data_4AC6 # _entry.id 4AC6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4AC6 PDBE EBI-50336 WWPDB D_1290050336 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 4ACI unspecified 'STRUCTURE OF THE C. GLUTAMICUM ACNR CRYSTAL FORM II' PDB 4AF5 unspecified 'STRUCTURE OF THE C. GLUTAMICUM ACNR CRYSTAL FORM I' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4AC6 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2011-12-14 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Garcia-Nafria, J.' 1 'Baumgart, M.' 2 'Turkenburg, J.P.' 3 'Wilkinson, A.J.' 4 'Bott, M.' 5 'Wilson, K.S.' 6 # _citation.id primary _citation.title ;Crystal and Solution Studies Reveal that the Transcriptional Regulator Acnr of Corynebacterium Glutamicum is Regulated by Citrate:Mg2+ Binding to a Non-Canonical Pocket. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 288 _citation.page_first 15800 _citation.page_last ? _citation.year 2013 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23589369 _citation.pdbx_database_id_DOI 10.1074/JBC.M113.462440 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Garcia-Nafria, J.' 1 primary 'Baumgart, M.' 2 primary 'Turkenburg, J.P.' 3 primary 'Wilkinson, A.J.' 4 primary 'Bott, M.' 5 primary 'Wilson, K.S.' 6 # _cell.entry_id 4AC6 _cell.length_a 34.142 _cell.length_b 72.886 _cell.length_c 73.250 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4AC6 _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HTH-TYPE TRANSCRIPTIONAL REPRESSOR ACNR' 21511.338 1 ? ? 'RESIDUES 2-188' ? 2 non-polymer syn 'GOLD ION' 196.967 4 ? ? ? ? 3 water nat water 18.015 49 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMVSVAAGDKPTNSRQEILEGARRCFAEHGYEGATVRRLEEATGKSRGAIFHHFGDKENLFLALAREDAARMAEVVSEN GLVEVMRGMLEDPERYDWMSVRLEISKQLRTDPVFRAKWIDHQSVLDEAVRVRLSRNVDKGQMRTDVPIEVLHTFLETVL DGFISRLATGASTEGLSEVLDLVEGTVRKRD ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMVSVAAGDKPTNSRQEILEGARRCFAEHGYEGATVRRLEEATGKSRGAIFHHFGDKENLFLALAREDAARMAEVVSEN GLVEVMRGMLEDPERYDWMSVRLEISKQLRTDPVFRAKWIDHQSVLDEAVRVRLSRNVDKGQMRTDVPIEVLHTFLETVL DGFISRLATGASTEGLSEVLDLVEGTVRKRD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 VAL n 1 5 SER n 1 6 VAL n 1 7 ALA n 1 8 ALA n 1 9 GLY n 1 10 ASP n 1 11 LYS n 1 12 PRO n 1 13 THR n 1 14 ASN n 1 15 SER n 1 16 ARG n 1 17 GLN n 1 18 GLU n 1 19 ILE n 1 20 LEU n 1 21 GLU n 1 22 GLY n 1 23 ALA n 1 24 ARG n 1 25 ARG n 1 26 CYS n 1 27 PHE n 1 28 ALA n 1 29 GLU n 1 30 HIS n 1 31 GLY n 1 32 TYR n 1 33 GLU n 1 34 GLY n 1 35 ALA n 1 36 THR n 1 37 VAL n 1 38 ARG n 1 39 ARG n 1 40 LEU n 1 41 GLU n 1 42 GLU n 1 43 ALA n 1 44 THR n 1 45 GLY n 1 46 LYS n 1 47 SER n 1 48 ARG n 1 49 GLY n 1 50 ALA n 1 51 ILE n 1 52 PHE n 1 53 HIS n 1 54 HIS n 1 55 PHE n 1 56 GLY n 1 57 ASP n 1 58 LYS n 1 59 GLU n 1 60 ASN n 1 61 LEU n 1 62 PHE n 1 63 LEU n 1 64 ALA n 1 65 LEU n 1 66 ALA n 1 67 ARG n 1 68 GLU n 1 69 ASP n 1 70 ALA n 1 71 ALA n 1 72 ARG n 1 73 MET n 1 74 ALA n 1 75 GLU n 1 76 VAL n 1 77 VAL n 1 78 SER n 1 79 GLU n 1 80 ASN n 1 81 GLY n 1 82 LEU n 1 83 VAL n 1 84 GLU n 1 85 VAL n 1 86 MET n 1 87 ARG n 1 88 GLY n 1 89 MET n 1 90 LEU n 1 91 GLU n 1 92 ASP n 1 93 PRO n 1 94 GLU n 1 95 ARG n 1 96 TYR n 1 97 ASP n 1 98 TRP n 1 99 MET n 1 100 SER n 1 101 VAL n 1 102 ARG n 1 103 LEU n 1 104 GLU n 1 105 ILE n 1 106 SER n 1 107 LYS n 1 108 GLN n 1 109 LEU n 1 110 ARG n 1 111 THR n 1 112 ASP n 1 113 PRO n 1 114 VAL n 1 115 PHE n 1 116 ARG n 1 117 ALA n 1 118 LYS n 1 119 TRP n 1 120 ILE n 1 121 ASP n 1 122 HIS n 1 123 GLN n 1 124 SER n 1 125 VAL n 1 126 LEU n 1 127 ASP n 1 128 GLU n 1 129 ALA n 1 130 VAL n 1 131 ARG n 1 132 VAL n 1 133 ARG n 1 134 LEU n 1 135 SER n 1 136 ARG n 1 137 ASN n 1 138 VAL n 1 139 ASP n 1 140 LYS n 1 141 GLY n 1 142 GLN n 1 143 MET n 1 144 ARG n 1 145 THR n 1 146 ASP n 1 147 VAL n 1 148 PRO n 1 149 ILE n 1 150 GLU n 1 151 VAL n 1 152 LEU n 1 153 HIS n 1 154 THR n 1 155 PHE n 1 156 LEU n 1 157 GLU n 1 158 THR n 1 159 VAL n 1 160 LEU n 1 161 ASP n 1 162 GLY n 1 163 PHE n 1 164 ILE n 1 165 SER n 1 166 ARG n 1 167 LEU n 1 168 ALA n 1 169 THR n 1 170 GLY n 1 171 ALA n 1 172 SER n 1 173 THR n 1 174 GLU n 1 175 GLY n 1 176 LEU n 1 177 SER n 1 178 GLU n 1 179 VAL n 1 180 LEU n 1 181 ASP n 1 182 LEU n 1 183 VAL n 1 184 GLU n 1 185 GLY n 1 186 THR n 1 187 VAL n 1 188 ARG n 1 189 LYS n 1 190 ARG n 1 191 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'CORYNEBACTERIUM GLUTAMICUM' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1718 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ACNR_CORGL _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q8NQ97 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4AC6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 191 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8NQ97 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 188 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 188 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4AC6 GLY A 1 ? UNP Q8NQ97 ? ? 'expression tag' -2 1 1 4AC6 HIS A 2 ? UNP Q8NQ97 ? ? 'expression tag' -1 2 1 4AC6 MET A 3 ? UNP Q8NQ97 ? ? 'expression tag' 0 3 1 4AC6 VAL A 4 ? UNP Q8NQ97 ? ? 'expression tag' 1 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 AU non-polymer . 'GOLD ION' ? 'Au 1' 196.967 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4AC6 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.29 _exptl_crystal.density_percent_sol 46 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '1 M AMMONIUM PHOSPHATE, 100 MM SODIUM CITRATE PH 5.6' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2010-04-17 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9334 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-1' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-1 _diffrn_source.pdbx_wavelength 0.9334 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4AC6 _reflns.observed_criterion_sigma_I 1.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 73.25 _reflns.d_resolution_high 2.54 _reflns.number_obs 6461 _reflns.number_all ? _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs 0.07 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 47.90 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 8.8 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.54 _reflns_shell.d_res_low 2.58 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.15 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 21.90 _reflns_shell.pdbx_redundancy 8.4 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4AC6 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 6151 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 73.25 _refine.ls_d_res_high 2.54 _refine.ls_percent_reflns_obs 99.88 _refine.ls_R_factor_obs 0.19792 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.19454 _refine.ls_R_factor_R_free 0.26336 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.7 _refine.ls_number_reflns_R_free 301 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.929 _refine.correlation_coeff_Fo_to_Fc_free 0.880 _refine.B_iso_mean 18.191 _refine.aniso_B[1][1] 0.88 _refine.aniso_B[2][2] -1.00 _refine.aniso_B[3][3] 0.12 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES REFINED INDIVIDUALLY.' _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 1.046 _refine.pdbx_overall_ESU_R_Free 0.330 _refine.overall_SU_ML 0.248 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 11.151 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1401 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 49 _refine_hist.number_atoms_total 1454 _refine_hist.d_res_high 2.54 _refine_hist.d_res_low 73.25 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.016 0.021 ? 1421 'X-RAY DIFFRACTION' ? r_bond_other_d 0.001 0.020 ? 999 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.355 1.956 ? 1912 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.930 3.000 ? 2400 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 4.983 5.000 ? 175 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 37.030 22.703 ? 74 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 17.536 15.000 ? 260 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 21.288 15.000 ? 19 'X-RAY DIFFRACTION' ? r_chiral_restr 0.074 0.200 ? 213 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.004 0.020 ? 1594 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 311 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.539 _refine_ls_shell.d_res_low 2.605 _refine_ls_shell.number_reflns_R_work 388 _refine_ls_shell.R_factor_R_work 0.192 _refine_ls_shell.percent_reflns_obs 99.03 _refine_ls_shell.R_factor_R_free 0.352 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 21 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 4AC6 _struct.title 'Corynebacterium glutamicum AcnR AU derivative structure' _struct.pdbx_descriptor 'HTH-TYPE TRANSCRIPTIONAL REPRESSOR ACNR' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4AC6 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'TRANSCRIPTION, ACONITASE, CITRATE, TETR SUPERFAMILY' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 14 ? ALA A 35 ? ASN A 11 ALA A 32 1 ? 22 HELX_P HELX_P2 2 THR A 36 ? GLY A 45 ? THR A 33 GLY A 42 1 ? 10 HELX_P HELX_P3 3 SER A 47 ? GLY A 56 ? SER A 44 GLY A 53 1 ? 10 HELX_P HELX_P4 4 ASP A 57 ? LEU A 90 ? ASP A 54 LEU A 87 1 ? 34 HELX_P HELX_P5 5 GLU A 91 ? GLU A 94 ? GLU A 88 GLU A 91 5 ? 4 HELX_P HELX_P6 6 ARG A 95 ? ILE A 105 ? ARG A 92 ILE A 102 1 ? 11 HELX_P HELX_P7 7 LYS A 107 ? ASP A 112 ? LYS A 104 ASP A 109 1 ? 6 HELX_P HELX_P8 8 ASP A 112 ? LYS A 140 ? ASP A 109 LYS A 137 1 ? 29 HELX_P HELX_P9 9 PRO A 148 ? THR A 169 ? PRO A 145 THR A 166 1 ? 22 HELX_P HELX_P10 10 GLY A 175 ? ARG A 188 ? GLY A 172 ARG A 185 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? D AU . AU ? ? ? 1_555 A CYS 26 SG ? ? A AU 1189 A CYS 23 1_555 ? ? ? ? ? ? ? 2.538 ? metalc2 metalc ? ? D AU . AU ? ? ? 1_555 A HIS 30 ND1 ? ? A AU 1189 A HIS 27 1_555 ? ? ? ? ? ? ? 1.896 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE AU A 1187' AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE AU A 1189' AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE AU A 1190' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 VAL A 76 ? VAL A 73 . ? 1_555 ? 2 AC1 3 VAL A 85 ? VAL A 82 . ? 1_555 ? 3 AC1 3 ASP A 139 ? ASP A 136 . ? 4_546 ? 4 AC2 2 CYS A 26 ? CYS A 23 . ? 1_555 ? 5 AC2 2 HIS A 30 ? HIS A 27 . ? 1_555 ? 6 AC3 2 LEU A 134 ? LEU A 131 . ? 1_555 ? 7 AC3 2 LEU A 156 ? LEU A 153 . ? 1_555 ? # _database_PDB_matrix.entry_id 4AC6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4AC6 _atom_sites.fract_transf_matrix[1][1] 0.029289 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013720 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013652 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol AU C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 HIS 2 -1 ? ? ? A . n A 1 3 MET 3 0 ? ? ? A . n A 1 4 VAL 4 1 ? ? ? A . n A 1 5 SER 5 2 ? ? ? A . n A 1 6 VAL 6 3 ? ? ? A . n A 1 7 ALA 7 4 ? ? ? A . n A 1 8 ALA 8 5 ? ? ? A . n A 1 9 GLY 9 6 ? ? ? A . n A 1 10 ASP 10 7 ? ? ? A . n A 1 11 LYS 11 8 ? ? ? A . n A 1 12 PRO 12 9 ? ? ? A . n A 1 13 THR 13 10 ? ? ? A . n A 1 14 ASN 14 11 11 ASN ASN A . n A 1 15 SER 15 12 12 SER SER A . n A 1 16 ARG 16 13 13 ARG ARG A . n A 1 17 GLN 17 14 14 GLN GLN A . n A 1 18 GLU 18 15 15 GLU GLU A . n A 1 19 ILE 19 16 16 ILE ILE A . n A 1 20 LEU 20 17 17 LEU LEU A . n A 1 21 GLU 21 18 18 GLU GLU A . n A 1 22 GLY 22 19 19 GLY GLY A . n A 1 23 ALA 23 20 20 ALA ALA A . n A 1 24 ARG 24 21 21 ARG ARG A . n A 1 25 ARG 25 22 22 ARG ARG A . n A 1 26 CYS 26 23 23 CYS CYS A . n A 1 27 PHE 27 24 24 PHE PHE A . n A 1 28 ALA 28 25 25 ALA ALA A . n A 1 29 GLU 29 26 26 GLU GLU A . n A 1 30 HIS 30 27 27 HIS HIS A . n A 1 31 GLY 31 28 28 GLY GLY A . n A 1 32 TYR 32 29 29 TYR TYR A . n A 1 33 GLU 33 30 30 GLU GLU A . n A 1 34 GLY 34 31 31 GLY GLY A . n A 1 35 ALA 35 32 32 ALA ALA A . n A 1 36 THR 36 33 33 THR THR A . n A 1 37 VAL 37 34 34 VAL VAL A . n A 1 38 ARG 38 35 35 ARG ARG A . n A 1 39 ARG 39 36 36 ARG ARG A . n A 1 40 LEU 40 37 37 LEU LEU A . n A 1 41 GLU 41 38 38 GLU GLU A . n A 1 42 GLU 42 39 39 GLU GLU A . n A 1 43 ALA 43 40 40 ALA ALA A . n A 1 44 THR 44 41 41 THR THR A . n A 1 45 GLY 45 42 42 GLY GLY A . n A 1 46 LYS 46 43 43 LYS LYS A . n A 1 47 SER 47 44 44 SER SER A . n A 1 48 ARG 48 45 45 ARG ARG A . n A 1 49 GLY 49 46 46 GLY GLY A . n A 1 50 ALA 50 47 47 ALA ALA A . n A 1 51 ILE 51 48 48 ILE ILE A . n A 1 52 PHE 52 49 49 PHE PHE A . n A 1 53 HIS 53 50 50 HIS HIS A . n A 1 54 HIS 54 51 51 HIS HIS A . n A 1 55 PHE 55 52 52 PHE PHE A . n A 1 56 GLY 56 53 53 GLY GLY A . n A 1 57 ASP 57 54 54 ASP ASP A . n A 1 58 LYS 58 55 55 LYS LYS A . n A 1 59 GLU 59 56 56 GLU GLU A . n A 1 60 ASN 60 57 57 ASN ASN A . n A 1 61 LEU 61 58 58 LEU LEU A . n A 1 62 PHE 62 59 59 PHE PHE A . n A 1 63 LEU 63 60 60 LEU LEU A . n A 1 64 ALA 64 61 61 ALA ALA A . n A 1 65 LEU 65 62 62 LEU LEU A . n A 1 66 ALA 66 63 63 ALA ALA A . n A 1 67 ARG 67 64 64 ARG ARG A . n A 1 68 GLU 68 65 65 GLU GLU A . n A 1 69 ASP 69 66 66 ASP ASP A . n A 1 70 ALA 70 67 67 ALA ALA A . n A 1 71 ALA 71 68 68 ALA ALA A . n A 1 72 ARG 72 69 69 ARG ARG A . n A 1 73 MET 73 70 70 MET MET A . n A 1 74 ALA 74 71 71 ALA ALA A . n A 1 75 GLU 75 72 72 GLU GLU A . n A 1 76 VAL 76 73 73 VAL VAL A . n A 1 77 VAL 77 74 74 VAL VAL A . n A 1 78 SER 78 75 75 SER SER A . n A 1 79 GLU 79 76 76 GLU GLU A . n A 1 80 ASN 80 77 77 ASN ASN A . n A 1 81 GLY 81 78 78 GLY GLY A . n A 1 82 LEU 82 79 79 LEU LEU A . n A 1 83 VAL 83 80 80 VAL VAL A . n A 1 84 GLU 84 81 81 GLU GLU A . n A 1 85 VAL 85 82 82 VAL VAL A . n A 1 86 MET 86 83 83 MET MET A . n A 1 87 ARG 87 84 84 ARG ARG A . n A 1 88 GLY 88 85 85 GLY GLY A . n A 1 89 MET 89 86 86 MET MET A . n A 1 90 LEU 90 87 87 LEU LEU A . n A 1 91 GLU 91 88 88 GLU GLU A . n A 1 92 ASP 92 89 89 ASP ASP A . n A 1 93 PRO 93 90 90 PRO PRO A . n A 1 94 GLU 94 91 91 GLU GLU A . n A 1 95 ARG 95 92 92 ARG ARG A . n A 1 96 TYR 96 93 93 TYR TYR A . n A 1 97 ASP 97 94 94 ASP ASP A . n A 1 98 TRP 98 95 95 TRP TRP A . n A 1 99 MET 99 96 96 MET MET A . n A 1 100 SER 100 97 97 SER SER A . n A 1 101 VAL 101 98 98 VAL VAL A . n A 1 102 ARG 102 99 99 ARG ARG A . n A 1 103 LEU 103 100 100 LEU LEU A . n A 1 104 GLU 104 101 101 GLU GLU A . n A 1 105 ILE 105 102 102 ILE ILE A . n A 1 106 SER 106 103 103 SER SER A . n A 1 107 LYS 107 104 104 LYS LYS A . n A 1 108 GLN 108 105 105 GLN GLN A . n A 1 109 LEU 109 106 106 LEU LEU A . n A 1 110 ARG 110 107 107 ARG ARG A . n A 1 111 THR 111 108 108 THR THR A . n A 1 112 ASP 112 109 109 ASP ASP A . n A 1 113 PRO 113 110 110 PRO PRO A . n A 1 114 VAL 114 111 111 VAL VAL A . n A 1 115 PHE 115 112 112 PHE PHE A . n A 1 116 ARG 116 113 113 ARG ARG A . n A 1 117 ALA 117 114 114 ALA ALA A . n A 1 118 LYS 118 115 115 LYS LYS A . n A 1 119 TRP 119 116 116 TRP TRP A . n A 1 120 ILE 120 117 117 ILE ILE A . n A 1 121 ASP 121 118 118 ASP ASP A . n A 1 122 HIS 122 119 119 HIS HIS A . n A 1 123 GLN 123 120 120 GLN GLN A . n A 1 124 SER 124 121 121 SER SER A . n A 1 125 VAL 125 122 122 VAL VAL A . n A 1 126 LEU 126 123 123 LEU LEU A . n A 1 127 ASP 127 124 124 ASP ASP A . n A 1 128 GLU 128 125 125 GLU GLU A . n A 1 129 ALA 129 126 126 ALA ALA A . n A 1 130 VAL 130 127 127 VAL VAL A . n A 1 131 ARG 131 128 128 ARG ARG A . n A 1 132 VAL 132 129 129 VAL VAL A . n A 1 133 ARG 133 130 130 ARG ARG A . n A 1 134 LEU 134 131 131 LEU LEU A . n A 1 135 SER 135 132 132 SER SER A . n A 1 136 ARG 136 133 133 ARG ARG A . n A 1 137 ASN 137 134 134 ASN ASN A . n A 1 138 VAL 138 135 135 VAL VAL A . n A 1 139 ASP 139 136 136 ASP ASP A . n A 1 140 LYS 140 137 137 LYS LYS A . n A 1 141 GLY 141 138 138 GLY GLY A . n A 1 142 GLN 142 139 139 GLN GLN A . n A 1 143 MET 143 140 140 MET MET A . n A 1 144 ARG 144 141 141 ARG ARG A . n A 1 145 THR 145 142 142 THR THR A . n A 1 146 ASP 146 143 143 ASP ASP A . n A 1 147 VAL 147 144 144 VAL VAL A . n A 1 148 PRO 148 145 145 PRO PRO A . n A 1 149 ILE 149 146 146 ILE ILE A . n A 1 150 GLU 150 147 147 GLU GLU A . n A 1 151 VAL 151 148 148 VAL VAL A . n A 1 152 LEU 152 149 149 LEU LEU A . n A 1 153 HIS 153 150 150 HIS HIS A . n A 1 154 THR 154 151 151 THR THR A . n A 1 155 PHE 155 152 152 PHE PHE A . n A 1 156 LEU 156 153 153 LEU LEU A . n A 1 157 GLU 157 154 154 GLU GLU A . n A 1 158 THR 158 155 155 THR THR A . n A 1 159 VAL 159 156 156 VAL VAL A . n A 1 160 LEU 160 157 157 LEU LEU A . n A 1 161 ASP 161 158 158 ASP ASP A . n A 1 162 GLY 162 159 159 GLY GLY A . n A 1 163 PHE 163 160 160 PHE PHE A . n A 1 164 ILE 164 161 161 ILE ILE A . n A 1 165 SER 165 162 162 SER SER A . n A 1 166 ARG 166 163 163 ARG ARG A . n A 1 167 LEU 167 164 164 LEU LEU A . n A 1 168 ALA 168 165 165 ALA ALA A . n A 1 169 THR 169 166 166 THR THR A . n A 1 170 GLY 170 167 167 GLY GLY A . n A 1 171 ALA 171 168 168 ALA ALA A . n A 1 172 SER 172 169 169 SER SER A . n A 1 173 THR 173 170 170 THR THR A . n A 1 174 GLU 174 171 171 GLU GLU A . n A 1 175 GLY 175 172 172 GLY GLY A . n A 1 176 LEU 176 173 173 LEU LEU A . n A 1 177 SER 177 174 174 SER SER A . n A 1 178 GLU 178 175 175 GLU GLU A . n A 1 179 VAL 179 176 176 VAL VAL A . n A 1 180 LEU 180 177 177 LEU LEU A . n A 1 181 ASP 181 178 178 ASP ASP A . n A 1 182 LEU 182 179 179 LEU LEU A . n A 1 183 VAL 183 180 180 VAL VAL A . n A 1 184 GLU 184 181 181 GLU GLU A . n A 1 185 GLY 185 182 182 GLY GLY A . n A 1 186 THR 186 183 183 THR THR A . n A 1 187 VAL 187 184 184 VAL VAL A . n A 1 188 ARG 188 185 185 ARG ARG A . n A 1 189 LYS 189 186 186 LYS LYS A . n A 1 190 ARG 190 187 ? ? ? A . n A 1 191 ASP 191 188 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 AU 1 1187 1187 AU AU A . C 2 AU 1 1188 1188 AU AU A . D 2 AU 1 1189 1189 AU AU A . E 2 AU 1 1190 1190 AU AU A . F 3 HOH 1 2001 2001 HOH HOH A . F 3 HOH 2 2002 2002 HOH HOH A . F 3 HOH 3 2003 2003 HOH HOH A . F 3 HOH 4 2004 2004 HOH HOH A . F 3 HOH 5 2005 2005 HOH HOH A . F 3 HOH 6 2006 2006 HOH HOH A . F 3 HOH 7 2007 2007 HOH HOH A . F 3 HOH 8 2008 2008 HOH HOH A . F 3 HOH 9 2009 2009 HOH HOH A . F 3 HOH 10 2010 2010 HOH HOH A . F 3 HOH 11 2011 2011 HOH HOH A . F 3 HOH 12 2012 2012 HOH HOH A . F 3 HOH 13 2013 2013 HOH HOH A . F 3 HOH 14 2014 2014 HOH HOH A . F 3 HOH 15 2015 2015 HOH HOH A . F 3 HOH 16 2016 2016 HOH HOH A . F 3 HOH 17 2017 2017 HOH HOH A . F 3 HOH 18 2018 2018 HOH HOH A . F 3 HOH 19 2019 2019 HOH HOH A . F 3 HOH 20 2020 2020 HOH HOH A . F 3 HOH 21 2021 2021 HOH HOH A . F 3 HOH 22 2022 2022 HOH HOH A . F 3 HOH 23 2023 2023 HOH HOH A . F 3 HOH 24 2024 2024 HOH HOH A . F 3 HOH 25 2025 2025 HOH HOH A . F 3 HOH 26 2026 2026 HOH HOH A . F 3 HOH 27 2027 2027 HOH HOH A . F 3 HOH 28 2028 2028 HOH HOH A . F 3 HOH 29 2029 2029 HOH HOH A . F 3 HOH 30 2030 2030 HOH HOH A . F 3 HOH 31 2031 2031 HOH HOH A . F 3 HOH 32 2032 2032 HOH HOH A . F 3 HOH 33 2033 2033 HOH HOH A . F 3 HOH 34 2034 2034 HOH HOH A . F 3 HOH 35 2035 2035 HOH HOH A . F 3 HOH 36 2036 2036 HOH HOH A . F 3 HOH 37 2037 2037 HOH HOH A . F 3 HOH 38 2038 2038 HOH HOH A . F 3 HOH 39 2039 2039 HOH HOH A . F 3 HOH 40 2040 2040 HOH HOH A . F 3 HOH 41 2041 2041 HOH HOH A . F 3 HOH 42 2042 2042 HOH HOH A . F 3 HOH 43 2043 2043 HOH HOH A . F 3 HOH 44 2044 2044 HOH HOH A . F 3 HOH 45 2045 2045 HOH HOH A . F 3 HOH 46 2046 2046 HOH HOH A . F 3 HOH 47 2047 2047 HOH HOH A . F 3 HOH 48 2048 2048 HOH HOH A . F 3 HOH 49 2049 2049 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4100 ? 1 MORE -53.9 ? 1 'SSA (A^2)' 16160 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_455 -x-1,-y,z -1.0000000000 0.0000000000 0.0000000000 -34.1420000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id SG _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id CYS _pdbx_struct_conn_angle.ptnr1_label_seq_id 26 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id CYS _pdbx_struct_conn_angle.ptnr1_auth_seq_id 23 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id AU _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id D _pdbx_struct_conn_angle.ptnr2_label_comp_id AU _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id AU _pdbx_struct_conn_angle.ptnr2_auth_seq_id 1189 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id ND1 _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id A _pdbx_struct_conn_angle.ptnr3_label_comp_id HIS _pdbx_struct_conn_angle.ptnr3_label_seq_id 30 _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id HIS _pdbx_struct_conn_angle.ptnr3_auth_seq_id 27 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 151.3 _pdbx_struct_conn_angle.value_esd ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-12-26 2 'Structure model' 1 1 2013-05-01 3 'Structure model' 1 2 2013-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other 3 2 'Structure model' 'Structure summary' 4 3 'Structure model' 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.6.0116 ? 1 HKL-2000 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 SHELXCDE phasing . ? 4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A HIS -1 ? A HIS 2 3 1 Y 1 A MET 0 ? A MET 3 4 1 Y 1 A VAL 1 ? A VAL 4 5 1 Y 1 A SER 2 ? A SER 5 6 1 Y 1 A VAL 3 ? A VAL 6 7 1 Y 1 A ALA 4 ? A ALA 7 8 1 Y 1 A ALA 5 ? A ALA 8 9 1 Y 1 A GLY 6 ? A GLY 9 10 1 Y 1 A ASP 7 ? A ASP 10 11 1 Y 1 A LYS 8 ? A LYS 11 12 1 Y 1 A PRO 9 ? A PRO 12 13 1 Y 1 A THR 10 ? A THR 13 14 1 Y 1 A ARG 187 ? A ARG 190 15 1 Y 1 A ASP 188 ? A ASP 191 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'GOLD ION' AU 3 water HOH #