data_4DMN # _entry.id 4DMN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4DMN pdb_00004dmn 10.2210/pdb4dmn/pdb RCSB RCSB070520 ? ? WWPDB D_1000070520 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-03-21 2 'Structure model' 1 1 2012-04-04 3 'Structure model' 1 2 2012-07-18 4 'Structure model' 1 3 2017-11-15 5 'Structure model' 1 4 2024-02-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Refinement description' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' chem_comp_atom 3 5 'Structure model' chem_comp_bond 4 5 'Structure model' database_2 5 5 'Structure model' struct_ref_seq_dif 6 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.classification' 2 4 'Structure model' '_software.contact_author' 3 4 'Structure model' '_software.contact_author_email' 4 4 'Structure model' '_software.date' 5 4 'Structure model' '_software.language' 6 4 'Structure model' '_software.location' 7 4 'Structure model' '_software.name' 8 4 'Structure model' '_software.type' 9 4 'Structure model' '_software.version' 10 5 'Structure model' '_database_2.pdbx_DOI' 11 5 'Structure model' '_database_2.pdbx_database_accession' 12 5 'Structure model' '_struct_ref_seq_dif.details' 13 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 14 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 15 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.entry_id 4DMN _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-02-08 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1ITG _pdbx_database_related.details 'HIV-1 Integrase catalytical core domain' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Feng, L.' 1 'Kvaratskhelia, M.' 2 # _citation.id primary _citation.title 'Multimode, cooperative mechanism of action of allosteric HIV-1 integrase inhibitors.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 287 _citation.page_first 16801 _citation.page_last 16811 _citation.year 2012 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22437836 _citation.pdbx_database_id_DOI 10.1074/jbc.M112.354373 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kessl, J.J.' 1 ? primary 'Jena, N.' 2 ? primary 'Koh, Y.' 3 ? primary 'Taskent-Sezgin, H.' 4 ? primary 'Slaughter, A.' 5 ? primary 'Feng, L.' 6 ? primary 'de Silva, S.' 7 ? primary 'Wu, L.' 8 ? primary 'Le Grice, S.F.' 9 ? primary 'Engelman, A.' 10 ? primary 'Fuchs, J.R.' 11 ? primary 'Kvaratskhelia, M.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HIV-1 Integrase' 17912.480 1 ? ? ? ? 2 non-polymer syn ARSENIC 74.922 2 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 non-polymer syn '(2S)-[6-bromo-4-(4-chlorophenyl)-2-methylquinolin-3-yl](methoxy)ethanoic acid' 420.684 1 ? ? ? ? 5 water nat water 18.015 7 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name IN # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAA CWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ TKE ; _entity_poly.pdbx_seq_one_letter_code_can ;MHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAA CWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ TKE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ARSENIC ARS 3 'SULFATE ION' SO4 4 '(2S)-[6-bromo-4-(4-chlorophenyl)-2-methylquinolin-3-yl](methoxy)ethanoic acid' 0L9 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 GLY n 1 4 GLN n 1 5 VAL n 1 6 ASP n 1 7 CYS n 1 8 SER n 1 9 PRO n 1 10 GLY n 1 11 ILE n 1 12 TRP n 1 13 GLN n 1 14 LEU n 1 15 ASP n 1 16 CYS n 1 17 THR n 1 18 HIS n 1 19 LEU n 1 20 GLU n 1 21 GLY n 1 22 LYS n 1 23 VAL n 1 24 ILE n 1 25 LEU n 1 26 VAL n 1 27 ALA n 1 28 VAL n 1 29 HIS n 1 30 VAL n 1 31 ALA n 1 32 SER n 1 33 GLY n 1 34 TYR n 1 35 ILE n 1 36 GLU n 1 37 ALA n 1 38 GLU n 1 39 VAL n 1 40 ILE n 1 41 PRO n 1 42 ALA n 1 43 GLU n 1 44 THR n 1 45 GLY n 1 46 GLN n 1 47 GLU n 1 48 THR n 1 49 ALA n 1 50 TYR n 1 51 PHE n 1 52 LEU n 1 53 LEU n 1 54 LYS n 1 55 LEU n 1 56 ALA n 1 57 GLY n 1 58 ARG n 1 59 TRP n 1 60 PRO n 1 61 VAL n 1 62 LYS n 1 63 THR n 1 64 VAL n 1 65 HIS n 1 66 THR n 1 67 ASP n 1 68 ASN n 1 69 GLY n 1 70 SER n 1 71 ASN n 1 72 PHE n 1 73 THR n 1 74 SER n 1 75 THR n 1 76 THR n 1 77 VAL n 1 78 LYS n 1 79 ALA n 1 80 ALA n 1 81 CYS n 1 82 TRP n 1 83 TRP n 1 84 ALA n 1 85 GLY n 1 86 ILE n 1 87 LYS n 1 88 GLN n 1 89 GLU n 1 90 PHE n 1 91 GLY n 1 92 ILE n 1 93 PRO n 1 94 TYR n 1 95 ASN n 1 96 PRO n 1 97 GLN n 1 98 SER n 1 99 GLN n 1 100 GLY n 1 101 VAL n 1 102 ILE n 1 103 GLU n 1 104 SER n 1 105 MET n 1 106 ASN n 1 107 LYS n 1 108 GLU n 1 109 LEU n 1 110 LYS n 1 111 LYS n 1 112 ILE n 1 113 ILE n 1 114 GLY n 1 115 GLN n 1 116 VAL n 1 117 ARG n 1 118 ASP n 1 119 GLN n 1 120 ALA n 1 121 GLU n 1 122 HIS n 1 123 LEU n 1 124 LYS n 1 125 THR n 1 126 ALA n 1 127 VAL n 1 128 GLN n 1 129 MET n 1 130 ALA n 1 131 VAL n 1 132 PHE n 1 133 ILE n 1 134 HIS n 1 135 ASN n 1 136 LYS n 1 137 LYS n 1 138 ARG n 1 139 LYS n 1 140 GLY n 1 141 GLY n 1 142 ILE n 1 143 GLY n 1 144 GLY n 1 145 TYR n 1 146 SER n 1 147 ALA n 1 148 GLY n 1 149 GLU n 1 150 ARG n 1 151 ILE n 1 152 VAL n 1 153 ASP n 1 154 ILE n 1 155 ILE n 1 156 ALA n 1 157 THR n 1 158 ASP n 1 159 ILE n 1 160 GLN n 1 161 THR n 1 162 LYS n 1 163 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HIV-1 _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene gag-pol _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus type 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11698 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 0L9 non-polymer . '(2S)-[6-bromo-4-(4-chlorophenyl)-2-methylquinolin-3-yl](methoxy)ethanoic acid' ? 'C19 H15 Br Cl N O3' 420.684 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ARS non-polymer . ARSENIC ? As 74.922 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 50 ? ? ? A . n A 1 2 HIS 2 51 ? ? ? A . n A 1 3 GLY 3 52 ? ? ? A . n A 1 4 GLN 4 53 ? ? ? A . n A 1 5 VAL 5 54 ? ? ? A . n A 1 6 ASP 6 55 55 ASP ASP A . n A 1 7 CYS 7 56 56 CYS CYS A . n A 1 8 SER 8 57 57 SER SER A . n A 1 9 PRO 9 58 58 PRO PRO A . n A 1 10 GLY 10 59 59 GLY GLY A . n A 1 11 ILE 11 60 60 ILE ILE A . n A 1 12 TRP 12 61 61 TRP TRP A . n A 1 13 GLN 13 62 62 GLN GLN A . n A 1 14 LEU 14 63 63 LEU LEU A . n A 1 15 ASP 15 64 64 ASP ASP A . n A 1 16 CYS 16 65 65 CYS CYS A . n A 1 17 THR 17 66 66 THR THR A . n A 1 18 HIS 18 67 67 HIS HIS A . n A 1 19 LEU 19 68 68 LEU LEU A . n A 1 20 GLU 20 69 69 GLU GLU A . n A 1 21 GLY 21 70 70 GLY GLY A . n A 1 22 LYS 22 71 71 LYS LYS A . n A 1 23 VAL 23 72 72 VAL VAL A . n A 1 24 ILE 24 73 73 ILE ILE A . n A 1 25 LEU 25 74 74 LEU LEU A . n A 1 26 VAL 26 75 75 VAL VAL A . n A 1 27 ALA 27 76 76 ALA ALA A . n A 1 28 VAL 28 77 77 VAL VAL A . n A 1 29 HIS 29 78 78 HIS HIS A . n A 1 30 VAL 30 79 79 VAL VAL A . n A 1 31 ALA 31 80 80 ALA ALA A . n A 1 32 SER 32 81 81 SER SER A . n A 1 33 GLY 33 82 82 GLY GLY A . n A 1 34 TYR 34 83 83 TYR TYR A . n A 1 35 ILE 35 84 84 ILE ILE A . n A 1 36 GLU 36 85 85 GLU GLU A . n A 1 37 ALA 37 86 86 ALA ALA A . n A 1 38 GLU 38 87 87 GLU GLU A . n A 1 39 VAL 39 88 88 VAL VAL A . n A 1 40 ILE 40 89 89 ILE ILE A . n A 1 41 PRO 41 90 90 PRO PRO A . n A 1 42 ALA 42 91 91 ALA ALA A . n A 1 43 GLU 43 92 92 GLU GLU A . n A 1 44 THR 44 93 93 THR THR A . n A 1 45 GLY 45 94 94 GLY GLY A . n A 1 46 GLN 46 95 95 GLN GLN A . n A 1 47 GLU 47 96 96 GLU GLU A . n A 1 48 THR 48 97 97 THR THR A . n A 1 49 ALA 49 98 98 ALA ALA A . n A 1 50 TYR 50 99 99 TYR TYR A . n A 1 51 PHE 51 100 100 PHE PHE A . n A 1 52 LEU 52 101 101 LEU LEU A . n A 1 53 LEU 53 102 102 LEU LEU A . n A 1 54 LYS 54 103 103 LYS LYS A . n A 1 55 LEU 55 104 104 LEU LEU A . n A 1 56 ALA 56 105 105 ALA ALA A . n A 1 57 GLY 57 106 106 GLY GLY A . n A 1 58 ARG 58 107 107 ARG ARG A . n A 1 59 TRP 59 108 108 TRP TRP A . n A 1 60 PRO 60 109 109 PRO PRO A . n A 1 61 VAL 61 110 110 VAL VAL A . n A 1 62 LYS 62 111 111 LYS LYS A . n A 1 63 THR 63 112 112 THR THR A . n A 1 64 VAL 64 113 113 VAL VAL A . n A 1 65 HIS 65 114 114 HIS HIS A . n A 1 66 THR 66 115 115 THR THR A . n A 1 67 ASP 67 116 116 ASP ASP A . n A 1 68 ASN 68 117 117 ASN ASN A . n A 1 69 GLY 69 118 118 GLY GLY A . n A 1 70 SER 70 119 119 SER SER A . n A 1 71 ASN 71 120 120 ASN ASN A . n A 1 72 PHE 72 121 121 PHE PHE A . n A 1 73 THR 73 122 122 THR THR A . n A 1 74 SER 74 123 123 SER SER A . n A 1 75 THR 75 124 124 THR THR A . n A 1 76 THR 76 125 125 THR THR A . n A 1 77 VAL 77 126 126 VAL VAL A . n A 1 78 LYS 78 127 127 LYS LYS A . n A 1 79 ALA 79 128 128 ALA ALA A . n A 1 80 ALA 80 129 129 ALA ALA A . n A 1 81 CYS 81 130 130 CYS CYS A . n A 1 82 TRP 82 131 131 TRP TRP A . n A 1 83 TRP 83 132 132 TRP TRP A . n A 1 84 ALA 84 133 133 ALA ALA A . n A 1 85 GLY 85 134 134 GLY GLY A . n A 1 86 ILE 86 135 135 ILE ILE A . n A 1 87 LYS 87 136 136 LYS LYS A . n A 1 88 GLN 88 137 137 GLN GLN A . n A 1 89 GLU 89 138 138 GLU GLU A . n A 1 90 PHE 90 139 139 PHE PHE A . n A 1 91 GLY 91 140 140 GLY GLY A . n A 1 92 ILE 92 141 141 ILE ILE A . n A 1 93 PRO 93 142 ? ? ? A . n A 1 94 TYR 94 143 ? ? ? A . n A 1 95 ASN 95 144 ? ? ? A . n A 1 96 PRO 96 145 ? ? ? A . n A 1 97 GLN 97 146 ? ? ? A . n A 1 98 SER 98 147 ? ? ? A . n A 1 99 GLN 99 148 ? ? ? A . n A 1 100 GLY 100 149 ? ? ? A . n A 1 101 VAL 101 150 ? ? ? A . n A 1 102 ILE 102 151 ? ? ? A . n A 1 103 GLU 103 152 152 GLU GLU A . n A 1 104 SER 104 153 153 SER SER A . n A 1 105 MET 105 154 154 MET MET A . n A 1 106 ASN 106 155 155 ASN ASN A . n A 1 107 LYS 107 156 156 LYS LYS A . n A 1 108 GLU 108 157 157 GLU GLU A . n A 1 109 LEU 109 158 158 LEU LEU A . n A 1 110 LYS 110 159 159 LYS LYS A . n A 1 111 LYS 111 160 160 LYS LYS A . n A 1 112 ILE 112 161 161 ILE ILE A . n A 1 113 ILE 113 162 162 ILE ILE A . n A 1 114 GLY 114 163 163 GLY GLY A . n A 1 115 GLN 115 164 164 GLN GLN A . n A 1 116 VAL 116 165 165 VAL VAL A . n A 1 117 ARG 117 166 166 ARG ARG A . n A 1 118 ASP 118 167 167 ASP ASP A . n A 1 119 GLN 119 168 168 GLN GLN A . n A 1 120 ALA 120 169 169 ALA ALA A . n A 1 121 GLU 121 170 170 GLU GLU A . n A 1 122 HIS 122 171 171 HIS HIS A . n A 1 123 LEU 123 172 172 LEU LEU A . n A 1 124 LYS 124 173 173 LYS LYS A . n A 1 125 THR 125 174 174 THR THR A . n A 1 126 ALA 126 175 175 ALA ALA A . n A 1 127 VAL 127 176 176 VAL VAL A . n A 1 128 GLN 128 177 177 GLN GLN A . n A 1 129 MET 129 178 178 MET MET A . n A 1 130 ALA 130 179 179 ALA ALA A . n A 1 131 VAL 131 180 180 VAL VAL A . n A 1 132 PHE 132 181 181 PHE PHE A . n A 1 133 ILE 133 182 182 ILE ILE A . n A 1 134 HIS 134 183 183 HIS HIS A . n A 1 135 ASN 135 184 184 ASN ASN A . n A 1 136 LYS 136 185 185 LYS LYS A . n A 1 137 LYS 137 186 186 LYS LYS A . n A 1 138 ARG 138 187 187 ARG ARG A . n A 1 139 LYS 139 188 188 LYS LYS A . n A 1 140 GLY 140 189 189 GLY GLY A . n A 1 141 GLY 141 190 190 GLY GLY A . n A 1 142 ILE 142 191 191 ILE ILE A . n A 1 143 GLY 143 192 192 GLY GLY A . n A 1 144 GLY 144 193 193 GLY GLY A . n A 1 145 TYR 145 194 194 TYR TYR A . n A 1 146 SER 146 195 195 SER SER A . n A 1 147 ALA 147 196 196 ALA ALA A . n A 1 148 GLY 148 197 197 GLY GLY A . n A 1 149 GLU 149 198 198 GLU GLU A . n A 1 150 ARG 150 199 199 ARG ARG A . n A 1 151 ILE 151 200 200 ILE ILE A . n A 1 152 VAL 152 201 201 VAL VAL A . n A 1 153 ASP 153 202 202 ASP ASP A . n A 1 154 ILE 154 203 203 ILE ILE A . n A 1 155 ILE 155 204 204 ILE ILE A . n A 1 156 ALA 156 205 205 ALA ALA A . n A 1 157 THR 157 206 206 THR THR A . n A 1 158 ASP 158 207 207 ASP ASP A . n A 1 159 ILE 159 208 208 ILE ILE A . n A 1 160 GLN 160 209 209 GLN GLN A . n A 1 161 THR 161 210 ? ? ? A . n A 1 162 LYS 162 211 ? ? ? A . n A 1 163 GLU 163 212 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ARS 1 301 1 ARS ARS A . C 2 ARS 1 302 2 ARS ARS A . D 3 SO4 1 303 1 SO4 SO4 A . E 3 SO4 1 304 1 SO4 SO4 A . F 4 0L9 1 305 1 0L9 0L9 A . G 5 HOH 1 401 1 HOH HOH A . G 5 HOH 2 402 2 HOH HOH A . G 5 HOH 3 403 5 HOH HOH A . G 5 HOH 4 404 6 HOH HOH A . G 5 HOH 5 405 7 HOH HOH A . G 5 HOH 6 406 8 HOH HOH A . G 5 HOH 7 407 9 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 188 ? CG ? A LYS 139 CG 2 1 Y 1 A LYS 188 ? CD ? A LYS 139 CD 3 1 Y 1 A LYS 188 ? CE ? A LYS 139 CE 4 1 Y 1 A LYS 188 ? NZ ? A LYS 139 NZ 5 1 Y 1 A ILE 191 ? CG1 ? A ILE 142 CG1 6 1 Y 1 A ILE 191 ? CG2 ? A ILE 142 CG2 7 1 Y 1 A ILE 191 ? CD1 ? A ILE 142 CD1 8 1 Y 1 A GLN 209 ? CG ? A GLN 160 CG 9 1 Y 1 A GLN 209 ? CD ? A GLN 160 CD 10 1 Y 1 A GLN 209 ? OE1 ? A GLN 160 OE1 11 1 Y 1 A GLN 209 ? NE2 ? A GLN 160 NE2 # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 PHASER 2.2.1 'Tue Aug 24 18:17:37 2010' program 'Randy J. Read' cimr-phaser@lists.cam.ac.uk phasing http://www-structmed.cimr.cam.ac.uk/phaser/ ? ? 4 REFMAC . ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 5 PDB_EXTRACT 3.10 'June 10, 2010' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 6 CrystalClear . ? ? ? ? 'data collection' ? ? ? # _cell.length_a 73.082 _cell.length_b 73.082 _cell.length_c 64.808 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 4DMN _cell.pdbx_unique_axis ? _cell.Z_PDB 6 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.entry_id 4DMN _symmetry.Int_Tables_number 152 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # _exptl.crystals_number 1 _exptl.entry_id 4DMN _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.79 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 55.90 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.temp 277.5 _exptl_crystal_grow.pdbx_details '10% PEG 8000, 0.1 M Na Cacodylate, pH 6.5, 0.1 M Ammonium Sulfate, Vapor Diffusion, hanging drop, temperature 277.5K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.pdbx_collection_date 2012-02-06 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator mirror _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.514 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type RIGAKU _diffrn_source.pdbx_wavelength_list 1.514 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? # _reflns.entry_id 4DMN _reflns.d_resolution_high 2.450 _reflns.d_resolution_low 50.000 _reflns.number_obs 7538 _reflns.pdbx_Rmerge_I_obs 0.044 _reflns.pdbx_netI_over_sigmaI 28.300 _reflns.pdbx_chi_squared 1.934 _reflns.pdbx_redundancy 6.900 _reflns.percent_possible_obs 98.500 _reflns.observed_criterion_sigma_F 3 _reflns.observed_criterion_sigma_I 3 _reflns.number_all 7638 _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.450 2.490 ? ? ? 0.563 ? ? 1.550 7.100 ? 372 100.000 1 1 2.490 2.540 ? ? ? 0.443 ? ? 1.605 7.000 ? 378 100.000 2 1 2.540 2.590 ? ? ? 0.366 ? ? 1.647 7.000 ? 379 100.000 3 1 2.590 2.640 ? ? ? 0.318 ? ? 1.661 7.000 ? 371 100.000 4 1 2.640 2.700 ? ? ? 0.269 ? ? 1.747 7.000 ? 373 100.000 5 1 2.700 2.760 ? ? ? 0.220 ? ? 1.690 7.000 ? 365 100.000 6 1 2.760 2.830 ? ? ? 0.179 ? ? 1.681 7.100 ? 380 100.000 7 1 2.830 2.900 ? ? ? 0.144 ? ? 1.803 7.000 ? 372 100.000 8 1 2.900 2.990 ? ? ? 0.105 ? ? 1.762 7.100 ? 371 100.000 9 1 2.990 3.090 ? ? ? 0.097 ? ? 1.866 7.000 ? 393 100.000 10 1 3.090 3.200 ? ? ? 0.074 ? ? 1.981 7.100 ? 370 100.000 11 1 3.200 3.320 ? ? ? 0.066 ? ? 2.000 7.100 ? 382 100.000 12 1 3.320 3.480 ? ? ? 0.052 ? ? 2.204 7.000 ? 392 100.000 13 1 3.480 3.660 ? ? ? 0.046 ? ? 2.353 6.900 ? 370 99.200 14 1 3.660 3.890 ? ? ? 0.040 ? ? 2.317 6.800 ? 370 98.400 15 1 3.890 4.190 ? ? ? 0.036 ? ? 2.319 6.600 ? 384 97.500 16 1 4.190 4.610 ? ? ? 0.034 ? ? 2.288 6.600 ? 357 91.300 17 1 4.610 5.280 ? ? ? 0.031 ? ? 2.268 6.500 ? 373 95.400 18 1 5.280 6.650 ? ? ? 0.029 ? ? 2.135 6.800 ? 394 98.300 19 1 6.650 50.000 ? ? ? 0.024 ? ? 1.891 6.000 ? 392 91.200 20 1 # _refine.entry_id 4DMN _refine.ls_d_res_high 2.4500 _refine.ls_d_res_low 28.44 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 98.2300 _refine.ls_number_reflns_obs 7501 _refine.ls_number_reflns_all 7638 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES: WITH TLS ADDED' _refine.ls_R_factor_obs 0.2330 _refine.ls_R_factor_R_work 0.2308 _refine.ls_wR_factor_R_work 0.2341 _refine.ls_R_factor_R_free 0.2763 _refine.ls_wR_factor_R_free 0.2798 _refine.ls_percent_reflns_R_free 4.6000 _refine.ls_number_reflns_R_free 346 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 70.5172 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 0.0600 _refine.aniso_B[2][2] 0.0600 _refine.aniso_B[3][3] -0.0800 _refine.aniso_B[1][2] 0.0300 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9410 _refine.correlation_coeff_Fo_to_Fc_free 0.9280 _refine.overall_SU_R_Cruickshank_DPI 0.3911 _refine.overall_SU_R_free 0.2782 _refine.pdbx_overall_ESU_R 0.3910 _refine.pdbx_overall_ESU_R_Free 0.2780 _refine.overall_SU_ML 0.2320 _refine.overall_SU_B 19.4740 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.4000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.7609 _refine.B_iso_max 157.800 _refine.B_iso_min 39.090 _refine.pdbx_overall_phase_error ? _refine.occupancy_max 1.000 _refine.occupancy_min 0.500 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.ls_R_factor_all ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1107 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 37 _refine_hist.number_atoms_solvent 7 _refine_hist.number_atoms_total 1151 _refine_hist.d_res_high 2.4500 _refine_hist.d_res_low 28.44 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 1170 0.019 0.022 ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1588 1.793 1.962 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 145 6.534 5.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 47 36.544 24.894 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 195 22.354 15.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 4 16.232 15.000 ? ? 'X-RAY DIFFRACTION' r_chiral_restr 176 0.114 0.200 ? ? 'X-RAY DIFFRACTION' r_gen_planes_refined 864 0.008 0.020 ? ? 'X-RAY DIFFRACTION' r_mcbond_it 717 0.932 1.500 ? ? 'X-RAY DIFFRACTION' r_mcangle_it 1149 1.738 2.000 ? ? 'X-RAY DIFFRACTION' r_scbond_it 453 2.376 3.000 ? ? 'X-RAY DIFFRACTION' r_scangle_it 438 3.685 4.500 ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.d_res_high 2.4500 _refine_ls_shell.d_res_low 2.5140 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 99.2600 _refine_ls_shell.number_reflns_R_work 514 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.3140 _refine_ls_shell.R_factor_R_free 0.3910 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 23 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 537 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4DMN _struct.title 'HIV-1 Integrase Catalytical Core Domain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4DMN _struct_keywords.text 'Integrase, CCD, DDE motif, dimer interface, VIRAL PROTEIN-Inhibitor complex' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN/Inhibitor' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POL_HV1N5 _struct_ref.pdbx_db_accession P12497 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAA CWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQ TKE ; _struct_ref.pdbx_align_begin 1197 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4DMN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 163 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P12497 _struct_ref_seq.db_align_beg 1197 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1359 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 50 _struct_ref_seq.pdbx_auth_seq_align_end 212 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 4DMN _struct_ref_seq_dif.mon_id LYS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 136 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P12497 _struct_ref_seq_dif.db_mon_id PHE _struct_ref_seq_dif.pdbx_seq_db_seq_num 1332 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 185 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 4610 ? 2 MORE -87 ? 2 'SSA (A^2)' 13540 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F,G 2 1,2 A,B,C,D,E,F,G # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 x-y,-y,-z+2/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 43.2053333333 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 44 ? GLY A 57 ? THR A 93 GLY A 106 1 ? 14 HELX_P HELX_P2 2 ASN A 68 ? THR A 73 ? ASN A 117 THR A 122 5 ? 6 HELX_P HELX_P3 3 SER A 74 ? GLY A 85 ? SER A 123 GLY A 134 1 ? 12 HELX_P HELX_P4 4 MET A 105 ? ARG A 117 ? MET A 154 ARG A 166 1 ? 13 HELX_P HELX_P5 5 ASP A 118 ? ALA A 120 ? ASP A 167 ALA A 169 5 ? 3 HELX_P HELX_P6 6 HIS A 122 ? LYS A 137 ? HIS A 171 LYS A 186 1 ? 16 HELX_P HELX_P7 7 SER A 146 ? ASP A 158 ? SER A 195 ASP A 207 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 103 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 152 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 SER _struct_mon_prot_cis.pdbx_label_seq_id_2 104 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 SER _struct_mon_prot_cis.pdbx_auth_seq_id_2 153 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -16.33 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 35 ? ILE A 40 ? ILE A 84 ILE A 89 A 2 LYS A 22 ? HIS A 29 ? LYS A 71 HIS A 78 A 3 ILE A 11 ? LEU A 19 ? ILE A 60 LEU A 68 A 4 THR A 63 ? HIS A 65 ? THR A 112 HIS A 114 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 38 ? O GLU A 87 N LEU A 25 ? N LEU A 74 A 2 3 O ILE A 24 ? O ILE A 73 N THR A 17 ? N THR A 66 A 3 4 N TRP A 12 ? N TRP A 61 O HIS A 65 ? O HIS A 114 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ARS 301 ? 2 'BINDING SITE FOR RESIDUE ARS A 301' AC2 Software A ARS 302 ? 1 'BINDING SITE FOR RESIDUE ARS A 302' AC3 Software A SO4 303 ? 3 'BINDING SITE FOR RESIDUE SO4 A 303' AC4 Software A SO4 304 ? 3 'BINDING SITE FOR RESIDUE SO4 A 304' AC5 Software A 0L9 305 ? 9 'BINDING SITE FOR RESIDUE 0L9 A 305' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 CYS A 16 ? CYS A 65 . ? 1_555 ? 2 AC1 2 ASN A 71 ? ASN A 120 . ? 1_555 ? 3 AC2 1 CYS A 81 ? CYS A 130 . ? 1_555 ? 4 AC3 3 CYS A 16 ? CYS A 65 . ? 1_555 ? 5 AC3 3 THR A 17 ? THR A 66 . ? 1_555 ? 6 AC3 3 HIS A 18 ? HIS A 67 . ? 1_555 ? 7 AC4 3 LYS A 22 ? LYS A 71 . ? 1_555 ? 8 AC4 3 HIS A 122 ? HIS A 171 . ? 1_555 ? 9 AC4 3 LEU A 123 ? LEU A 172 . ? 1_555 ? 10 AC5 9 THR A 75 ? THR A 124 . ? 1_555 ? 11 AC5 9 ALA A 79 ? ALA A 128 . ? 1_555 ? 12 AC5 9 ALA A 80 ? ALA A 129 . ? 1_555 ? 13 AC5 9 TRP A 83 ? TRP A 132 . ? 1_555 ? 14 AC5 9 PHE A 90 ? PHE A 139 . ? 2_565 ? 15 AC5 9 ALA A 120 ? ALA A 169 . ? 5_555 ? 16 AC5 9 GLU A 121 ? GLU A 170 . ? 5_555 ? 17 AC5 9 HIS A 122 ? HIS A 171 . ? 5_555 ? 18 AC5 9 THR A 125 ? THR A 174 . ? 5_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 153 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 N _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ASN _pdbx_validate_close_contact.auth_seq_id_2 155 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.18 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 74 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 74 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 74 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 129.55 _pdbx_validate_rmsd_angle.angle_target_value 115.30 _pdbx_validate_rmsd_angle.angle_deviation 14.25 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 137 ? ? -103.41 -125.39 2 1 GLU A 138 ? ? 177.92 124.80 3 1 MET A 154 ? ? 46.48 -39.83 4 1 LYS A 173 ? ? -26.02 -68.45 5 1 ASP A 207 ? ? -68.99 1.45 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -37.0682 9.7707 16.3750 0.2308 0.2522 0.1978 0.0186 0.0340 0.0449 0.7361 4.5448 3.1958 -0.7105 0.4306 0.7891 0.1777 -0.2258 0.0481 0.1277 0.1894 -0.0335 -0.3344 -0.1669 0.0522 'X-RAY DIFFRACTION' 2 ? refined -33.3998 11.3265 8.4695 0.7296 0.4896 0.5139 -0.1409 0.2931 -0.0937 -0.4311 -0.0067 -0.8082 2.0668 -3.4979 -6.3079 -0.1456 0.8008 -0.6551 0.4031 1.0977 0.2416 -1.3572 0.3479 0.6980 'X-RAY DIFFRACTION' 3 ? refined -30.3174 -4.5897 10.9897 0.3197 0.3185 0.2295 0.1213 0.1002 0.0233 9.0791 5.5176 4.8882 1.9872 3.2216 1.2926 -0.0300 0.0081 0.0219 0.6563 -0.5528 -0.7548 -0.7679 0.2916 0.6084 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 55 A 133 ? . . . . ? 'X-RAY DIFFRACTION' 2 2 A 134 A 159 ? . . . . ? 'X-RAY DIFFRACTION' 3 3 A 160 A 209 ? . . . . ? # _pdbx_phasing_MR.entry_id 4DMN _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.500 _pdbx_phasing_MR.d_res_low_rotation 28.440 _pdbx_phasing_MR.d_res_high_translation 2.500 _pdbx_phasing_MR.d_res_low_translation 28.440 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 50 ? A MET 1 2 1 Y 1 A HIS 51 ? A HIS 2 3 1 Y 1 A GLY 52 ? A GLY 3 4 1 Y 1 A GLN 53 ? A GLN 4 5 1 Y 1 A VAL 54 ? A VAL 5 6 1 Y 1 A PRO 142 ? A PRO 93 7 1 Y 1 A TYR 143 ? A TYR 94 8 1 Y 1 A ASN 144 ? A ASN 95 9 1 Y 1 A PRO 145 ? A PRO 96 10 1 Y 1 A GLN 146 ? A GLN 97 11 1 Y 1 A SER 147 ? A SER 98 12 1 Y 1 A GLN 148 ? A GLN 99 13 1 Y 1 A GLY 149 ? A GLY 100 14 1 Y 1 A VAL 150 ? A VAL 101 15 1 Y 1 A ILE 151 ? A ILE 102 16 1 Y 1 A THR 210 ? A THR 161 17 1 Y 1 A LYS 211 ? A LYS 162 18 1 Y 1 A GLU 212 ? A GLU 163 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 0L9 CL1 CL N N 1 0L9 C19 C Y N 2 0L9 C20 C Y N 3 0L9 C21 C Y N 4 0L9 C18 C Y N 5 0L9 C17 C Y N 6 0L9 C10 C Y N 7 0L9 C9 C Y N 8 0L9 C8 C Y N 9 0L9 C11 C N S 10 0L9 O13 O N N 11 0L9 C14 C N N 12 0L9 C12 C N N 13 0L9 O1 O N N 14 0L9 O2 O N N 15 0L9 C5 C Y N 16 0L9 C6 C Y N 17 0L9 C1 C Y N 18 0L9 BR BR N N 19 0L9 C2 C Y N 20 0L9 C3 C Y N 21 0L9 C4 C Y N 22 0L9 N N Y N 23 0L9 C7 C Y N 24 0L9 C16 C N N 25 0L9 H1 H N N 26 0L9 H2 H N N 27 0L9 H3 H N N 28 0L9 H4 H N N 29 0L9 H5 H N N 30 0L9 H6 H N N 31 0L9 H7 H N N 32 0L9 H8 H N N 33 0L9 H9 H N N 34 0L9 H10 H N N 35 0L9 H11 H N N 36 0L9 H12 H N N 37 0L9 H13 H N N 38 0L9 H14 H N N 39 0L9 H15 H N N 40 ALA N N N N 41 ALA CA C N S 42 ALA C C N N 43 ALA O O N N 44 ALA CB C N N 45 ALA OXT O N N 46 ALA H H N N 47 ALA H2 H N N 48 ALA HA H N N 49 ALA HB1 H N N 50 ALA HB2 H N N 51 ALA HB3 H N N 52 ALA HXT H N N 53 ARG N N N N 54 ARG CA C N S 55 ARG C C N N 56 ARG O O N N 57 ARG CB C N N 58 ARG CG C N N 59 ARG CD C N N 60 ARG NE N N N 61 ARG CZ C N N 62 ARG NH1 N N N 63 ARG NH2 N N N 64 ARG OXT O N N 65 ARG H H N N 66 ARG H2 H N N 67 ARG HA H N N 68 ARG HB2 H N N 69 ARG HB3 H N N 70 ARG HG2 H N N 71 ARG HG3 H N N 72 ARG HD2 H N N 73 ARG HD3 H N N 74 ARG HE H N N 75 ARG HH11 H N N 76 ARG HH12 H N N 77 ARG HH21 H N N 78 ARG HH22 H N N 79 ARG HXT H N N 80 ARS AS AS N N 81 ASN N N N N 82 ASN CA C N S 83 ASN C C N N 84 ASN O O N N 85 ASN CB C N N 86 ASN CG C N N 87 ASN OD1 O N N 88 ASN ND2 N N N 89 ASN OXT O N N 90 ASN H H N N 91 ASN H2 H N N 92 ASN HA H N N 93 ASN HB2 H N N 94 ASN HB3 H N N 95 ASN HD21 H N N 96 ASN HD22 H N N 97 ASN HXT H N N 98 ASP N N N N 99 ASP CA C N S 100 ASP C C N N 101 ASP O O N N 102 ASP CB C N N 103 ASP CG C N N 104 ASP OD1 O N N 105 ASP OD2 O N N 106 ASP OXT O N N 107 ASP H H N N 108 ASP H2 H N N 109 ASP HA H N N 110 ASP HB2 H N N 111 ASP HB3 H N N 112 ASP HD2 H N N 113 ASP HXT H N N 114 CYS N N N N 115 CYS CA C N R 116 CYS C C N N 117 CYS O O N N 118 CYS CB C N N 119 CYS SG S N N 120 CYS OXT O N N 121 CYS H H N N 122 CYS H2 H N N 123 CYS HA H N N 124 CYS HB2 H N N 125 CYS HB3 H N N 126 CYS HG H N N 127 CYS HXT H N N 128 GLN N N N N 129 GLN CA C N S 130 GLN C C N N 131 GLN O O N N 132 GLN CB C N N 133 GLN CG C N N 134 GLN CD C N N 135 GLN OE1 O N N 136 GLN NE2 N N N 137 GLN OXT O N N 138 GLN H H N N 139 GLN H2 H N N 140 GLN HA H N N 141 GLN HB2 H N N 142 GLN HB3 H N N 143 GLN HG2 H N N 144 GLN HG3 H N N 145 GLN HE21 H N N 146 GLN HE22 H N N 147 GLN HXT H N N 148 GLU N N N N 149 GLU CA C N S 150 GLU C C N N 151 GLU O O N N 152 GLU CB C N N 153 GLU CG C N N 154 GLU CD C N N 155 GLU OE1 O N N 156 GLU OE2 O N N 157 GLU OXT O N N 158 GLU H H N N 159 GLU H2 H N N 160 GLU HA H N N 161 GLU HB2 H N N 162 GLU HB3 H N N 163 GLU HG2 H N N 164 GLU HG3 H N N 165 GLU HE2 H N N 166 GLU HXT H N N 167 GLY N N N N 168 GLY CA C N N 169 GLY C C N N 170 GLY O O N N 171 GLY OXT O N N 172 GLY H H N N 173 GLY H2 H N N 174 GLY HA2 H N N 175 GLY HA3 H N N 176 GLY HXT H N N 177 HIS N N N N 178 HIS CA C N S 179 HIS C C N N 180 HIS O O N N 181 HIS CB C N N 182 HIS CG C Y N 183 HIS ND1 N Y N 184 HIS CD2 C Y N 185 HIS CE1 C Y N 186 HIS NE2 N Y N 187 HIS OXT O N N 188 HIS H H N N 189 HIS H2 H N N 190 HIS HA H N N 191 HIS HB2 H N N 192 HIS HB3 H N N 193 HIS HD1 H N N 194 HIS HD2 H N N 195 HIS HE1 H N N 196 HIS HE2 H N N 197 HIS HXT H N N 198 HOH O O N N 199 HOH H1 H N N 200 HOH H2 H N N 201 ILE N N N N 202 ILE CA C N S 203 ILE C C N N 204 ILE O O N N 205 ILE CB C N S 206 ILE CG1 C N N 207 ILE CG2 C N N 208 ILE CD1 C N N 209 ILE OXT O N N 210 ILE H H N N 211 ILE H2 H N N 212 ILE HA H N N 213 ILE HB H N N 214 ILE HG12 H N N 215 ILE HG13 H N N 216 ILE HG21 H N N 217 ILE HG22 H N N 218 ILE HG23 H N N 219 ILE HD11 H N N 220 ILE HD12 H N N 221 ILE HD13 H N N 222 ILE HXT H N N 223 LEU N N N N 224 LEU CA C N S 225 LEU C C N N 226 LEU O O N N 227 LEU CB C N N 228 LEU CG C N N 229 LEU CD1 C N N 230 LEU CD2 C N N 231 LEU OXT O N N 232 LEU H H N N 233 LEU H2 H N N 234 LEU HA H N N 235 LEU HB2 H N N 236 LEU HB3 H N N 237 LEU HG H N N 238 LEU HD11 H N N 239 LEU HD12 H N N 240 LEU HD13 H N N 241 LEU HD21 H N N 242 LEU HD22 H N N 243 LEU HD23 H N N 244 LEU HXT H N N 245 LYS N N N N 246 LYS CA C N S 247 LYS C C N N 248 LYS O O N N 249 LYS CB C N N 250 LYS CG C N N 251 LYS CD C N N 252 LYS CE C N N 253 LYS NZ N N N 254 LYS OXT O N N 255 LYS H H N N 256 LYS H2 H N N 257 LYS HA H N N 258 LYS HB2 H N N 259 LYS HB3 H N N 260 LYS HG2 H N N 261 LYS HG3 H N N 262 LYS HD2 H N N 263 LYS HD3 H N N 264 LYS HE2 H N N 265 LYS HE3 H N N 266 LYS HZ1 H N N 267 LYS HZ2 H N N 268 LYS HZ3 H N N 269 LYS HXT H N N 270 MET N N N N 271 MET CA C N S 272 MET C C N N 273 MET O O N N 274 MET CB C N N 275 MET CG C N N 276 MET SD S N N 277 MET CE C N N 278 MET OXT O N N 279 MET H H N N 280 MET H2 H N N 281 MET HA H N N 282 MET HB2 H N N 283 MET HB3 H N N 284 MET HG2 H N N 285 MET HG3 H N N 286 MET HE1 H N N 287 MET HE2 H N N 288 MET HE3 H N N 289 MET HXT H N N 290 PHE N N N N 291 PHE CA C N S 292 PHE C C N N 293 PHE O O N N 294 PHE CB C N N 295 PHE CG C Y N 296 PHE CD1 C Y N 297 PHE CD2 C Y N 298 PHE CE1 C Y N 299 PHE CE2 C Y N 300 PHE CZ C Y N 301 PHE OXT O N N 302 PHE H H N N 303 PHE H2 H N N 304 PHE HA H N N 305 PHE HB2 H N N 306 PHE HB3 H N N 307 PHE HD1 H N N 308 PHE HD2 H N N 309 PHE HE1 H N N 310 PHE HE2 H N N 311 PHE HZ H N N 312 PHE HXT H N N 313 PRO N N N N 314 PRO CA C N S 315 PRO C C N N 316 PRO O O N N 317 PRO CB C N N 318 PRO CG C N N 319 PRO CD C N N 320 PRO OXT O N N 321 PRO H H N N 322 PRO HA H N N 323 PRO HB2 H N N 324 PRO HB3 H N N 325 PRO HG2 H N N 326 PRO HG3 H N N 327 PRO HD2 H N N 328 PRO HD3 H N N 329 PRO HXT H N N 330 SER N N N N 331 SER CA C N S 332 SER C C N N 333 SER O O N N 334 SER CB C N N 335 SER OG O N N 336 SER OXT O N N 337 SER H H N N 338 SER H2 H N N 339 SER HA H N N 340 SER HB2 H N N 341 SER HB3 H N N 342 SER HG H N N 343 SER HXT H N N 344 SO4 S S N N 345 SO4 O1 O N N 346 SO4 O2 O N N 347 SO4 O3 O N N 348 SO4 O4 O N N 349 THR N N N N 350 THR CA C N S 351 THR C C N N 352 THR O O N N 353 THR CB C N R 354 THR OG1 O N N 355 THR CG2 C N N 356 THR OXT O N N 357 THR H H N N 358 THR H2 H N N 359 THR HA H N N 360 THR HB H N N 361 THR HG1 H N N 362 THR HG21 H N N 363 THR HG22 H N N 364 THR HG23 H N N 365 THR HXT H N N 366 TRP N N N N 367 TRP CA C N S 368 TRP C C N N 369 TRP O O N N 370 TRP CB C N N 371 TRP CG C Y N 372 TRP CD1 C Y N 373 TRP CD2 C Y N 374 TRP NE1 N Y N 375 TRP CE2 C Y N 376 TRP CE3 C Y N 377 TRP CZ2 C Y N 378 TRP CZ3 C Y N 379 TRP CH2 C Y N 380 TRP OXT O N N 381 TRP H H N N 382 TRP H2 H N N 383 TRP HA H N N 384 TRP HB2 H N N 385 TRP HB3 H N N 386 TRP HD1 H N N 387 TRP HE1 H N N 388 TRP HE3 H N N 389 TRP HZ2 H N N 390 TRP HZ3 H N N 391 TRP HH2 H N N 392 TRP HXT H N N 393 TYR N N N N 394 TYR CA C N S 395 TYR C C N N 396 TYR O O N N 397 TYR CB C N N 398 TYR CG C Y N 399 TYR CD1 C Y N 400 TYR CD2 C Y N 401 TYR CE1 C Y N 402 TYR CE2 C Y N 403 TYR CZ C Y N 404 TYR OH O N N 405 TYR OXT O N N 406 TYR H H N N 407 TYR H2 H N N 408 TYR HA H N N 409 TYR HB2 H N N 410 TYR HB3 H N N 411 TYR HD1 H N N 412 TYR HD2 H N N 413 TYR HE1 H N N 414 TYR HE2 H N N 415 TYR HH H N N 416 TYR HXT H N N 417 VAL N N N N 418 VAL CA C N S 419 VAL C C N N 420 VAL O O N N 421 VAL CB C N N 422 VAL CG1 C N N 423 VAL CG2 C N N 424 VAL OXT O N N 425 VAL H H N N 426 VAL H2 H N N 427 VAL HA H N N 428 VAL HB H N N 429 VAL HG11 H N N 430 VAL HG12 H N N 431 VAL HG13 H N N 432 VAL HG21 H N N 433 VAL HG22 H N N 434 VAL HG23 H N N 435 VAL HXT H N N 436 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 0L9 C14 O13 sing N N 1 0L9 C16 C7 sing N N 2 0L9 O13 C11 sing N N 3 0L9 N C7 doub Y N 4 0L9 N C4 sing Y N 5 0L9 C3 C4 doub Y N 6 0L9 C3 C2 sing Y N 7 0L9 C7 C8 sing Y N 8 0L9 C4 C5 sing Y N 9 0L9 C2 C1 doub Y N 10 0L9 C17 C18 doub Y N 11 0L9 C17 C10 sing Y N 12 0L9 C8 C11 sing N N 13 0L9 C8 C9 doub Y N 14 0L9 C5 C9 sing Y N 15 0L9 C5 C6 doub Y N 16 0L9 C1 C6 sing Y N 17 0L9 C1 BR sing N N 18 0L9 C18 C19 sing Y N 19 0L9 C11 C12 sing N N 20 0L9 C9 C10 sing N N 21 0L9 C10 C21 doub Y N 22 0L9 C19 CL1 sing N N 23 0L9 C19 C20 doub Y N 24 0L9 C12 O2 doub N N 25 0L9 C12 O1 sing N N 26 0L9 C21 C20 sing Y N 27 0L9 C20 H1 sing N N 28 0L9 C21 H2 sing N N 29 0L9 C18 H3 sing N N 30 0L9 C17 H4 sing N N 31 0L9 C11 H5 sing N N 32 0L9 C14 H6 sing N N 33 0L9 C14 H7 sing N N 34 0L9 C14 H8 sing N N 35 0L9 O1 H9 sing N N 36 0L9 C6 H10 sing N N 37 0L9 C2 H11 sing N N 38 0L9 C3 H12 sing N N 39 0L9 C16 H13 sing N N 40 0L9 C16 H14 sing N N 41 0L9 C16 H15 sing N N 42 ALA N CA sing N N 43 ALA N H sing N N 44 ALA N H2 sing N N 45 ALA CA C sing N N 46 ALA CA CB sing N N 47 ALA CA HA sing N N 48 ALA C O doub N N 49 ALA C OXT sing N N 50 ALA CB HB1 sing N N 51 ALA CB HB2 sing N N 52 ALA CB HB3 sing N N 53 ALA OXT HXT sing N N 54 ARG N CA sing N N 55 ARG N H sing N N 56 ARG N H2 sing N N 57 ARG CA C sing N N 58 ARG CA CB sing N N 59 ARG CA HA sing N N 60 ARG C O doub N N 61 ARG C OXT sing N N 62 ARG CB CG sing N N 63 ARG CB HB2 sing N N 64 ARG CB HB3 sing N N 65 ARG CG CD sing N N 66 ARG CG HG2 sing N N 67 ARG CG HG3 sing N N 68 ARG CD NE sing N N 69 ARG CD HD2 sing N N 70 ARG CD HD3 sing N N 71 ARG NE CZ sing N N 72 ARG NE HE sing N N 73 ARG CZ NH1 sing N N 74 ARG CZ NH2 doub N N 75 ARG NH1 HH11 sing N N 76 ARG NH1 HH12 sing N N 77 ARG NH2 HH21 sing N N 78 ARG NH2 HH22 sing N N 79 ARG OXT HXT sing N N 80 ASN N CA sing N N 81 ASN N H sing N N 82 ASN N H2 sing N N 83 ASN CA C sing N N 84 ASN CA CB sing N N 85 ASN CA HA sing N N 86 ASN C O doub N N 87 ASN C OXT sing N N 88 ASN CB CG sing N N 89 ASN CB HB2 sing N N 90 ASN CB HB3 sing N N 91 ASN CG OD1 doub N N 92 ASN CG ND2 sing N N 93 ASN ND2 HD21 sing N N 94 ASN ND2 HD22 sing N N 95 ASN OXT HXT sing N N 96 ASP N CA sing N N 97 ASP N H sing N N 98 ASP N H2 sing N N 99 ASP CA C sing N N 100 ASP CA CB sing N N 101 ASP CA HA sing N N 102 ASP C O doub N N 103 ASP C OXT sing N N 104 ASP CB CG sing N N 105 ASP CB HB2 sing N N 106 ASP CB HB3 sing N N 107 ASP CG OD1 doub N N 108 ASP CG OD2 sing N N 109 ASP OD2 HD2 sing N N 110 ASP OXT HXT sing N N 111 CYS N CA sing N N 112 CYS N H sing N N 113 CYS N H2 sing N N 114 CYS CA C sing N N 115 CYS CA CB sing N N 116 CYS CA HA sing N N 117 CYS C O doub N N 118 CYS C OXT sing N N 119 CYS CB SG sing N N 120 CYS CB HB2 sing N N 121 CYS CB HB3 sing N N 122 CYS SG HG sing N N 123 CYS OXT HXT sing N N 124 GLN N CA sing N N 125 GLN N H sing N N 126 GLN N H2 sing N N 127 GLN CA C sing N N 128 GLN CA CB sing N N 129 GLN CA HA sing N N 130 GLN C O doub N N 131 GLN C OXT sing N N 132 GLN CB CG sing N N 133 GLN CB HB2 sing N N 134 GLN CB HB3 sing N N 135 GLN CG CD sing N N 136 GLN CG HG2 sing N N 137 GLN CG HG3 sing N N 138 GLN CD OE1 doub N N 139 GLN CD NE2 sing N N 140 GLN NE2 HE21 sing N N 141 GLN NE2 HE22 sing N N 142 GLN OXT HXT sing N N 143 GLU N CA sing N N 144 GLU N H sing N N 145 GLU N H2 sing N N 146 GLU CA C sing N N 147 GLU CA CB sing N N 148 GLU CA HA sing N N 149 GLU C O doub N N 150 GLU C OXT sing N N 151 GLU CB CG sing N N 152 GLU CB HB2 sing N N 153 GLU CB HB3 sing N N 154 GLU CG CD sing N N 155 GLU CG HG2 sing N N 156 GLU CG HG3 sing N N 157 GLU CD OE1 doub N N 158 GLU CD OE2 sing N N 159 GLU OE2 HE2 sing N N 160 GLU OXT HXT sing N N 161 GLY N CA sing N N 162 GLY N H sing N N 163 GLY N H2 sing N N 164 GLY CA C sing N N 165 GLY CA HA2 sing N N 166 GLY CA HA3 sing N N 167 GLY C O doub N N 168 GLY C OXT sing N N 169 GLY OXT HXT sing N N 170 HIS N CA sing N N 171 HIS N H sing N N 172 HIS N H2 sing N N 173 HIS CA C sing N N 174 HIS CA CB sing N N 175 HIS CA HA sing N N 176 HIS C O doub N N 177 HIS C OXT sing N N 178 HIS CB CG sing N N 179 HIS CB HB2 sing N N 180 HIS CB HB3 sing N N 181 HIS CG ND1 sing Y N 182 HIS CG CD2 doub Y N 183 HIS ND1 CE1 doub Y N 184 HIS ND1 HD1 sing N N 185 HIS CD2 NE2 sing Y N 186 HIS CD2 HD2 sing N N 187 HIS CE1 NE2 sing Y N 188 HIS CE1 HE1 sing N N 189 HIS NE2 HE2 sing N N 190 HIS OXT HXT sing N N 191 HOH O H1 sing N N 192 HOH O H2 sing N N 193 ILE N CA sing N N 194 ILE N H sing N N 195 ILE N H2 sing N N 196 ILE CA C sing N N 197 ILE CA CB sing N N 198 ILE CA HA sing N N 199 ILE C O doub N N 200 ILE C OXT sing N N 201 ILE CB CG1 sing N N 202 ILE CB CG2 sing N N 203 ILE CB HB sing N N 204 ILE CG1 CD1 sing N N 205 ILE CG1 HG12 sing N N 206 ILE CG1 HG13 sing N N 207 ILE CG2 HG21 sing N N 208 ILE CG2 HG22 sing N N 209 ILE CG2 HG23 sing N N 210 ILE CD1 HD11 sing N N 211 ILE CD1 HD12 sing N N 212 ILE CD1 HD13 sing N N 213 ILE OXT HXT sing N N 214 LEU N CA sing N N 215 LEU N H sing N N 216 LEU N H2 sing N N 217 LEU CA C sing N N 218 LEU CA CB sing N N 219 LEU CA HA sing N N 220 LEU C O doub N N 221 LEU C OXT sing N N 222 LEU CB CG sing N N 223 LEU CB HB2 sing N N 224 LEU CB HB3 sing N N 225 LEU CG CD1 sing N N 226 LEU CG CD2 sing N N 227 LEU CG HG sing N N 228 LEU CD1 HD11 sing N N 229 LEU CD1 HD12 sing N N 230 LEU CD1 HD13 sing N N 231 LEU CD2 HD21 sing N N 232 LEU CD2 HD22 sing N N 233 LEU CD2 HD23 sing N N 234 LEU OXT HXT sing N N 235 LYS N CA sing N N 236 LYS N H sing N N 237 LYS N H2 sing N N 238 LYS CA C sing N N 239 LYS CA CB sing N N 240 LYS CA HA sing N N 241 LYS C O doub N N 242 LYS C OXT sing N N 243 LYS CB CG sing N N 244 LYS CB HB2 sing N N 245 LYS CB HB3 sing N N 246 LYS CG CD sing N N 247 LYS CG HG2 sing N N 248 LYS CG HG3 sing N N 249 LYS CD CE sing N N 250 LYS CD HD2 sing N N 251 LYS CD HD3 sing N N 252 LYS CE NZ sing N N 253 LYS CE HE2 sing N N 254 LYS CE HE3 sing N N 255 LYS NZ HZ1 sing N N 256 LYS NZ HZ2 sing N N 257 LYS NZ HZ3 sing N N 258 LYS OXT HXT sing N N 259 MET N CA sing N N 260 MET N H sing N N 261 MET N H2 sing N N 262 MET CA C sing N N 263 MET CA CB sing N N 264 MET CA HA sing N N 265 MET C O doub N N 266 MET C OXT sing N N 267 MET CB CG sing N N 268 MET CB HB2 sing N N 269 MET CB HB3 sing N N 270 MET CG SD sing N N 271 MET CG HG2 sing N N 272 MET CG HG3 sing N N 273 MET SD CE sing N N 274 MET CE HE1 sing N N 275 MET CE HE2 sing N N 276 MET CE HE3 sing N N 277 MET OXT HXT sing N N 278 PHE N CA sing N N 279 PHE N H sing N N 280 PHE N H2 sing N N 281 PHE CA C sing N N 282 PHE CA CB sing N N 283 PHE CA HA sing N N 284 PHE C O doub N N 285 PHE C OXT sing N N 286 PHE CB CG sing N N 287 PHE CB HB2 sing N N 288 PHE CB HB3 sing N N 289 PHE CG CD1 doub Y N 290 PHE CG CD2 sing Y N 291 PHE CD1 CE1 sing Y N 292 PHE CD1 HD1 sing N N 293 PHE CD2 CE2 doub Y N 294 PHE CD2 HD2 sing N N 295 PHE CE1 CZ doub Y N 296 PHE CE1 HE1 sing N N 297 PHE CE2 CZ sing Y N 298 PHE CE2 HE2 sing N N 299 PHE CZ HZ sing N N 300 PHE OXT HXT sing N N 301 PRO N CA sing N N 302 PRO N CD sing N N 303 PRO N H sing N N 304 PRO CA C sing N N 305 PRO CA CB sing N N 306 PRO CA HA sing N N 307 PRO C O doub N N 308 PRO C OXT sing N N 309 PRO CB CG sing N N 310 PRO CB HB2 sing N N 311 PRO CB HB3 sing N N 312 PRO CG CD sing N N 313 PRO CG HG2 sing N N 314 PRO CG HG3 sing N N 315 PRO CD HD2 sing N N 316 PRO CD HD3 sing N N 317 PRO OXT HXT sing N N 318 SER N CA sing N N 319 SER N H sing N N 320 SER N H2 sing N N 321 SER CA C sing N N 322 SER CA CB sing N N 323 SER CA HA sing N N 324 SER C O doub N N 325 SER C OXT sing N N 326 SER CB OG sing N N 327 SER CB HB2 sing N N 328 SER CB HB3 sing N N 329 SER OG HG sing N N 330 SER OXT HXT sing N N 331 SO4 S O1 doub N N 332 SO4 S O2 doub N N 333 SO4 S O3 sing N N 334 SO4 S O4 sing N N 335 THR N CA sing N N 336 THR N H sing N N 337 THR N H2 sing N N 338 THR CA C sing N N 339 THR CA CB sing N N 340 THR CA HA sing N N 341 THR C O doub N N 342 THR C OXT sing N N 343 THR CB OG1 sing N N 344 THR CB CG2 sing N N 345 THR CB HB sing N N 346 THR OG1 HG1 sing N N 347 THR CG2 HG21 sing N N 348 THR CG2 HG22 sing N N 349 THR CG2 HG23 sing N N 350 THR OXT HXT sing N N 351 TRP N CA sing N N 352 TRP N H sing N N 353 TRP N H2 sing N N 354 TRP CA C sing N N 355 TRP CA CB sing N N 356 TRP CA HA sing N N 357 TRP C O doub N N 358 TRP C OXT sing N N 359 TRP CB CG sing N N 360 TRP CB HB2 sing N N 361 TRP CB HB3 sing N N 362 TRP CG CD1 doub Y N 363 TRP CG CD2 sing Y N 364 TRP CD1 NE1 sing Y N 365 TRP CD1 HD1 sing N N 366 TRP CD2 CE2 doub Y N 367 TRP CD2 CE3 sing Y N 368 TRP NE1 CE2 sing Y N 369 TRP NE1 HE1 sing N N 370 TRP CE2 CZ2 sing Y N 371 TRP CE3 CZ3 doub Y N 372 TRP CE3 HE3 sing N N 373 TRP CZ2 CH2 doub Y N 374 TRP CZ2 HZ2 sing N N 375 TRP CZ3 CH2 sing Y N 376 TRP CZ3 HZ3 sing N N 377 TRP CH2 HH2 sing N N 378 TRP OXT HXT sing N N 379 TYR N CA sing N N 380 TYR N H sing N N 381 TYR N H2 sing N N 382 TYR CA C sing N N 383 TYR CA CB sing N N 384 TYR CA HA sing N N 385 TYR C O doub N N 386 TYR C OXT sing N N 387 TYR CB CG sing N N 388 TYR CB HB2 sing N N 389 TYR CB HB3 sing N N 390 TYR CG CD1 doub Y N 391 TYR CG CD2 sing Y N 392 TYR CD1 CE1 sing Y N 393 TYR CD1 HD1 sing N N 394 TYR CD2 CE2 doub Y N 395 TYR CD2 HD2 sing N N 396 TYR CE1 CZ doub Y N 397 TYR CE1 HE1 sing N N 398 TYR CE2 CZ sing Y N 399 TYR CE2 HE2 sing N N 400 TYR CZ OH sing N N 401 TYR OH HH sing N N 402 TYR OXT HXT sing N N 403 VAL N CA sing N N 404 VAL N H sing N N 405 VAL N H2 sing N N 406 VAL CA C sing N N 407 VAL CA CB sing N N 408 VAL CA HA sing N N 409 VAL C O doub N N 410 VAL C OXT sing N N 411 VAL CB CG1 sing N N 412 VAL CB CG2 sing N N 413 VAL CB HB sing N N 414 VAL CG1 HG11 sing N N 415 VAL CG1 HG12 sing N N 416 VAL CG1 HG13 sing N N 417 VAL CG2 HG21 sing N N 418 VAL CG2 HG22 sing N N 419 VAL CG2 HG23 sing N N 420 VAL OXT HXT sing N N 421 # _atom_sites.entry_id 4DMN _atom_sites.fract_transf_matrix[1][1] 0.013683 _atom_sites.fract_transf_matrix[1][2] 0.007900 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015800 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015430 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol AS BR C CL N O S # loop_