data_4PAC # _entry.id 4PAC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4PAC pdb_00004pac 10.2210/pdb4pac/pdb WWPDB D_1000201020 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-05-20 2 'Structure model' 2 0 2017-09-06 3 'Structure model' 2 1 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' pdbx_audit_support 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.B_iso_or_equiv' 2 2 'Structure model' '_atom_site.Cartn_x' 3 2 'Structure model' '_atom_site.Cartn_y' 4 2 'Structure model' '_atom_site.Cartn_z' 5 2 'Structure model' '_pdbx_audit_support.funding_organization' 6 3 'Structure model' '_database_2.pdbx_DOI' 7 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 4PAC _pdbx_database_status.recvd_initial_deposition_date 2014-04-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs . _pdbx_database_status.methods_development_category . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB ;Crystal structure of histidine-containing phosphotransfer protein AHP1 in complex with histidine kinase AHK5 from Arabidopsis thaliana ; 4EUK unspecified PDB 'Crystal Structure of Histidine-containing Phosphotransfer Protein MtHPt1 from Medicago truncatula' 3US6 unspecified PDB 'Subatomic Resolution Crystal Structure of Histidine-containing Phosphotransfer Protein MtHPt2 from Medicago truncatula' 4G78 unspecified PDB 'Crystal Structure of Histidine-containing Phosphotransfer Protein, ZmHP2, from maize' 1WN0 unspecified PDB 'X-RAY STRUCTURE OF PUTATIVE HISTIDINE-CONTAINING PHOSPHOTRANSFER PROTEIN FROM RICE, AK104879' 1YVI unspecified PDB 'ENSEMBLE REFINEMENT OF THE CRYSTAL STRUCTURE OF PUTATIVE HISTIDINE-CONTAINING PHOSPHOTRANSFER PROTEIN FROM RICE, AK104879' 2Q4F unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Degtjarik, O.' 1 'Dopitova, R.' 2 'Puehringer, S.' 3 'Weiss, M.S.' 4 'Janda, L.' 5 'Hejatko, J.' 6 'Kuta-Smatanova, I.' 7 # _citation.abstract . _citation.abstract_id_CAS . _citation.book_id_ISBN . _citation.book_publisher . _citation.book_publisher_city . _citation.book_title . _citation.coordinate_linkage . _citation.country ? _citation.database_id_Medline . _citation.details . _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full . _citation.journal_issue . _citation.journal_volume . _citation.language . _citation.page_first . _citation.page_last . _citation.title 'Crystal structure of AHP2 from Arabidopsis thaliana' _citation.year . _citation.database_id_CSD . _citation.pdbx_database_id_DOI . _citation.pdbx_database_id_PubMed . _citation.unpublished_flag . # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Degtjarik, O.' 1 ? primary 'Dopitova, R.' 2 ? primary 'Puehringer, S.' 3 ? primary 'Reha, D.' 4 ? primary 'Otrusinova, O.' 5 ? primary 'Pekarova, B.' 6 ? primary 'Kuty, M.' 7 ? primary 'Zidek, L.' 8 ? primary 'Janda, L.' 9 ? primary 'Weiss, M.S.' 10 ? primary 'Kuta-Smatanova, I.' 11 ? primary 'Hejatko, H.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Histidine-containing phosphotransfer protein 2' 22369.232 1 ? ? ? ? 2 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' 195.237 1 ? ? ? ? 3 non-polymer syn IMIDAZOLE 69.085 1 ? ? ? ? 4 water nat water 18.015 18 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPSSRSAAGTMEFMDALIAQLQRQFRDYTISLYQQGFLDDQFTELKKLQ DDGSPDFVSEVLSLFFEDCVKLISNMARALDTTGTVDFSQVGASVHQLKGSSSSVGAKRVKTLCVSFKECCEAKNYEGCV RCLQQVDIEYKALKTKLQDMFNLEKQIIQAGGIVPQVDIN ; _entity_poly.pdbx_seq_one_letter_code_can ;MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPSSRSAAGTMEFMDALIAQLQRQFRDYTISLYQQGFLDDQFTELKKLQ DDGSPDFVSEVLSLFFEDCVKLISNMARALDTTGTVDFSQVGASVHQLKGSSSSVGAKRVKTLCVSFKECCEAKNYEGCV RCLQQVDIEYKALKTKLQDMFNLEKQIIQAGGIVPQVDIN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' MES 3 IMIDAZOLE IMD 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 GLY n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 GLY n 1 12 MET n 1 13 ALA n 1 14 SER n 1 15 MET n 1 16 THR n 1 17 GLY n 1 18 GLY n 1 19 GLN n 1 20 GLN n 1 21 MET n 1 22 GLY n 1 23 ARG n 1 24 ASP n 1 25 LEU n 1 26 TYR n 1 27 ASP n 1 28 ASP n 1 29 ASP n 1 30 ASP n 1 31 LYS n 1 32 ASP n 1 33 PRO n 1 34 SER n 1 35 SER n 1 36 ARG n 1 37 SER n 1 38 ALA n 1 39 ALA n 1 40 GLY n 1 41 THR n 1 42 MET n 1 43 GLU n 1 44 PHE n 1 45 MET n 1 46 ASP n 1 47 ALA n 1 48 LEU n 1 49 ILE n 1 50 ALA n 1 51 GLN n 1 52 LEU n 1 53 GLN n 1 54 ARG n 1 55 GLN n 1 56 PHE n 1 57 ARG n 1 58 ASP n 1 59 TYR n 1 60 THR n 1 61 ILE n 1 62 SER n 1 63 LEU n 1 64 TYR n 1 65 GLN n 1 66 GLN n 1 67 GLY n 1 68 PHE n 1 69 LEU n 1 70 ASP n 1 71 ASP n 1 72 GLN n 1 73 PHE n 1 74 THR n 1 75 GLU n 1 76 LEU n 1 77 LYS n 1 78 LYS n 1 79 LEU n 1 80 GLN n 1 81 ASP n 1 82 ASP n 1 83 GLY n 1 84 SER n 1 85 PRO n 1 86 ASP n 1 87 PHE n 1 88 VAL n 1 89 SER n 1 90 GLU n 1 91 VAL n 1 92 LEU n 1 93 SER n 1 94 LEU n 1 95 PHE n 1 96 PHE n 1 97 GLU n 1 98 ASP n 1 99 CYS n 1 100 VAL n 1 101 LYS n 1 102 LEU n 1 103 ILE n 1 104 SER n 1 105 ASN n 1 106 MET n 1 107 ALA n 1 108 ARG n 1 109 ALA n 1 110 LEU n 1 111 ASP n 1 112 THR n 1 113 THR n 1 114 GLY n 1 115 THR n 1 116 VAL n 1 117 ASP n 1 118 PHE n 1 119 SER n 1 120 GLN n 1 121 VAL n 1 122 GLY n 1 123 ALA n 1 124 SER n 1 125 VAL n 1 126 HIS n 1 127 GLN n 1 128 LEU n 1 129 LYS n 1 130 GLY n 1 131 SER n 1 132 SER n 1 133 SER n 1 134 SER n 1 135 VAL n 1 136 GLY n 1 137 ALA n 1 138 LYS n 1 139 ARG n 1 140 VAL n 1 141 LYS n 1 142 THR n 1 143 LEU n 1 144 CYS n 1 145 VAL n 1 146 SER n 1 147 PHE n 1 148 LYS n 1 149 GLU n 1 150 CYS n 1 151 CYS n 1 152 GLU n 1 153 ALA n 1 154 LYS n 1 155 ASN n 1 156 TYR n 1 157 GLU n 1 158 GLY n 1 159 CYS n 1 160 VAL n 1 161 ARG n 1 162 CYS n 1 163 LEU n 1 164 GLN n 1 165 GLN n 1 166 VAL n 1 167 ASP n 1 168 ILE n 1 169 GLU n 1 170 TYR n 1 171 LYS n 1 172 ALA n 1 173 LEU n 1 174 LYS n 1 175 THR n 1 176 LYS n 1 177 LEU n 1 178 GLN n 1 179 ASP n 1 180 MET n 1 181 PHE n 1 182 ASN n 1 183 LEU n 1 184 GLU n 1 185 LYS n 1 186 GLN n 1 187 ILE n 1 188 ILE n 1 189 GLN n 1 190 ALA n 1 191 GLY n 1 192 GLY n 1 193 ILE n 1 194 VAL n 1 195 PRO n 1 196 GLN n 1 197 VAL n 1 198 ASP n 1 199 ILE n 1 200 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 200 _entity_src_gen.gene_src_common_name 'Mouse-ear cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AHP2, ATHP1, At3g29350, MUO10.6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant pLysS _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pRSET B' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IMD non-polymer . IMIDAZOLE ? 'C3 H5 N2 1' 69.085 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MES non-polymer . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ? 'C6 H13 N O4 S' 195.237 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ARG 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 HIS 8 8 ? ? ? A . n A 1 9 HIS 9 9 ? ? ? A . n A 1 10 HIS 10 10 ? ? ? A . n A 1 11 GLY 11 11 ? ? ? A . n A 1 12 MET 12 12 ? ? ? A . n A 1 13 ALA 13 13 ? ? ? A . n A 1 14 SER 14 14 ? ? ? A . n A 1 15 MET 15 15 ? ? ? A . n A 1 16 THR 16 16 ? ? ? A . n A 1 17 GLY 17 17 ? ? ? A . n A 1 18 GLY 18 18 ? ? ? A . n A 1 19 GLN 19 19 ? ? ? A . n A 1 20 GLN 20 20 ? ? ? A . n A 1 21 MET 21 21 ? ? ? A . n A 1 22 GLY 22 22 ? ? ? A . n A 1 23 ARG 23 23 ? ? ? A . n A 1 24 ASP 24 24 ? ? ? A . n A 1 25 LEU 25 25 ? ? ? A . n A 1 26 TYR 26 26 ? ? ? A . n A 1 27 ASP 27 27 ? ? ? A . n A 1 28 ASP 28 28 ? ? ? A . n A 1 29 ASP 29 29 ? ? ? A . n A 1 30 ASP 30 30 ? ? ? A . n A 1 31 LYS 31 31 ? ? ? A . n A 1 32 ASP 32 32 ? ? ? A . n A 1 33 PRO 33 33 ? ? ? A . n A 1 34 SER 34 34 ? ? ? A . n A 1 35 SER 35 35 ? ? ? A . n A 1 36 ARG 36 36 ? ? ? A . n A 1 37 SER 37 37 ? ? ? A . n A 1 38 ALA 38 38 ? ? ? A . n A 1 39 ALA 39 39 ? ? ? A . n A 1 40 GLY 40 40 ? ? ? A . n A 1 41 THR 41 41 ? ? ? A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 ASP 82 82 ? ? ? A . n A 1 83 GLY 83 83 ? ? ? A . n A 1 84 SER 84 84 ? ? ? A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 CYS 99 99 99 CYS CYS A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 MET 106 106 106 MET MET A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 CYS 144 144 144 CYS CYS A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 CYS 150 150 150 CYS CYS A . n A 1 151 CYS 151 151 151 CYS CYS A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 ASN 155 155 155 ASN ASN A . n A 1 156 TYR 156 156 156 TYR TYR A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 CYS 159 159 159 CYS CYS A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 ARG 161 161 161 ARG ARG A . n A 1 162 CYS 162 162 162 CYS CYS A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 GLN 164 164 164 GLN GLN A . n A 1 165 GLN 165 165 165 GLN GLN A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 TYR 170 170 170 TYR TYR A . n A 1 171 LYS 171 171 171 LYS LYS A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 THR 175 175 175 THR THR A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 GLN 178 178 178 GLN GLN A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 MET 180 180 180 MET MET A . n A 1 181 PHE 181 181 181 PHE PHE A . n A 1 182 ASN 182 182 182 ASN ASN A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 GLN 186 186 186 GLN GLN A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 GLN 189 189 189 GLN GLN A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 ILE 193 193 193 ILE ILE A . n A 1 194 VAL 194 194 194 VAL VAL A . n A 1 195 PRO 195 195 195 PRO PRO A . n A 1 196 GLN 196 196 196 GLN GLN A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 ASP 198 198 ? ? ? A . n A 1 199 ILE 199 199 ? ? ? A . n A 1 200 ASN 200 200 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MES 1 301 1 MES MES A . C 3 IMD 1 302 1 IMD IMD A . D 4 HOH 1 401 11 HOH HOH A . D 4 HOH 2 402 21 HOH HOH A . D 4 HOH 3 403 2 HOH HOH A . D 4 HOH 4 404 15 HOH HOH A . D 4 HOH 5 405 25 HOH HOH A . D 4 HOH 6 406 7 HOH HOH A . D 4 HOH 7 407 24 HOH HOH A . D 4 HOH 8 408 18 HOH HOH A . D 4 HOH 9 409 1 HOH HOH A . D 4 HOH 10 410 19 HOH HOH A . D 4 HOH 11 411 28 HOH HOH A . D 4 HOH 12 412 12 HOH HOH A . D 4 HOH 13 413 27 HOH HOH A . D 4 HOH 14 414 29 HOH HOH A . D 4 HOH 15 415 30 HOH HOH A . D 4 HOH 16 416 26 HOH HOH A . D 4 HOH 17 417 9 HOH HOH A . D 4 HOH 18 418 3 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement . . . . . . . . . . . REFMAC . . . 5.7.0032 1 ? 'data reduction' . . . . . . . . . . . XDS . . . . 2 ? 'data collection' . . . . . . . . . . . MAR345dtb . . . . 3 ? phasing . . . . . . . . . . . SHELXDE . . . . 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 5 # _cell.entry_id 4PAC _cell.length_a 59.900 _cell.length_b 59.900 _cell.length_c 169.700 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4PAC _symmetry.cell_setting . _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall . _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M . # _exptl.absorpt_coefficient_mu . _exptl.absorpt_correction_T_max . _exptl.absorpt_correction_T_min . _exptl.absorpt_correction_type . _exptl.absorpt_process_details . _exptl.entry_id 4PAC _exptl.crystals_number 1 _exptl.details . _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details . # _exptl_crystal.colour . _exptl_crystal.density_diffrn . _exptl_crystal.density_Matthews 3.40 _exptl_crystal.density_method . _exptl_crystal.density_percent_sol 63.84 _exptl_crystal.description . _exptl_crystal.F_000 . _exptl_crystal.id 1 _exptl_crystal.preparation . _exptl_crystal.size_max . _exptl_crystal.size_mid . _exptl_crystal.size_min . _exptl_crystal.size_rad . _exptl_crystal.colour_lustre . _exptl_crystal.colour_modifier . _exptl_crystal.colour_primary . _exptl_crystal.density_meas . _exptl_crystal.density_meas_esd . _exptl_crystal.density_meas_gt . _exptl_crystal.density_meas_lt . _exptl_crystal.density_meas_temp . _exptl_crystal.density_meas_temp_esd . _exptl_crystal.density_meas_temp_gt . _exptl_crystal.density_meas_temp_lt . _exptl_crystal.pdbx_crystal_image_url . _exptl_crystal.pdbx_crystal_image_format . _exptl_crystal.pdbx_mosaicity . _exptl_crystal.pdbx_mosaicity_esd . # _exptl_crystal_grow.apparatus . _exptl_crystal_grow.atmosphere . _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details . _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref . _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure . _exptl_crystal_grow.pressure_esd . _exptl_crystal_grow.seeding . _exptl_crystal_grow.seeding_ref . _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details . _exptl_crystal_grow.temp_esd . _exptl_crystal_grow.time . _exptl_crystal_grow.pdbx_details '0.1M MES, 1.6M magnesium sulfate' _exptl_crystal_grow.pdbx_pH_range '5.8 - 6.5' # _diffrn.ambient_environment . _diffrn.ambient_temp 100 _diffrn.ambient_temp_details . _diffrn.ambient_temp_esd . _diffrn.crystal_id 1 _diffrn.crystal_support . _diffrn.crystal_treatment . _diffrn.details . _diffrn.id 1 _diffrn.ambient_pressure . _diffrn.ambient_pressure_esd . _diffrn.ambient_pressure_gt . _diffrn.ambient_pressure_lt . _diffrn.ambient_temp_gt . _diffrn.ambient_temp_lt . # _diffrn_detector.details . _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-225' _diffrn_detector.area_resol_mean . _diffrn_detector.dtime . _diffrn_detector.pdbx_frames_total . _diffrn_detector.pdbx_collection_time_total . _diffrn_detector.pdbx_collection_date 2012-02-28 # _diffrn_radiation.collimation . _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge . _diffrn_radiation.inhomogeneity . _diffrn_radiation.monochromator . _diffrn_radiation.polarisn_norm . _diffrn_radiation.polarisn_ratio . _diffrn_radiation.probe . _diffrn_radiation.type . _diffrn_radiation.xray_symbol . _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list . _diffrn_radiation.pdbx_wavelength . _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer . _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.91841 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current . _diffrn_source.details . _diffrn_source.diffrn_id 1 _diffrn_source.power . _diffrn_source.size . _diffrn_source.source SYNCHROTRON _diffrn_source.target . _diffrn_source.type 'BESSY BEAMLINE 14.2' _diffrn_source.voltage . _diffrn_source.take-off_angle . _diffrn_source.pdbx_wavelength_list 0.91841 _diffrn_source.pdbx_wavelength . _diffrn_source.pdbx_synchrotron_beamline 14.2 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate . _reflns.entry_id 4PAC _reflns.data_reduction_details . _reflns.data_reduction_method . _reflns.d_resolution_high 2.530 _reflns.d_resolution_low 50.0 _reflns.details . _reflns.limit_h_max . _reflns.limit_h_min . _reflns.limit_k_max . _reflns.limit_k_min . _reflns.limit_l_max . _reflns.limit_l_min . _reflns.number_all . _reflns.number_obs 10808 _reflns.observed_criterion . _reflns.observed_criterion_F_max . _reflns.observed_criterion_F_min . _reflns.observed_criterion_I_max . _reflns.observed_criterion_I_min . _reflns.observed_criterion_sigma_F . _reflns.observed_criterion_sigma_I . _reflns.percent_possible_obs 99.600 _reflns.R_free_details . _reflns.Rmerge_F_all . _reflns.Rmerge_F_obs . _reflns.Friedel_coverage . _reflns.number_gt . _reflns.threshold_expression . _reflns.pdbx_redundancy 7.0 _reflns.pdbx_Rmerge_I_obs . _reflns.pdbx_Rmerge_I_all . _reflns.pdbx_Rsym_value . _reflns.pdbx_netI_over_av_sigmaI . _reflns.pdbx_netI_over_sigmaI 15.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 . _reflns.pdbx_res_netI_over_sigmaI_2 . _reflns.pdbx_chi_squared . _reflns.pdbx_scaling_rejects . _reflns.pdbx_d_res_high_opt . _reflns.pdbx_d_res_low_opt . _reflns.pdbx_d_res_opt_method . _reflns.phase_calculation_details . _reflns.pdbx_Rrim_I_all . _reflns.pdbx_Rpim_I_all . _reflns.pdbx_d_opt . _reflns.pdbx_number_measured_all . _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.Rmerge_I_obs 1.014 _reflns_shell.d_res_high 2.53 _reflns_shell.d_res_low 2.68 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_sigI_obs 1.76 _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_gt ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_gt ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_redundancy 7.02 _reflns_shell.pdbx_rejects ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_gt ? _reflns_shell.percent_possible_obs 98.7 # _refine.aniso_B[1][1] 0.97 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.97 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -1.94 _refine.B_iso_max . _refine.B_iso_mean 59.628 _refine.B_iso_min . _refine.correlation_coeff_Fo_to_Fc 0.941 _refine.correlation_coeff_Fo_to_Fc_free 0.914 _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.diff_density_max . _refine.diff_density_max_esd . _refine.diff_density_min . _refine.diff_density_min_esd . _refine.diff_density_rms . _refine.diff_density_rms_esd . _refine.entry_id 4PAC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details . _refine.ls_abs_structure_Flack . _refine.ls_abs_structure_Flack_esd . _refine.ls_abs_structure_Rogers . _refine.ls_abs_structure_Rogers_esd . _refine.ls_d_res_high 2.53 _refine.ls_d_res_low 50.0 _refine.ls_extinction_coef . _refine.ls_extinction_coef_esd . _refine.ls_extinction_expression . _refine.ls_extinction_method . _refine.ls_goodness_of_fit_all . _refine.ls_goodness_of_fit_all_esd . _refine.ls_goodness_of_fit_obs . _refine.ls_goodness_of_fit_obs_esd . _refine.ls_hydrogen_treatment . _refine.ls_matrix_type . _refine.ls_number_constraints . _refine.ls_number_parameters . _refine.ls_number_reflns_all . _refine.ls_number_reflns_obs 8855 _refine.ls_number_reflns_R_free 443 _refine.ls_number_reflns_R_work . _refine.ls_number_restraints . _refine.ls_percent_reflns_obs 84.46 _refine.ls_percent_reflns_R_free 4.8 _refine.ls_R_factor_all . _refine.ls_R_factor_obs 0.23219 _refine.ls_R_factor_R_free 0.30392 _refine.ls_R_factor_R_free_error . _refine.ls_R_factor_R_free_error_details . _refine.ls_R_factor_R_work 0.22869 _refine.ls_R_Fsqd_factor_obs . _refine.ls_R_I_factor_obs . _refine.ls_redundancy_reflns_all . _refine.ls_redundancy_reflns_obs . _refine.ls_restrained_S_all . _refine.ls_restrained_S_obs . _refine.ls_shift_over_esd_max . _refine.ls_shift_over_esd_mean . _refine.ls_structure_factor_coef . _refine.ls_weighting_details . _refine.ls_weighting_scheme . _refine.ls_wR_factor_all . _refine.ls_wR_factor_obs . _refine.ls_wR_factor_R_free . _refine.ls_wR_factor_R_work . _refine.occupancy_max . _refine.occupancy_min . _refine.overall_SU_B 11.856 _refine.overall_SU_ML 0.242 _refine.overall_SU_R_Cruickshank_DPI . _refine.overall_SU_R_free . _refine.overall_FOM_free_R_set . _refine.overall_FOM_work_R_set . _refine.solvent_model_details MASK _refine.solvent_model_param_bsol . _refine.solvent_model_param_ksol . _refine.ls_R_factor_gt . _refine.ls_goodness_of_fit_gt . _refine.ls_goodness_of_fit_ref . _refine.ls_shift_over_su_max . _refine.ls_shift_over_su_max_lt . _refine.ls_shift_over_su_mean . _refine.ls_shift_over_su_mean_lt . _refine.pdbx_ls_sigma_I . _refine.pdbx_ls_sigma_F . _refine.pdbx_ls_sigma_Fsqd . _refine.pdbx_data_cutoff_high_absF . _refine.pdbx_data_cutoff_high_rms_absF . _refine.pdbx_data_cutoff_low_absF . _refine.pdbx_isotropic_thermal_model . _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SIRAS _refine.pdbx_starting_model . _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case . _refine.pdbx_overall_ESU_R 0.353 _refine.pdbx_overall_ESU_R_Free 0.310 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R . _refine.pdbx_density_correlation . _refine.pdbx_pd_number_of_powder_patterns . _refine.pdbx_pd_number_of_points . _refine.pdbx_pd_meas_number_of_points . _refine.pdbx_pd_proc_ls_prof_R_factor . _refine.pdbx_pd_proc_ls_prof_wR_factor . _refine.pdbx_pd_Marquardt_correlation_coeff . _refine.pdbx_pd_Fsqrd_R_factor . _refine.pdbx_pd_ls_matrix_band_width . _refine.pdbx_overall_phase_error . _refine.pdbx_overall_SU_R_free_Cruickshank_DPI . _refine.pdbx_overall_SU_R_free_Blow_DPI . _refine.pdbx_overall_SU_R_Blow_DPI . _refine.pdbx_TLS_residual_ADP_flag . _refine.pdbx_diffrn_id 1 # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1208 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 17 _refine_hist.number_atoms_solvent 18 _refine_hist.number_atoms_total 1243 _refine_hist.d_res_high 2.53 _refine_hist.d_res_low 50.0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' . 0.014 0.019 1245 . r_bond_refined_d . . 'X-RAY DIFFRACTION' . . . . . r_bond_other_d . . 'X-RAY DIFFRACTION' . 1.861 1.982 1669 . r_angle_refined_deg . . 'X-RAY DIFFRACTION' . . . . . r_angle_other_deg . . 'X-RAY DIFFRACTION' . 7.113 5.000 151 . r_dihedral_angle_1_deg . . 'X-RAY DIFFRACTION' . 35.428 25.690 58 . r_dihedral_angle_2_deg . . 'X-RAY DIFFRACTION' . 19.970 15.000 235 . r_dihedral_angle_3_deg . . 'X-RAY DIFFRACTION' . 6.790 15.000 5 . r_dihedral_angle_4_deg . . 'X-RAY DIFFRACTION' . 0.121 0.200 191 . r_chiral_restr . . 'X-RAY DIFFRACTION' . 0.006 0.020 898 . r_gen_planes_refined . . 'X-RAY DIFFRACTION' . . . . . r_gen_planes_other . . 'X-RAY DIFFRACTION' . . . . . r_nbd_refined . . 'X-RAY DIFFRACTION' . . . . . r_nbd_other . . 'X-RAY DIFFRACTION' . . . . . r_nbtor_refined . . 'X-RAY DIFFRACTION' . . . . . r_nbtor_other . . 'X-RAY DIFFRACTION' . . . . . r_xyhbond_nbd_refined . . 'X-RAY DIFFRACTION' . . . . . r_xyhbond_nbd_other . . 'X-RAY DIFFRACTION' . . . . . r_metal_ion_refined . . 'X-RAY DIFFRACTION' . . . . . r_metal_ion_other . . 'X-RAY DIFFRACTION' . . . . . r_symmetry_vdw_refined . . 'X-RAY DIFFRACTION' . . . . . r_symmetry_vdw_other . . 'X-RAY DIFFRACTION' . . . . . r_symmetry_hbond_refined . . 'X-RAY DIFFRACTION' . . . . . r_symmetry_hbond_other . . 'X-RAY DIFFRACTION' . . . . . r_symmetry_metal_ion_refined . . 'X-RAY DIFFRACTION' . . . . . r_symmetry_metal_ion_other . . 'X-RAY DIFFRACTION' . 5.273 5.737 610 . r_mcbond_it . . 'X-RAY DIFFRACTION' . . . . . r_mcbond_other . . 'X-RAY DIFFRACTION' . 8.040 8.567 759 . r_mcangle_it . . 'X-RAY DIFFRACTION' . . . . . r_mcangle_other . . 'X-RAY DIFFRACTION' . 6.515 6.073 635 . r_scbond_it . . 'X-RAY DIFFRACTION' . . . . . r_scbond_other . . 'X-RAY DIFFRACTION' . . . . . r_scangle_it . . 'X-RAY DIFFRACTION' . . . . . r_scangle_other . . 'X-RAY DIFFRACTION' . 11.874 47.258 1902 . r_long_range_B_refined . . 'X-RAY DIFFRACTION' . . . . . r_long_range_B_other . . 'X-RAY DIFFRACTION' . . . . . r_rigid_bond_restr . . 'X-RAY DIFFRACTION' . . . . . r_sphericity_free . . 'X-RAY DIFFRACTION' . . . . . r_sphericity_bonded . . # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.528 _refine_ls_shell.d_res_low 2.594 _refine_ls_shell.number_reflns_all . _refine_ls_shell.number_reflns_obs . _refine_ls_shell.number_reflns_R_free 17 _refine_ls_shell.number_reflns_R_work 374 _refine_ls_shell.percent_reflns_obs 49.94 _refine_ls_shell.percent_reflns_R_free . _refine_ls_shell.R_factor_all . _refine_ls_shell.R_factor_obs . _refine_ls_shell.R_factor_R_free 0.550 _refine_ls_shell.R_factor_R_free_error . _refine_ls_shell.R_factor_R_work 0.479 _refine_ls_shell.redundancy_reflns_all . _refine_ls_shell.redundancy_reflns_obs . _refine_ls_shell.wR_factor_all . _refine_ls_shell.wR_factor_obs . _refine_ls_shell.wR_factor_R_free . _refine_ls_shell.wR_factor_R_work . _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error . # _struct.entry_id 4PAC _struct.title 'Crystal Structure of Histidine-containing Phosphotransfer Protein AHP2 from Arabidopsis thaliana' _struct.pdbx_model_details . _struct.pdbx_formula_weight . _struct.pdbx_formula_weight_method . _struct.pdbx_model_type_details . _struct.pdbx_CASP_flag . # _struct_keywords.entry_id 4PAC _struct_keywords.text 'cytokinin signaling, helical fold, signaling protein' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AHP2_ARATH _struct_ref.pdbx_db_accession Q9ZNV8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDALIAQLQRQFRDYTISLYQQGFLDDQFTELKKLQDDGSPDFVSEVLSLFFEDCVKLISNMARALDTTGTVDFSQVGAS VHQLKGSSSSVGAKRVKTLCVSFKECCEAKNYEGCVRCLQQVDIEYKALKTKLQDMFNLEKQIIQAGGIVPQVDIN ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4PAC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 45 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 200 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9ZNV8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 156 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 45 _struct_ref_seq.pdbx_auth_seq_align_end 200 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4PAC MET A 1 ? UNP Q9ZNV8 ? ? 'initiating methionine' 1 1 1 4PAC ARG A 2 ? UNP Q9ZNV8 ? ? 'expression tag' 2 2 1 4PAC GLY A 3 ? UNP Q9ZNV8 ? ? 'expression tag' 3 3 1 4PAC SER A 4 ? UNP Q9ZNV8 ? ? 'expression tag' 4 4 1 4PAC HIS A 5 ? UNP Q9ZNV8 ? ? 'expression tag' 5 5 1 4PAC HIS A 6 ? UNP Q9ZNV8 ? ? 'expression tag' 6 6 1 4PAC HIS A 7 ? UNP Q9ZNV8 ? ? 'expression tag' 7 7 1 4PAC HIS A 8 ? UNP Q9ZNV8 ? ? 'expression tag' 8 8 1 4PAC HIS A 9 ? UNP Q9ZNV8 ? ? 'expression tag' 9 9 1 4PAC HIS A 10 ? UNP Q9ZNV8 ? ? 'expression tag' 10 10 1 4PAC GLY A 11 ? UNP Q9ZNV8 ? ? 'expression tag' 11 11 1 4PAC MET A 12 ? UNP Q9ZNV8 ? ? 'expression tag' 12 12 1 4PAC ALA A 13 ? UNP Q9ZNV8 ? ? 'expression tag' 13 13 1 4PAC SER A 14 ? UNP Q9ZNV8 ? ? 'expression tag' 14 14 1 4PAC MET A 15 ? UNP Q9ZNV8 ? ? 'expression tag' 15 15 1 4PAC THR A 16 ? UNP Q9ZNV8 ? ? 'expression tag' 16 16 1 4PAC GLY A 17 ? UNP Q9ZNV8 ? ? 'expression tag' 17 17 1 4PAC GLY A 18 ? UNP Q9ZNV8 ? ? 'expression tag' 18 18 1 4PAC GLN A 19 ? UNP Q9ZNV8 ? ? 'expression tag' 19 19 1 4PAC GLN A 20 ? UNP Q9ZNV8 ? ? 'expression tag' 20 20 1 4PAC MET A 21 ? UNP Q9ZNV8 ? ? 'expression tag' 21 21 1 4PAC GLY A 22 ? UNP Q9ZNV8 ? ? 'expression tag' 22 22 1 4PAC ARG A 23 ? UNP Q9ZNV8 ? ? 'expression tag' 23 23 1 4PAC ASP A 24 ? UNP Q9ZNV8 ? ? 'expression tag' 24 24 1 4PAC LEU A 25 ? UNP Q9ZNV8 ? ? 'expression tag' 25 25 1 4PAC TYR A 26 ? UNP Q9ZNV8 ? ? 'expression tag' 26 26 1 4PAC ASP A 27 ? UNP Q9ZNV8 ? ? 'expression tag' 27 27 1 4PAC ASP A 28 ? UNP Q9ZNV8 ? ? 'expression tag' 28 28 1 4PAC ASP A 29 ? UNP Q9ZNV8 ? ? 'expression tag' 29 29 1 4PAC ASP A 30 ? UNP Q9ZNV8 ? ? 'expression tag' 30 30 1 4PAC LYS A 31 ? UNP Q9ZNV8 ? ? 'expression tag' 31 31 1 4PAC ASP A 32 ? UNP Q9ZNV8 ? ? 'expression tag' 32 32 1 4PAC PRO A 33 ? UNP Q9ZNV8 ? ? 'expression tag' 33 33 1 4PAC SER A 34 ? UNP Q9ZNV8 ? ? 'expression tag' 34 34 1 4PAC SER A 35 ? UNP Q9ZNV8 ? ? 'expression tag' 35 35 1 4PAC ARG A 36 ? UNP Q9ZNV8 ? ? 'expression tag' 36 36 1 4PAC SER A 37 ? UNP Q9ZNV8 ? ? 'expression tag' 37 37 1 4PAC ALA A 38 ? UNP Q9ZNV8 ? ? 'expression tag' 38 38 1 4PAC ALA A 39 ? UNP Q9ZNV8 ? ? 'expression tag' 39 39 1 4PAC GLY A 40 ? UNP Q9ZNV8 ? ? 'expression tag' 40 40 1 4PAC THR A 41 ? UNP Q9ZNV8 ? ? 'expression tag' 41 41 1 4PAC MET A 42 ? UNP Q9ZNV8 ? ? 'expression tag' 42 42 1 4PAC GLU A 43 ? UNP Q9ZNV8 ? ? 'expression tag' 43 43 1 4PAC PHE A 44 ? UNP Q9ZNV8 ? ? 'expression tag' 44 44 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details Monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 530 ? 1 MORE 8 ? 1 'SSA (A^2)' 9160 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 45 ? GLN A 66 ? MET A 45 GLN A 66 1 ? 22 HELX_P HELX_P2 AA2 ASP A 70 ? LYS A 78 ? ASP A 70 LYS A 78 1 ? 9 HELX_P HELX_P3 AA3 ASP A 86 ? ASP A 111 ? ASP A 86 ASP A 111 1 ? 26 HELX_P HELX_P4 AA4 ASP A 117 ? GLY A 136 ? ASP A 117 GLY A 136 1 ? 20 HELX_P HELX_P5 AA5 ALA A 137 ? ALA A 153 ? ALA A 137 ALA A 153 1 ? 17 HELX_P HELX_P6 AA6 ASN A 155 ? GLN A 189 ? ASN A 155 GLN A 189 1 ? 35 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id MES _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'binding site for residue MES A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 SER A 89 ? SER A 89 . ? 1_555 ? 2 AC1 4 LYS A 174 ? LYS A 174 . ? 1_555 ? 3 AC1 4 GLN A 178 ? GLN A 178 . ? 1_555 ? 4 AC1 4 PHE A 181 ? PHE A 181 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 78 ? ? -52.92 -7.40 2 1 ASP A 86 ? ? -165.81 19.23 3 1 THR A 115 ? ? 79.11 128.54 4 1 LYS A 154 ? ? 31.96 41.59 5 1 ALA A 190 ? ? 98.31 -1.63 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ARG 2 ? A ARG 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A HIS 8 ? A HIS 8 9 1 Y 1 A HIS 9 ? A HIS 9 10 1 Y 1 A HIS 10 ? A HIS 10 11 1 Y 1 A GLY 11 ? A GLY 11 12 1 Y 1 A MET 12 ? A MET 12 13 1 Y 1 A ALA 13 ? A ALA 13 14 1 Y 1 A SER 14 ? A SER 14 15 1 Y 1 A MET 15 ? A MET 15 16 1 Y 1 A THR 16 ? A THR 16 17 1 Y 1 A GLY 17 ? A GLY 17 18 1 Y 1 A GLY 18 ? A GLY 18 19 1 Y 1 A GLN 19 ? A GLN 19 20 1 Y 1 A GLN 20 ? A GLN 20 21 1 Y 1 A MET 21 ? A MET 21 22 1 Y 1 A GLY 22 ? A GLY 22 23 1 Y 1 A ARG 23 ? A ARG 23 24 1 Y 1 A ASP 24 ? A ASP 24 25 1 Y 1 A LEU 25 ? A LEU 25 26 1 Y 1 A TYR 26 ? A TYR 26 27 1 Y 1 A ASP 27 ? A ASP 27 28 1 Y 1 A ASP 28 ? A ASP 28 29 1 Y 1 A ASP 29 ? A ASP 29 30 1 Y 1 A ASP 30 ? A ASP 30 31 1 Y 1 A LYS 31 ? A LYS 31 32 1 Y 1 A ASP 32 ? A ASP 32 33 1 Y 1 A PRO 33 ? A PRO 33 34 1 Y 1 A SER 34 ? A SER 34 35 1 Y 1 A SER 35 ? A SER 35 36 1 Y 1 A ARG 36 ? A ARG 36 37 1 Y 1 A SER 37 ? A SER 37 38 1 Y 1 A ALA 38 ? A ALA 38 39 1 Y 1 A ALA 39 ? A ALA 39 40 1 Y 1 A GLY 40 ? A GLY 40 41 1 Y 1 A THR 41 ? A THR 41 42 1 Y 1 A ASP 82 ? A ASP 82 43 1 Y 1 A GLY 83 ? A GLY 83 44 1 Y 1 A SER 84 ? A SER 84 45 1 Y 1 A ASP 198 ? A ASP 198 46 1 Y 1 A ILE 199 ? A ILE 199 47 1 Y 1 A ASN 200 ? A ASN 200 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 IMD N1 N Y N 183 IMD C2 C Y N 184 IMD N3 N Y N 185 IMD C4 C Y N 186 IMD C5 C Y N 187 IMD HN1 H N N 188 IMD H2 H N N 189 IMD HN3 H N N 190 IMD H4 H N N 191 IMD H5 H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MES O1 O N N 240 MES C2 C N N 241 MES C3 C N N 242 MES N4 N N N 243 MES C5 C N N 244 MES C6 C N N 245 MES C7 C N N 246 MES C8 C N N 247 MES S S N N 248 MES O1S O N N 249 MES O2S O N N 250 MES O3S O N N 251 MES H21 H N N 252 MES H22 H N N 253 MES H31 H N N 254 MES H32 H N N 255 MES HN4 H N N 256 MES H51 H N N 257 MES H52 H N N 258 MES H61 H N N 259 MES H62 H N N 260 MES H71 H N N 261 MES H72 H N N 262 MES H81 H N N 263 MES H82 H N N 264 MET N N N N 265 MET CA C N S 266 MET C C N N 267 MET O O N N 268 MET CB C N N 269 MET CG C N N 270 MET SD S N N 271 MET CE C N N 272 MET OXT O N N 273 MET H H N N 274 MET H2 H N N 275 MET HA H N N 276 MET HB2 H N N 277 MET HB3 H N N 278 MET HG2 H N N 279 MET HG3 H N N 280 MET HE1 H N N 281 MET HE2 H N N 282 MET HE3 H N N 283 MET HXT H N N 284 PHE N N N N 285 PHE CA C N S 286 PHE C C N N 287 PHE O O N N 288 PHE CB C N N 289 PHE CG C Y N 290 PHE CD1 C Y N 291 PHE CD2 C Y N 292 PHE CE1 C Y N 293 PHE CE2 C Y N 294 PHE CZ C Y N 295 PHE OXT O N N 296 PHE H H N N 297 PHE H2 H N N 298 PHE HA H N N 299 PHE HB2 H N N 300 PHE HB3 H N N 301 PHE HD1 H N N 302 PHE HD2 H N N 303 PHE HE1 H N N 304 PHE HE2 H N N 305 PHE HZ H N N 306 PHE HXT H N N 307 PRO N N N N 308 PRO CA C N S 309 PRO C C N N 310 PRO O O N N 311 PRO CB C N N 312 PRO CG C N N 313 PRO CD C N N 314 PRO OXT O N N 315 PRO H H N N 316 PRO HA H N N 317 PRO HB2 H N N 318 PRO HB3 H N N 319 PRO HG2 H N N 320 PRO HG3 H N N 321 PRO HD2 H N N 322 PRO HD3 H N N 323 PRO HXT H N N 324 SER N N N N 325 SER CA C N S 326 SER C C N N 327 SER O O N N 328 SER CB C N N 329 SER OG O N N 330 SER OXT O N N 331 SER H H N N 332 SER H2 H N N 333 SER HA H N N 334 SER HB2 H N N 335 SER HB3 H N N 336 SER HG H N N 337 SER HXT H N N 338 THR N N N N 339 THR CA C N S 340 THR C C N N 341 THR O O N N 342 THR CB C N R 343 THR OG1 O N N 344 THR CG2 C N N 345 THR OXT O N N 346 THR H H N N 347 THR H2 H N N 348 THR HA H N N 349 THR HB H N N 350 THR HG1 H N N 351 THR HG21 H N N 352 THR HG22 H N N 353 THR HG23 H N N 354 THR HXT H N N 355 TYR N N N N 356 TYR CA C N S 357 TYR C C N N 358 TYR O O N N 359 TYR CB C N N 360 TYR CG C Y N 361 TYR CD1 C Y N 362 TYR CD2 C Y N 363 TYR CE1 C Y N 364 TYR CE2 C Y N 365 TYR CZ C Y N 366 TYR OH O N N 367 TYR OXT O N N 368 TYR H H N N 369 TYR H2 H N N 370 TYR HA H N N 371 TYR HB2 H N N 372 TYR HB3 H N N 373 TYR HD1 H N N 374 TYR HD2 H N N 375 TYR HE1 H N N 376 TYR HE2 H N N 377 TYR HH H N N 378 TYR HXT H N N 379 VAL N N N N 380 VAL CA C N S 381 VAL C C N N 382 VAL O O N N 383 VAL CB C N N 384 VAL CG1 C N N 385 VAL CG2 C N N 386 VAL OXT O N N 387 VAL H H N N 388 VAL H2 H N N 389 VAL HA H N N 390 VAL HB H N N 391 VAL HG11 H N N 392 VAL HG12 H N N 393 VAL HG13 H N N 394 VAL HG21 H N N 395 VAL HG22 H N N 396 VAL HG23 H N N 397 VAL HXT H N N 398 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 IMD N1 C2 sing Y N 173 IMD N1 C5 sing Y N 174 IMD N1 HN1 sing N N 175 IMD C2 N3 doub Y N 176 IMD C2 H2 sing N N 177 IMD N3 C4 sing Y N 178 IMD N3 HN3 sing N N 179 IMD C4 C5 doub Y N 180 IMD C4 H4 sing N N 181 IMD C5 H5 sing N N 182 LEU N CA sing N N 183 LEU N H sing N N 184 LEU N H2 sing N N 185 LEU CA C sing N N 186 LEU CA CB sing N N 187 LEU CA HA sing N N 188 LEU C O doub N N 189 LEU C OXT sing N N 190 LEU CB CG sing N N 191 LEU CB HB2 sing N N 192 LEU CB HB3 sing N N 193 LEU CG CD1 sing N N 194 LEU CG CD2 sing N N 195 LEU CG HG sing N N 196 LEU CD1 HD11 sing N N 197 LEU CD1 HD12 sing N N 198 LEU CD1 HD13 sing N N 199 LEU CD2 HD21 sing N N 200 LEU CD2 HD22 sing N N 201 LEU CD2 HD23 sing N N 202 LEU OXT HXT sing N N 203 LYS N CA sing N N 204 LYS N H sing N N 205 LYS N H2 sing N N 206 LYS CA C sing N N 207 LYS CA CB sing N N 208 LYS CA HA sing N N 209 LYS C O doub N N 210 LYS C OXT sing N N 211 LYS CB CG sing N N 212 LYS CB HB2 sing N N 213 LYS CB HB3 sing N N 214 LYS CG CD sing N N 215 LYS CG HG2 sing N N 216 LYS CG HG3 sing N N 217 LYS CD CE sing N N 218 LYS CD HD2 sing N N 219 LYS CD HD3 sing N N 220 LYS CE NZ sing N N 221 LYS CE HE2 sing N N 222 LYS CE HE3 sing N N 223 LYS NZ HZ1 sing N N 224 LYS NZ HZ2 sing N N 225 LYS NZ HZ3 sing N N 226 LYS OXT HXT sing N N 227 MES O1 C2 sing N N 228 MES O1 C6 sing N N 229 MES C2 C3 sing N N 230 MES C2 H21 sing N N 231 MES C2 H22 sing N N 232 MES C3 N4 sing N N 233 MES C3 H31 sing N N 234 MES C3 H32 sing N N 235 MES N4 C5 sing N N 236 MES N4 C7 sing N N 237 MES N4 HN4 sing N N 238 MES C5 C6 sing N N 239 MES C5 H51 sing N N 240 MES C5 H52 sing N N 241 MES C6 H61 sing N N 242 MES C6 H62 sing N N 243 MES C7 C8 sing N N 244 MES C7 H71 sing N N 245 MES C7 H72 sing N N 246 MES C8 S sing N N 247 MES C8 H81 sing N N 248 MES C8 H82 sing N N 249 MES S O1S doub N N 250 MES S O2S doub N N 251 MES S O3S sing N N 252 MET N CA sing N N 253 MET N H sing N N 254 MET N H2 sing N N 255 MET CA C sing N N 256 MET CA CB sing N N 257 MET CA HA sing N N 258 MET C O doub N N 259 MET C OXT sing N N 260 MET CB CG sing N N 261 MET CB HB2 sing N N 262 MET CB HB3 sing N N 263 MET CG SD sing N N 264 MET CG HG2 sing N N 265 MET CG HG3 sing N N 266 MET SD CE sing N N 267 MET CE HE1 sing N N 268 MET CE HE2 sing N N 269 MET CE HE3 sing N N 270 MET OXT HXT sing N N 271 PHE N CA sing N N 272 PHE N H sing N N 273 PHE N H2 sing N N 274 PHE CA C sing N N 275 PHE CA CB sing N N 276 PHE CA HA sing N N 277 PHE C O doub N N 278 PHE C OXT sing N N 279 PHE CB CG sing N N 280 PHE CB HB2 sing N N 281 PHE CB HB3 sing N N 282 PHE CG CD1 doub Y N 283 PHE CG CD2 sing Y N 284 PHE CD1 CE1 sing Y N 285 PHE CD1 HD1 sing N N 286 PHE CD2 CE2 doub Y N 287 PHE CD2 HD2 sing N N 288 PHE CE1 CZ doub Y N 289 PHE CE1 HE1 sing N N 290 PHE CE2 CZ sing Y N 291 PHE CE2 HE2 sing N N 292 PHE CZ HZ sing N N 293 PHE OXT HXT sing N N 294 PRO N CA sing N N 295 PRO N CD sing N N 296 PRO N H sing N N 297 PRO CA C sing N N 298 PRO CA CB sing N N 299 PRO CA HA sing N N 300 PRO C O doub N N 301 PRO C OXT sing N N 302 PRO CB CG sing N N 303 PRO CB HB2 sing N N 304 PRO CB HB3 sing N N 305 PRO CG CD sing N N 306 PRO CG HG2 sing N N 307 PRO CG HG3 sing N N 308 PRO CD HD2 sing N N 309 PRO CD HD3 sing N N 310 PRO OXT HXT sing N N 311 SER N CA sing N N 312 SER N H sing N N 313 SER N H2 sing N N 314 SER CA C sing N N 315 SER CA CB sing N N 316 SER CA HA sing N N 317 SER C O doub N N 318 SER C OXT sing N N 319 SER CB OG sing N N 320 SER CB HB2 sing N N 321 SER CB HB3 sing N N 322 SER OG HG sing N N 323 SER OXT HXT sing N N 324 THR N CA sing N N 325 THR N H sing N N 326 THR N H2 sing N N 327 THR CA C sing N N 328 THR CA CB sing N N 329 THR CA HA sing N N 330 THR C O doub N N 331 THR C OXT sing N N 332 THR CB OG1 sing N N 333 THR CB CG2 sing N N 334 THR CB HB sing N N 335 THR OG1 HG1 sing N N 336 THR CG2 HG21 sing N N 337 THR CG2 HG22 sing N N 338 THR CG2 HG23 sing N N 339 THR OXT HXT sing N N 340 TYR N CA sing N N 341 TYR N H sing N N 342 TYR N H2 sing N N 343 TYR CA C sing N N 344 TYR CA CB sing N N 345 TYR CA HA sing N N 346 TYR C O doub N N 347 TYR C OXT sing N N 348 TYR CB CG sing N N 349 TYR CB HB2 sing N N 350 TYR CB HB3 sing N N 351 TYR CG CD1 doub Y N 352 TYR CG CD2 sing Y N 353 TYR CD1 CE1 sing Y N 354 TYR CD1 HD1 sing N N 355 TYR CD2 CE2 doub Y N 356 TYR CD2 HD2 sing N N 357 TYR CE1 CZ doub Y N 358 TYR CE1 HE1 sing N N 359 TYR CE2 CZ sing Y N 360 TYR CE2 HE2 sing N N 361 TYR CZ OH sing N N 362 TYR OH HH sing N N 363 TYR OXT HXT sing N N 364 VAL N CA sing N N 365 VAL N H sing N N 366 VAL N H2 sing N N 367 VAL CA C sing N N 368 VAL CA CB sing N N 369 VAL CA HA sing N N 370 VAL C O doub N N 371 VAL C OXT sing N N 372 VAL CB CG1 sing N N 373 VAL CB CG2 sing N N 374 VAL CB HB sing N N 375 VAL CG1 HG11 sing N N 376 VAL CG1 HG12 sing N N 377 VAL CG1 HG13 sing N N 378 VAL CG2 HG21 sing N N 379 VAL CG2 HG22 sing N N 380 VAL CG2 HG23 sing N N 381 VAL OXT HXT sing N N 382 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Czech Science Foundation' 'Czech Republic' 521/09/1699 1 'Czech Science Foundation' 'Czech Republic' P305/11/0756, 2 'Central European Institute of Technology' 'Czech Republic' CZ.1.05/1.1.00/02.0068 3 'Czech Academy of Sciences' 'Czech Republic' AV0Z60870520 4 . 'Czech Republic' ME09016 5 . 'Czech Republic' CZ.1.05/2.1.00/01.0024 6 # _atom_sites.entry_id 4PAC _atom_sites.fract_transf_matrix[1][1] 0.016694 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016694 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005893 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_