data_4IEW # _entry.id 4IEW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4IEW RCSB RCSB076665 WWPDB D_1000076665 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4IEO . unspecified PDB 4IEP . unspecified PDB 4IEQ . unspecified PDB 4IER . unspecified PDB 4IES . unspecified PDB 4IET . unspecified PDB 4IEU . unspecified PDB 4IEV . unspecified PDB 4IEX . unspecified PDB 4IEY . unspecified PDB 4IEZ . unspecified PDB 4IF0 . unspecified PDB 4IF1 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4IEW _pdbx_database_status.recvd_initial_deposition_date 2012-12-13 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Driggers, C.M.' 1 'Cooley, R.B.' 2 'Karplus, P.A.' 3 # _citation.id primary _citation.title ;Cysteine Dioxygenase Structures from pH4 to 9: Consistent Cys-Persulfenate Formation at Intermediate pH and a Cys-Bound Enzyme at Higher pH. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 425 _citation.page_first 3121 _citation.page_last 3136 _citation.year 2013 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23747973 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2013.05.028 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Driggers, C.M.' 1 primary 'Cooley, R.B.' 2 primary 'Sankaran, B.' 3 primary 'Hirschberger, L.L.' 4 primary 'Stipanuk, M.H.' 5 primary 'Karplus, P.A.' 6 # _cell.entry_id 4IEW _cell.length_a 57.600 _cell.length_b 57.600 _cell.length_c 122.400 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4IEW _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cysteine dioxygenase type 1' 23058.889 1 1.13.11.20 ? ? ? 2 non-polymer syn 'FE (II) ION' 55.845 1 ? ? ? ? 3 non-polymer syn CYSTEINE 121.158 1 ? ? ? ? 4 water nat water 18.015 256 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cysteine dioxygenase type I, CDO, CDO-I' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEG HGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPP FDTCHAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN ; _entity_poly.pdbx_seq_one_letter_code_can ;MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEG HGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPP FDTCHAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ARG n 1 4 THR n 1 5 GLU n 1 6 LEU n 1 7 LEU n 1 8 LYS n 1 9 PRO n 1 10 ARG n 1 11 THR n 1 12 LEU n 1 13 ALA n 1 14 ASP n 1 15 LEU n 1 16 ILE n 1 17 ARG n 1 18 ILE n 1 19 LEU n 1 20 HIS n 1 21 GLU n 1 22 LEU n 1 23 PHE n 1 24 ALA n 1 25 GLY n 1 26 ASP n 1 27 GLU n 1 28 VAL n 1 29 ASN n 1 30 VAL n 1 31 GLU n 1 32 GLU n 1 33 VAL n 1 34 GLN n 1 35 ALA n 1 36 VAL n 1 37 LEU n 1 38 GLU n 1 39 ALA n 1 40 TYR n 1 41 GLU n 1 42 SER n 1 43 ASN n 1 44 PRO n 1 45 ALA n 1 46 GLU n 1 47 TRP n 1 48 ALA n 1 49 LEU n 1 50 TYR n 1 51 ALA n 1 52 LYS n 1 53 PHE n 1 54 ASP n 1 55 GLN n 1 56 TYR n 1 57 ARG n 1 58 TYR n 1 59 THR n 1 60 ARG n 1 61 ASN n 1 62 LEU n 1 63 VAL n 1 64 ASP n 1 65 GLN n 1 66 GLY n 1 67 ASN n 1 68 GLY n 1 69 LYS n 1 70 PHE n 1 71 ASN n 1 72 LEU n 1 73 MET n 1 74 ILE n 1 75 LEU n 1 76 CYS n 1 77 TRP n 1 78 GLY n 1 79 GLU n 1 80 GLY n 1 81 HIS n 1 82 GLY n 1 83 SER n 1 84 SER n 1 85 ILE n 1 86 HIS n 1 87 ASP n 1 88 HIS n 1 89 THR n 1 90 ASP n 1 91 SER n 1 92 HIS n 1 93 CYS n 1 94 PHE n 1 95 LEU n 1 96 LYS n 1 97 LEU n 1 98 LEU n 1 99 GLN n 1 100 GLY n 1 101 ASN n 1 102 LEU n 1 103 LYS n 1 104 GLU n 1 105 THR n 1 106 LEU n 1 107 PHE n 1 108 ASP n 1 109 TRP n 1 110 PRO n 1 111 ASP n 1 112 LYS n 1 113 LYS n 1 114 SER n 1 115 ASN n 1 116 GLU n 1 117 MET n 1 118 ILE n 1 119 LYS n 1 120 LYS n 1 121 SER n 1 122 GLU n 1 123 ARG n 1 124 THR n 1 125 LEU n 1 126 ARG n 1 127 GLU n 1 128 ASN n 1 129 GLN n 1 130 CYS n 1 131 ALA n 1 132 TYR n 1 133 ILE n 1 134 ASN n 1 135 ASP n 1 136 SER n 1 137 ILE n 1 138 GLY n 1 139 LEU n 1 140 HIS n 1 141 ARG n 1 142 VAL n 1 143 GLU n 1 144 ASN n 1 145 VAL n 1 146 SER n 1 147 HIS n 1 148 THR n 1 149 GLU n 1 150 PRO n 1 151 ALA n 1 152 VAL n 1 153 SER n 1 154 LEU n 1 155 HIS n 1 156 LEU n 1 157 TYR n 1 158 SER n 1 159 PRO n 1 160 PRO n 1 161 PHE n 1 162 ASP n 1 163 THR n 1 164 CYS n 1 165 HIS n 1 166 ALA n 1 167 PHE n 1 168 ASP n 1 169 GLN n 1 170 ARG n 1 171 THR n 1 172 GLY n 1 173 HIS n 1 174 LYS n 1 175 ASN n 1 176 LYS n 1 177 VAL n 1 178 THR n 1 179 MET n 1 180 THR n 1 181 PHE n 1 182 HIS n 1 183 SER n 1 184 LYS n 1 185 PHE n 1 186 GLY n 1 187 ILE n 1 188 ARG n 1 189 THR n 1 190 PRO n 1 191 PHE n 1 192 THR n 1 193 THR n 1 194 SER n 1 195 GLY n 1 196 SER n 1 197 LEU n 1 198 GLU n 1 199 ASN n 1 200 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'brown rat,rat,rats' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Cdo1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CDO1_RAT _struct_ref.pdbx_db_accession P21816 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEG HGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPP FDTCHAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4IEW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 200 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P21816 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 200 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 200 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE2 non-polymer . 'FE (II) ION' ? 'Fe 2' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4IEW _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.20 _exptl_crystal.density_percent_sol 44.13 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.2 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;Purified enzyme was concentrated to ~8 mg/mL and then added into a crystallization screen containing 0.1 M tri-sodium citrate pH=5.6, 24-34% PEG 4K, and 0.1-0.25 M ammonium acetate. 1.5L of protein solution was added to each well and mixed with an equivalent volume of reservoir solution., pH 6.2, VAPOR DIFFUSION, HANGING DROP, temperature 298K ; # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2012-06-15 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'DOUBLE CRYSTAL, SI(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 8.2.1' _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 8.2.1 _diffrn_source.pdbx_wavelength 0.976 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4IEW _reflns.observed_criterion_sigma_I 0.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 34.000 _reflns.d_resolution_high 1.450 _reflns.number_obs 33886 _reflns.number_all ? _reflns.percent_possible_obs 88.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4IEW _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 32889 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.330 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 33.91 _refine.ls_d_res_high 1.45 _refine.ls_percent_reflns_obs 87.9 _refine.ls_R_factor_obs 0.154 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.149 _refine.ls_R_factor_R_free 0.199 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.740 _refine.ls_number_reflns_R_free 3202 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.200 _refine.pdbx_overall_phase_error 22.190 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1512 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.number_atoms_solvent 256 _refine_hist.number_atoms_total 1776 _refine_hist.d_res_high 1.45 _refine_hist.d_res_low 33.91 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.014 ? ? 1590 'X-RAY DIFFRACTION' ? f_angle_d 1.296 ? ? 2159 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 14.359 ? ? 594 'X-RAY DIFFRACTION' ? f_chiral_restr 0.083 ? ? 230 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 279 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 1.4500 1.4716 701 0.3524 48.00 0.3946 . . 74 . . 'X-RAY DIFFRACTION' . 1.4716 1.4946 1259 0.3169 88.00 0.3714 . . 123 . . 'X-RAY DIFFRACTION' . 1.4946 1.5191 965 0.3190 66.00 0.3571 . . 101 . . 'X-RAY DIFFRACTION' . 1.5191 1.5453 1310 0.2741 92.00 0.3680 . . 135 . . 'X-RAY DIFFRACTION' . 1.5453 1.5734 1424 0.2297 100.00 0.3165 . . 177 . . 'X-RAY DIFFRACTION' . 1.5734 1.6037 1416 0.1931 100.00 0.2847 . . 171 . . 'X-RAY DIFFRACTION' . 1.6037 1.6364 1455 0.1792 100.00 0.2397 . . 144 . . 'X-RAY DIFFRACTION' . 1.6364 1.6720 1434 0.1642 100.00 0.2383 . . 166 . . 'X-RAY DIFFRACTION' . 1.6720 1.7109 1237 0.1613 86.00 0.2541 . . 147 . . 'X-RAY DIFFRACTION' . 1.7109 1.7537 1323 0.1526 91.00 0.2501 . . 134 . . 'X-RAY DIFFRACTION' . 1.7537 1.8011 1449 0.1362 100.00 0.2704 . . 160 . . 'X-RAY DIFFRACTION' . 1.8011 1.8541 1478 0.1406 100.00 0.2556 . . 137 . . 'X-RAY DIFFRACTION' . 1.8541 1.9139 999 0.1705 69.00 0.2909 . . 108 . . 'X-RAY DIFFRACTION' . 1.9139 1.9823 1019 0.1362 69.00 0.2189 . . 112 . . 'X-RAY DIFFRACTION' . 1.9823 2.0617 1276 0.1245 89.00 0.2047 . . 146 . . 'X-RAY DIFFRACTION' . 2.0617 2.1555 1294 0.1262 89.00 0.1903 . . 139 . . 'X-RAY DIFFRACTION' . 2.1555 2.2691 1109 0.1251 75.00 0.1969 . . 106 . . 'X-RAY DIFFRACTION' . 2.2691 2.4113 1510 0.1355 100.00 0.1894 . . 136 . . 'X-RAY DIFFRACTION' . 2.4113 2.5974 1461 0.1409 100.00 0.2017 . . 173 . . 'X-RAY DIFFRACTION' . 2.5974 2.8587 1244 0.1454 84.00 0.2248 . . 140 . . 'X-RAY DIFFRACTION' . 2.8587 3.2720 1499 0.1431 100.00 0.1721 . . 169 . . 'X-RAY DIFFRACTION' . 3.2720 4.1213 1192 0.1339 77.00 0.1489 . . 126 . . 'X-RAY DIFFRACTION' . 4.1213 33.9162 1633 0.1539 100.00 0.1661 . . 178 . . # _struct.entry_id 4IEW _struct.title 'Cys-only bound Cysteine Dioxygenase at pH 9.0 in the presence of Cys' _struct.pdbx_descriptor 'Cysteine dioxygenase type 1 (E.C.1.13.11.20)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4IEW _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'Cupin fold, catalyzes oxidation, cysteine to cysteine sulfinate, C93-Y157 crosslink, Cytosol, OXIDOREDUCTASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 11 ? PHE A 23 ? THR A 11 PHE A 23 1 ? 13 HELX_P HELX_P2 2 ASN A 29 ? TYR A 40 ? ASN A 29 TYR A 40 1 ? 12 HELX_P HELX_P3 3 ASN A 43 ? ALA A 48 ? ASN A 43 ALA A 48 1 ? 6 HELX_P HELX_P4 4 LEU A 49 ? ALA A 51 ? LEU A 49 ALA A 51 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A CYS 93 SG ? ? ? 1_555 A TYR 157 CE2 ? ? A CYS 93 A TYR 157 1_555 ? ? ? ? ? ? ? 1.790 ? metalc1 metalc ? ? A HIS 86 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 86 A FE2 501 1_555 ? ? ? ? ? ? ? 1.980 ? metalc2 metalc ? ? A HIS 140 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 140 A FE2 501 1_555 ? ? ? ? ? ? ? 2.118 ? metalc3 metalc ? ? A HIS 88 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 88 A FE2 501 1_555 ? ? ? ? ? ? ? 2.188 ? metalc4 metalc ? ? B FE2 . FE ? ? ? 1_555 C CYS . N ? ? A FE2 501 A CYS 502 1_555 ? ? ? ? ? ? ? 2.244 ? metalc5 metalc ? ? B FE2 . FE ? ? ? 1_555 C CYS . SG ? ? A FE2 501 A CYS 502 1_555 ? ? ? ? ? ? ? 2.347 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 158 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 158 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 159 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 159 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -4.47 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 3 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 130 ? ILE A 133 ? CYS A 130 ILE A 133 A 2 HIS A 92 ? GLN A 99 ? HIS A 92 GLN A 99 A 3 ALA A 151 ? SER A 158 ? ALA A 151 SER A 158 A 4 ASN A 71 ? TRP A 77 ? ASN A 71 TRP A 77 A 5 THR A 59 ? ASP A 64 ? THR A 59 ASP A 64 A 6 SER A 183 ? LYS A 184 ? SER A 183 LYS A 184 A 7 ILE A 187 ? ARG A 188 ? ILE A 187 ARG A 188 B 1 ILE A 85 ? HIS A 86 ? ILE A 85 HIS A 86 B 2 THR A 163 ? PHE A 167 ? THR A 163 PHE A 167 B 3 LYS A 174 ? THR A 178 ? LYS A 174 THR A 178 C 1 LYS A 119 ? LEU A 125 ? LYS A 119 LEU A 125 C 2 LEU A 102 ? PHE A 107 ? LEU A 102 PHE A 107 C 3 LEU A 139 ? GLU A 143 ? LEU A 139 GLU A 143 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ALA A 131 ? O ALA A 131 N LEU A 95 ? N LEU A 95 A 2 3 N LYS A 96 ? N LYS A 96 O LEU A 154 ? O LEU A 154 A 3 4 O HIS A 155 ? O HIS A 155 N MET A 73 ? N MET A 73 A 4 5 O ILE A 74 ? O ILE A 74 N ASN A 61 ? N ASN A 61 A 5 6 N LEU A 62 ? N LEU A 62 O SER A 183 ? O SER A 183 A 6 7 N LYS A 184 ? N LYS A 184 O ILE A 187 ? O ILE A 187 B 1 2 N ILE A 85 ? N ILE A 85 O PHE A 167 ? O PHE A 167 B 2 3 N CYS A 164 ? N CYS A 164 O VAL A 177 ? O VAL A 177 C 1 2 O LEU A 125 ? O LEU A 125 N LEU A 102 ? N LEU A 102 C 2 3 N LYS A 103 ? N LYS A 103 O GLU A 143 ? O GLU A 143 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FE2 A 501' AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CYS A 502' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 86 ? HIS A 86 . ? 1_555 ? 2 AC1 4 HIS A 88 ? HIS A 88 . ? 1_555 ? 3 AC1 4 HIS A 140 ? HIS A 140 . ? 1_555 ? 4 AC1 4 CYS C . ? CYS A 502 . ? 1_555 ? 5 AC2 11 TYR A 58 ? TYR A 58 . ? 1_555 ? 6 AC2 11 ARG A 60 ? ARG A 60 . ? 1_555 ? 7 AC2 11 LEU A 75 ? LEU A 75 . ? 1_555 ? 8 AC2 11 HIS A 86 ? HIS A 86 . ? 1_555 ? 9 AC2 11 HIS A 88 ? HIS A 88 . ? 1_555 ? 10 AC2 11 HIS A 140 ? HIS A 140 . ? 1_555 ? 11 AC2 11 VAL A 142 ? VAL A 142 . ? 1_555 ? 12 AC2 11 HIS A 155 ? HIS A 155 . ? 1_555 ? 13 AC2 11 TYR A 157 ? TYR A 157 . ? 1_555 ? 14 AC2 11 MET A 179 ? MET A 179 . ? 1_555 ? 15 AC2 11 FE2 B . ? FE2 A 501 . ? 1_555 ? # _database_PDB_matrix.entry_id 4IEW _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4IEW _atom_sites.fract_transf_matrix[1][1] 0.017361 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017361 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008170 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 CYS 93 93 93 CYS CYS A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 MET 117 117 117 MET MET A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 HIS 140 140 140 HIS HIS A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 HIS 155 155 155 HIS HIS A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 PRO 159 159 159 PRO PRO A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 CYS 164 164 164 CYS CYS A . n A 1 165 HIS 165 165 165 HIS HIS A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 GLN 169 169 169 GLN GLN A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 MET 179 179 179 MET MET A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 PHE 181 181 181 PHE PHE A . n A 1 182 HIS 182 182 182 HIS HIS A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 PHE 185 185 185 PHE PHE A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 THR 189 189 189 THR THR A . n A 1 190 PRO 190 190 190 PRO PRO A . n A 1 191 PHE 191 191 ? ? ? A . n A 1 192 THR 192 192 ? ? ? A . n A 1 193 THR 193 193 ? ? ? A . n A 1 194 SER 194 194 ? ? ? A . n A 1 195 GLY 195 195 ? ? ? A . n A 1 196 SER 196 196 ? ? ? A . n A 1 197 LEU 197 197 ? ? ? A . n A 1 198 GLU 198 198 ? ? ? A . n A 1 199 ASN 199 199 ? ? ? A . n A 1 200 ASN 200 200 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE2 1 501 501 FE2 FE A . C 3 CYS 1 502 980 CYS CYS A . D 4 HOH 1 601 1 HOH HOH A . D 4 HOH 2 602 2 HOH HOH A . D 4 HOH 3 603 3 HOH HOH A . D 4 HOH 4 604 4 HOH HOH A . D 4 HOH 5 605 5 HOH HOH A . D 4 HOH 6 606 6 HOH HOH A . D 4 HOH 7 607 7 HOH HOH A . D 4 HOH 8 608 8 HOH HOH A . D 4 HOH 9 609 9 HOH HOH A . D 4 HOH 10 610 10 HOH HOH A . D 4 HOH 11 611 11 HOH HOH A . D 4 HOH 12 612 12 HOH HOH A . D 4 HOH 13 613 13 HOH HOH A . D 4 HOH 14 614 14 HOH HOH A . D 4 HOH 15 615 15 HOH HOH A . D 4 HOH 16 616 16 HOH HOH A . D 4 HOH 17 617 17 HOH HOH A . D 4 HOH 18 618 18 HOH HOH A . D 4 HOH 19 619 19 HOH HOH A . D 4 HOH 20 620 20 HOH HOH A . D 4 HOH 21 621 21 HOH HOH A . D 4 HOH 22 622 22 HOH HOH A . D 4 HOH 23 623 23 HOH HOH A . D 4 HOH 24 624 24 HOH HOH A . D 4 HOH 25 625 25 HOH HOH A . D 4 HOH 26 626 26 HOH HOH A . D 4 HOH 27 627 27 HOH HOH A . D 4 HOH 28 628 28 HOH HOH A . D 4 HOH 29 629 29 HOH HOH A . D 4 HOH 30 630 30 HOH HOH A . D 4 HOH 31 631 31 HOH HOH A . D 4 HOH 32 632 32 HOH HOH A . D 4 HOH 33 633 33 HOH HOH A . D 4 HOH 34 634 34 HOH HOH A . D 4 HOH 35 635 35 HOH HOH A . D 4 HOH 36 636 36 HOH HOH A . D 4 HOH 37 637 37 HOH HOH A . D 4 HOH 38 638 38 HOH HOH A . D 4 HOH 39 639 39 HOH HOH A . D 4 HOH 40 640 40 HOH HOH A . D 4 HOH 41 641 41 HOH HOH A . D 4 HOH 42 642 42 HOH HOH A . D 4 HOH 43 643 43 HOH HOH A . D 4 HOH 44 644 44 HOH HOH A . D 4 HOH 45 645 45 HOH HOH A . D 4 HOH 46 646 46 HOH HOH A . D 4 HOH 47 647 47 HOH HOH A . D 4 HOH 48 648 48 HOH HOH A . D 4 HOH 49 649 49 HOH HOH A . D 4 HOH 50 650 50 HOH HOH A . D 4 HOH 51 651 51 HOH HOH A . D 4 HOH 52 652 52 HOH HOH A . D 4 HOH 53 653 53 HOH HOH A . D 4 HOH 54 654 54 HOH HOH A . D 4 HOH 55 655 55 HOH HOH A . D 4 HOH 56 656 56 HOH HOH A . D 4 HOH 57 657 57 HOH HOH A . D 4 HOH 58 658 58 HOH HOH A . D 4 HOH 59 659 59 HOH HOH A . D 4 HOH 60 660 60 HOH HOH A . D 4 HOH 61 661 61 HOH HOH A . D 4 HOH 62 662 62 HOH HOH A . D 4 HOH 63 663 63 HOH HOH A . D 4 HOH 64 664 64 HOH HOH A . D 4 HOH 65 665 65 HOH HOH A . D 4 HOH 66 666 66 HOH HOH A . D 4 HOH 67 667 67 HOH HOH A . D 4 HOH 68 668 68 HOH HOH A . D 4 HOH 69 669 69 HOH HOH A . D 4 HOH 70 670 70 HOH HOH A . D 4 HOH 71 671 71 HOH HOH A . D 4 HOH 72 672 72 HOH HOH A . D 4 HOH 73 673 73 HOH HOH A . D 4 HOH 74 674 74 HOH HOH A . D 4 HOH 75 675 75 HOH HOH A . D 4 HOH 76 676 76 HOH HOH A . D 4 HOH 77 677 77 HOH HOH A . D 4 HOH 78 678 78 HOH HOH A . D 4 HOH 79 679 79 HOH HOH A . D 4 HOH 80 680 80 HOH HOH A . D 4 HOH 81 681 81 HOH HOH A . D 4 HOH 82 682 82 HOH HOH A . D 4 HOH 83 683 83 HOH HOH A . D 4 HOH 84 684 84 HOH HOH A . D 4 HOH 85 685 85 HOH HOH A . D 4 HOH 86 686 86 HOH HOH A . D 4 HOH 87 687 87 HOH HOH A . D 4 HOH 88 688 88 HOH HOH A . D 4 HOH 89 689 89 HOH HOH A . D 4 HOH 90 690 90 HOH HOH A . D 4 HOH 91 691 91 HOH HOH A . D 4 HOH 92 692 92 HOH HOH A . D 4 HOH 93 693 93 HOH HOH A . D 4 HOH 94 694 94 HOH HOH A . D 4 HOH 95 695 95 HOH HOH A . D 4 HOH 96 696 96 HOH HOH A . D 4 HOH 97 697 97 HOH HOH A . D 4 HOH 98 698 98 HOH HOH A . D 4 HOH 99 699 99 HOH HOH A . D 4 HOH 100 700 100 HOH HOH A . D 4 HOH 101 701 101 HOH HOH A . D 4 HOH 102 702 102 HOH HOH A . D 4 HOH 103 703 103 HOH HOH A . D 4 HOH 104 704 104 HOH HOH A . D 4 HOH 105 705 105 HOH HOH A . D 4 HOH 106 706 106 HOH HOH A . D 4 HOH 107 707 107 HOH HOH A . D 4 HOH 108 708 108 HOH HOH A . D 4 HOH 109 709 109 HOH HOH A . D 4 HOH 110 710 110 HOH HOH A . D 4 HOH 111 711 111 HOH HOH A . D 4 HOH 112 712 112 HOH HOH A . D 4 HOH 113 713 113 HOH HOH A . D 4 HOH 114 714 114 HOH HOH A . D 4 HOH 115 715 115 HOH HOH A . D 4 HOH 116 716 116 HOH HOH A . D 4 HOH 117 717 118 HOH HOH A . D 4 HOH 118 718 119 HOH HOH A . D 4 HOH 119 719 120 HOH HOH A . D 4 HOH 120 720 121 HOH HOH A . D 4 HOH 121 721 122 HOH HOH A . D 4 HOH 122 722 123 HOH HOH A . D 4 HOH 123 723 124 HOH HOH A . D 4 HOH 124 724 125 HOH HOH A . D 4 HOH 125 725 126 HOH HOH A . D 4 HOH 126 726 127 HOH HOH A . D 4 HOH 127 727 128 HOH HOH A . D 4 HOH 128 728 129 HOH HOH A . D 4 HOH 129 729 130 HOH HOH A . D 4 HOH 130 730 131 HOH HOH A . D 4 HOH 131 731 132 HOH HOH A . D 4 HOH 132 732 133 HOH HOH A . D 4 HOH 133 733 134 HOH HOH A . D 4 HOH 134 734 135 HOH HOH A . D 4 HOH 135 735 136 HOH HOH A . D 4 HOH 136 736 137 HOH HOH A . D 4 HOH 137 737 138 HOH HOH A . D 4 HOH 138 738 139 HOH HOH A . D 4 HOH 139 739 140 HOH HOH A . D 4 HOH 140 740 141 HOH HOH A . D 4 HOH 141 741 143 HOH HOH A . D 4 HOH 142 742 144 HOH HOH A . D 4 HOH 143 743 145 HOH HOH A . D 4 HOH 144 744 146 HOH HOH A . D 4 HOH 145 745 147 HOH HOH A . D 4 HOH 146 746 148 HOH HOH A . D 4 HOH 147 747 149 HOH HOH A . D 4 HOH 148 748 150 HOH HOH A . D 4 HOH 149 749 151 HOH HOH A . D 4 HOH 150 750 152 HOH HOH A . D 4 HOH 151 751 153 HOH HOH A . D 4 HOH 152 752 154 HOH HOH A . D 4 HOH 153 753 155 HOH HOH A . D 4 HOH 154 754 156 HOH HOH A . D 4 HOH 155 755 157 HOH HOH A . D 4 HOH 156 756 158 HOH HOH A . D 4 HOH 157 757 159 HOH HOH A . D 4 HOH 158 758 162 HOH HOH A . D 4 HOH 159 759 163 HOH HOH A . D 4 HOH 160 760 164 HOH HOH A . D 4 HOH 161 761 166 HOH HOH A . D 4 HOH 162 762 167 HOH HOH A . D 4 HOH 163 763 168 HOH HOH A . D 4 HOH 164 764 169 HOH HOH A . D 4 HOH 165 765 170 HOH HOH A . D 4 HOH 166 766 171 HOH HOH A . D 4 HOH 167 767 172 HOH HOH A . D 4 HOH 168 768 173 HOH HOH A . D 4 HOH 169 769 174 HOH HOH A . D 4 HOH 170 770 176 HOH HOH A . D 4 HOH 171 771 177 HOH HOH A . D 4 HOH 172 772 178 HOH HOH A . D 4 HOH 173 773 179 HOH HOH A . D 4 HOH 174 774 180 HOH HOH A . D 4 HOH 175 775 181 HOH HOH A . D 4 HOH 176 776 182 HOH HOH A . D 4 HOH 177 777 183 HOH HOH A . D 4 HOH 178 778 184 HOH HOH A . D 4 HOH 179 779 185 HOH HOH A . D 4 HOH 180 780 186 HOH HOH A . D 4 HOH 181 781 187 HOH HOH A . D 4 HOH 182 782 189 HOH HOH A . D 4 HOH 183 783 190 HOH HOH A . D 4 HOH 184 784 191 HOH HOH A . D 4 HOH 185 785 192 HOH HOH A . D 4 HOH 186 786 193 HOH HOH A . D 4 HOH 187 787 195 HOH HOH A . D 4 HOH 188 788 196 HOH HOH A . D 4 HOH 189 789 197 HOH HOH A . D 4 HOH 190 790 198 HOH HOH A . D 4 HOH 191 791 200 HOH HOH A . D 4 HOH 192 792 201 HOH HOH A . D 4 HOH 193 793 202 HOH HOH A . D 4 HOH 194 794 203 HOH HOH A . D 4 HOH 195 795 204 HOH HOH A . D 4 HOH 196 796 205 HOH HOH A . D 4 HOH 197 797 206 HOH HOH A . D 4 HOH 198 798 207 HOH HOH A . D 4 HOH 199 799 208 HOH HOH A . D 4 HOH 200 800 209 HOH HOH A . D 4 HOH 201 801 210 HOH HOH A . D 4 HOH 202 802 211 HOH HOH A . D 4 HOH 203 803 212 HOH HOH A . D 4 HOH 204 804 213 HOH HOH A . D 4 HOH 205 805 214 HOH HOH A . D 4 HOH 206 806 215 HOH HOH A . D 4 HOH 207 807 216 HOH HOH A . D 4 HOH 208 808 217 HOH HOH A . D 4 HOH 209 809 218 HOH HOH A . D 4 HOH 210 810 219 HOH HOH A . D 4 HOH 211 811 220 HOH HOH A . D 4 HOH 212 812 221 HOH HOH A . D 4 HOH 213 813 222 HOH HOH A . D 4 HOH 214 814 223 HOH HOH A . D 4 HOH 215 815 225 HOH HOH A . D 4 HOH 216 816 227 HOH HOH A . D 4 HOH 217 817 228 HOH HOH A . D 4 HOH 218 818 230 HOH HOH A . D 4 HOH 219 819 231 HOH HOH A . D 4 HOH 220 820 233 HOH HOH A . D 4 HOH 221 821 234 HOH HOH A . D 4 HOH 222 822 235 HOH HOH A . D 4 HOH 223 823 236 HOH HOH A . D 4 HOH 224 824 237 HOH HOH A . D 4 HOH 225 825 238 HOH HOH A . D 4 HOH 226 826 239 HOH HOH A . D 4 HOH 227 827 240 HOH HOH A . D 4 HOH 228 828 241 HOH HOH A . D 4 HOH 229 829 242 HOH HOH A . D 4 HOH 230 830 243 HOH HOH A . D 4 HOH 231 831 244 HOH HOH A . D 4 HOH 232 832 245 HOH HOH A . D 4 HOH 233 833 246 HOH HOH A . D 4 HOH 234 834 247 HOH HOH A . D 4 HOH 235 835 248 HOH HOH A . D 4 HOH 236 836 250 HOH HOH A . D 4 HOH 237 837 251 HOH HOH A . D 4 HOH 238 838 252 HOH HOH A . D 4 HOH 239 839 253 HOH HOH A . D 4 HOH 240 840 254 HOH HOH A . D 4 HOH 241 841 255 HOH HOH A . D 4 HOH 242 842 256 HOH HOH A . D 4 HOH 243 843 257 HOH HOH A . D 4 HOH 244 844 258 HOH HOH A . D 4 HOH 245 845 259 HOH HOH A . D 4 HOH 246 846 260 HOH HOH A . D 4 HOH 247 847 261 HOH HOH A . D 4 HOH 248 848 263 HOH HOH A . D 4 HOH 249 849 264 HOH HOH A . D 4 HOH 250 850 265 HOH HOH A . D 4 HOH 251 851 266 HOH HOH A . D 4 HOH 252 852 267 HOH HOH A . D 4 HOH 253 853 268 HOH HOH A . D 4 HOH 254 854 269 HOH HOH A . D 4 HOH 255 855 270 HOH HOH A . D 4 HOH 256 856 271 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 837 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 96.3 ? 2 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 100.1 ? 3 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 90.0 ? 4 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 N ? C CYS . ? A CYS 502 ? 1_555 93.1 ? 5 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 N ? C CYS . ? A CYS 502 ? 1_555 170.5 ? 6 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 N ? C CYS . ? A CYS 502 ? 1_555 89.7 ? 7 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 SG ? C CYS . ? A CYS 502 ? 1_555 107.7 ? 8 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 SG ? C CYS . ? A CYS 502 ? 1_555 92.3 ? 9 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 SG ? C CYS . ? A CYS 502 ? 1_555 151.6 ? 10 N ? C CYS . ? A CYS 502 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 SG ? C CYS . ? A CYS 502 ? 1_555 83.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-06-26 2 'Structure model' 1 1 2013-08-21 3 'Structure model' 1 2 2013-09-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal ADSC 'data collection' Quantum ? 1 PHENIX 'model building' '(phenix.refine: 1.8_1069)' ? 2 PHENIX refinement '(phenix.refine: 1.8_1069)' ? 3 MOSFLM 'data reduction' . ? 4 SCALA 'data scaling' . ? 5 PHENIX phasing 1.8_1069 ? 6 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 128 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 74.11 _pdbx_validate_torsion.psi -7.67 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A PHE 191 ? A PHE 191 6 1 Y 1 A THR 192 ? A THR 192 7 1 Y 1 A THR 193 ? A THR 193 8 1 Y 1 A SER 194 ? A SER 194 9 1 Y 1 A GLY 195 ? A GLY 195 10 1 Y 1 A SER 196 ? A SER 196 11 1 Y 1 A LEU 197 ? A LEU 197 12 1 Y 1 A GLU 198 ? A GLU 198 13 1 Y 1 A ASN 199 ? A ASN 199 14 1 Y 1 A ASN 200 ? A ASN 200 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (II) ION' FE2 3 CYSTEINE CYS 4 water HOH #