A . n A 1 263 GLU 263 263 263 GLU GLU A . n A 1 264 GLU 264 264 264 GLU GLU A . n A 1 265 ILE 265 265 265 ILE ILE A . n A 1 266 LEU 266 266 266 LEU LEU A . n A 1 267 GLU 267 267 267 GLU GLU A . n A 1 268 ASN 268 268 268 ASN ASN A . n A 1 269 PRO 269 269 269 PRO PRO A . n A 1 270 LEU 270 270 270 LEU LEU A . n A 1 271 ILE 271 271 271 ILE ILE A . n A 1 272 LEU 272 272 272 LEU LEU A . n A 1 273 GLU 273 273 273 GLU GLU A . n A 1 274 HIS 274 274 274 HIS HIS A . n A 1 275 HIS 275 275 275 HIS HIS A . n A 1 276 HIS 276 276 276 HIS HIS A . n A 1 277 HIS 277 277 277 HIS HIS A . n A 1 278 HIS 278 278 278 HIS HIS A . n A 1 279 HIS 279 279 279 HIS HIS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 JUP 1 1280 1280 JUP JUP A . C 3 HOH 1 2001 2001 HOH HOH A . C 3 HOH 2 2002 2002 HOH HOH A . C 3 HOH 3 2003 2003 HOH HOH A . C 3 HOH 4 2004 2004 HOH HOH A . C 3 HOH 5 2005 2005 HOH HOH A . C 3 HOH 6 2006 2006 HOH HOH A . C 3 HOH 7 2007 2007 HOH HOH A . C 3 HOH 8 2008 2008 HOH HOH A . C 3 HOH 9 2009 2009 HOH HOH A . C 3 HOH 10 2010 2010 HOH HOH A . C 3 HOH 11 2011 2011 HOH HOH A . C 3 HOH 12 2012 2012 HOH HOH A . C 3 HOH 13 2013 2013 HOH HOH A . C 3 HOH 14 2014 2014 HOH HOH A . C 3 HOH 15 2015 2015 HOH HOH A . C 3 HOH 16 2016 2016 HOH HOH A . C 3 HOH 17 2017 2017 HOH HOH A . C 3 HOH 18 2018 2018 HOH HOH A . C 3 HOH 19 2019 2019 HOH HOH A . C 3 HOH 20 2020 2020 HOH HOH A . C 3 HOH 21 2021 2021 HOH HOH A . C 3 HOH 22 2022 2022 HOH HOH A . C 3 HOH 23 2023 2023 HOH HOH A . C 3 HOH 24 2024 2024 HOH HOH A . C 3 HOH 25 2025 2025 HOH HOH A . C 3 HOH 26 2026 2026 HOH HOH A . C 3 HOH 27 2027 2027 HOH HOH A . C 3 HOH 28 2028 2028 HOH HOH A . C 3 HOH 29 2029 2029 HOH HOH A . C 3 HOH 30 2030 2030 HOH HOH A . C 3 HOH 31 2031 2031 HOH HOH A . C 3 HOH 32 2032 2032 HOH HOH A . C 3 HOH 33 2033 2033 HOH HOH A . C 3 HOH 34 2034 2034 HOH HOH A . C 3 HOH 35 2035 2035 HOH HOH A . C 3 HOH 36 2036 2036 HOH HOH A . C 3 HOH 37 2037 2037 HOH HOH A . C 3 HOH 38 2038 2038 HOH HOH A . C 3 HOH 39 2039 2039 HOH HOH A . C 3 HOH 40 2040 2040 HOH HOH A . C 3 HOH 41 2041 2041 HOH HOH A . C 3 HOH 42 2042 2042 HOH HOH A . C 3 HOH 43 2043 2043 HOH HOH A . C 3 HOH 44 2044 2044 HOH HOH A . C 3 HOH 45 2045 2045 HOH HOH A . C 3 HOH 46 2046 2046 HOH HOH A . C 3 HOH 47 2047 2047 HOH HOH A . C 3 HOH 48 2048 2048 HOH HOH A . C 3 HOH 49 2049 2049 HOH HOH A . C 3 HOH 50 2050 2050 HOH HOH A . C 3 HOH 51 2051 2051 HOH HOH A . C 3 HOH 52 2052 2052 HOH HOH A . C 3 HOH 53 2053 2053 HOH HOH A . C 3 HOH 54 2054 2054 HOH HOH A . C 3 HOH 55 2055 2055 HOH HOH A . C 3 HOH 56 2056 2056 HOH HOH A . C 3 HOH 57 2057 2057 HOH HOH A . C 3 HOH 58 2058 2058 HOH HOH A . C 3 HOH 59 2059 2059 HOH HOH A . C 3 HOH 60 2060 2060 HOH HOH A . C 3 HOH 61 2061 2061 HOH HOH A . C 3 HOH 62 2062 2062 HOH HOH A . C 3 HOH 63 2063 2063 HOH HOH A . C 3 HOH 64 2064 2064 HOH HOH A . C 3 HOH 65 2065 2065 HOH HOH A . C 3 HOH 66 2066 2066 HOH HOH A . C 3 HOH 67 2067 2067 HOH HOH A . C 3 HOH 68 2068 2068 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2012-04-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _software.name PHENIX _software.classification refinement _software.version '(PHENIX.REFINE)' _software.citation_id ? _software.pdbx_ordinal 1 # _pdbx_entry_details.entry_id 4A4X _pdbx_entry_details.compound_details ;ENGINEERED RESIDUE IN CHAIN A, THR 170 TO GLU ENGINEERED RESIDUE IN CHAIN A, SER 171 TO ASP ENGINEERED RESIDUE IN CHAIN A, THR 175 TO GLU ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 C A GLN 187 ? ? N A ASN 189 ? ? 1.55 2 1 N A MET 188 ? ? N A ASN 189 ? ? 1.57 3 1 CG A MET 183 ? ? CE A MET 188 ? ? 1.66 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CA A GLN 187 ? ? CB A GLN 187 ? ? 1.706 1.535 0.171 0.022 N 2 1 CB A GLN 187 ? ? CG A GLN 187 ? ? 1.701 1.521 0.180 0.027 N 3 1 C A GLN 187 ? ? O A GLN 187 ? ? 1.103 1.229 -0.126 0.019 N 4 1 C A MET 188 ? ? O A MET 188 ? ? 1.367 1.229 0.138 0.019 N 5 1 CA A ASN 189 ? ? CB A ASN 189 ? ? 1.716 1.527 0.189 0.026 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A GLN 187 ? ? C A GLN 187 ? ? N A MET 188 ? ? 97.20 117.20 -20.00 2.20 Y 2 1 N A MET 188 ? ? CA A MET 188 ? ? C A MET 188 ? ? 77.01 111.00 -33.99 2.70 N 3 1 C A MET 188 ? ? N A ASN 189 ? ? CA A ASN 189 ? ? 102.45 121.70 -19.25 2.50 Y 4 1 CB A ASN 189 ? ? CA A ASN 189 ? ? C A ASN 189 ? ? 97.96 110.40 -12.44 2.00 N 5 1 N A ASN 189 ? ? CA A ASN 189 ? ? CB A ASN 189 ? ? 124.47 110.60 13.87 1.80 N 6 1 N A ASN 189 ? ? CA A ASN 189 ? ? C A ASN 189 ? ? 127.86 111.00 16.86 2.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 5 ? ? -38.44 -29.32 2 1 SER A 18 ? ? 69.70 -147.62 3 1 TYR A 19 ? ? -22.26 -61.11 4 1 THR A 45 ? ? -64.55 -176.42 5 1 ARG A 105 ? ? 37.54 63.02 6 1 ARG A 130 ? ? -81.94 49.40 7 1 MET A 188 ? ? -64.38 0.21 8 1 ASN A 189 ? ? -123.71 -88.19 9 1 SER A 241 ? ? -47.78 150.47 10 1 PRO A 269 ? ? -47.27 -17.07 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id GLN _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 187 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle 20.40 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 39 ? CG ? A LEU 39 CG 2 1 Y 1 A LEU 39 ? CD1 ? A LEU 39 CD1 3 1 Y 1 A LEU 39 ? CD2 ? A LEU 39 CD2 4 1 Y 1 A LYS 63 ? CG ? A LYS 63 CG 5 1 Y 1 A LYS 63 ? CD ? A LYS 63 CD 6 1 Y 1 A LYS 63 ? CE ? A LYS 63 CE 7 1 Y 1 A LYS 63 ? NZ ? A LYS 63 NZ 8 1 Y 1 A ASN 79 ? CG ? A ASN 79 CG 9 1 Y 1 A ASN 79 ? OD1 ? A ASN 79 OD1 10 1 Y 1 A ASN 79 ? ND2 ? A ASN 79 ND2 11 1 Y 1 A ARG 130 ? CG ? A ARG 130 CG 12 1 Y 1 A ARG 130 ? CD ? A ARG 130 CD 13 1 Y 1 A ARG 130 ? NE ? A ARG 130 NE 14 1 Y 1 A ARG 130 ? CZ ? A ARG 130 CZ 15 1 Y 1 A ARG 130 ? NH1 ? A ARG 130 NH1 16 1 Y 1 A ARG 130 ? NH2 ? A ARG 130 NH2 17 1 Y 1 A ARG 190 ? CG ? A ARG 190 CG 18 1 Y 1 A ARG 190 ? CD ? A ARG 190 CD 19 1 Y 1 A ARG 190 ? NE ? A ARG 190 NE 20 1 Y 1 A ARG 190 ? CZ ? A ARG 190 CZ 21 1 Y 1 A ARG 190 ? NH1 ? A ARG 190 NH1 22 1 Y 1 A ARG 190 ? NH2 ? A ARG 190 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A ASP 132 ? A ASP 132 4 1 Y 1 A GLY 133 ? A GLY 133 5 1 Y 1 A GLY 134 ? A GLY 134 6 1 Y 1 A HIS 135 ? A HIS 135 7 1 Y 1 A THR 136 ? A THR 136 8 1 Y 1 A VAL 137 ? A VAL 137 9 1 Y 1 A LEU 138 ? A LEU 138 10 1 Y 1 A ALA 163 ? A ALA 163 11 1 Y 1 A ARG 164 ? A ARG 164 12 1 Y 1 A ILE 165 ? A ILE 165 13 1 Y 1 A LEU 166 ? A LEU 166 14 1 Y 1 A ASN 167 ? A ASN 167 15 1 Y 1 A HIS 168 ? A HIS 168 16 1 Y 1 A ASP 169 ? A ASP 169 17 1 Y 1 A GLU 170 ? A GLU 170 18 1 Y 1 A ASP 171 ? A ASP 171 19 1 Y 1 A PHE 172 ? A PHE 172 20 1 Y 1 A ALA 173 ? A ALA 173 21 1 Y 1 A LYS 174 ? A LYS 174 22 1 Y 1 A GLU 175 ? A GLU 175 23 1 Y 1 A PHE 176 ? A PHE 176 24 1 Y 1 A MET 191 ? A MET 191 25 1 Y 1 A SER 192 ? A SER 192 26 1 Y 1 A TYR 193 ? A TYR 193 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '4-(2-AMINO-5-{4-[(DIMETHYLAMINO)METHYL]THIOPHEN-2-YL}PYRIDIN-3-YL)-2-{(1R)-1-[2-(TRIFLUOROMETHYL)PHENYL]ETHOXY}BENZAMIDE' JUP 3 water HOH #