data_5BOK # _entry.id 5BOK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5BOK pdb_00005bok 10.2210/pdb5bok/pdb WWPDB D_1000208747 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5BOK _pdbx_database_status.recvd_initial_deposition_date 2015-05-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ramaswamy, S.' 1 'Kumari, A.' 2 'Singh, D.' 3 'Gurunath, R.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Ferredoxin component of 3-nitrotoluene dioxygenase from Diaphorobacter sp. strain DS2' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ramaswamy, S.' 1 ? primary 'Kumari, A.' 2 ? primary 'Singh, D.' 3 ? primary 'Qurunath, R.' 4 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5BOK _cell.details ? _cell.formula_units_Z ? _cell.length_a 79.530 _cell.length_a_esd ? _cell.length_b 79.530 _cell.length_b_esd ? _cell.length_c 108.970 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5BOK _symmetry.cell_setting ? _symmetry.Int_Tables_number 97 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 4 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Ferredoxin 11486.068 1 ? ? ? ? 2 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER' 175.820 1 ? ? ? ? 3 non-polymer syn 'FE (III) ION' 55.845 1 ? ? ? ? 4 water nat water 18.015 15 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSENWIDAAARDEVPEGDVIGINIVGKEIALYEVAGEIYATDNTCTHGAARMSDGFLEGREIECPLHQGRFDVCTGKALC TPLTQDIKTYPVKIENMRVMLKLD ; _entity_poly.pdbx_seq_one_letter_code_can ;MSENWIDAAARDEVPEGDVIGINIVGKEIALYEVAGEIYATDNTCTHGAARMSDGFLEGREIECPLHQGRFDVCTGKALC TPLTQDIKTYPVKIENMRVMLKLD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLU n 1 4 ASN n 1 5 TRP n 1 6 ILE n 1 7 ASP n 1 8 ALA n 1 9 ALA n 1 10 ALA n 1 11 ARG n 1 12 ASP n 1 13 GLU n 1 14 VAL n 1 15 PRO n 1 16 GLU n 1 17 GLY n 1 18 ASP n 1 19 VAL n 1 20 ILE n 1 21 GLY n 1 22 ILE n 1 23 ASN n 1 24 ILE n 1 25 VAL n 1 26 GLY n 1 27 LYS n 1 28 GLU n 1 29 ILE n 1 30 ALA n 1 31 LEU n 1 32 TYR n 1 33 GLU n 1 34 VAL n 1 35 ALA n 1 36 GLY n 1 37 GLU n 1 38 ILE n 1 39 TYR n 1 40 ALA n 1 41 THR n 1 42 ASP n 1 43 ASN n 1 44 THR n 1 45 CYS n 1 46 THR n 1 47 HIS n 1 48 GLY n 1 49 ALA n 1 50 ALA n 1 51 ARG n 1 52 MET n 1 53 SER n 1 54 ASP n 1 55 GLY n 1 56 PHE n 1 57 LEU n 1 58 GLU n 1 59 GLY n 1 60 ARG n 1 61 GLU n 1 62 ILE n 1 63 GLU n 1 64 CYS n 1 65 PRO n 1 66 LEU n 1 67 HIS n 1 68 GLN n 1 69 GLY n 1 70 ARG n 1 71 PHE n 1 72 ASP n 1 73 VAL n 1 74 CYS n 1 75 THR n 1 76 GLY n 1 77 LYS n 1 78 ALA n 1 79 LEU n 1 80 CYS n 1 81 THR n 1 82 PRO n 1 83 LEU n 1 84 THR n 1 85 GLN n 1 86 ASP n 1 87 ILE n 1 88 LYS n 1 89 THR n 1 90 TYR n 1 91 PRO n 1 92 VAL n 1 93 LYS n 1 94 ILE n 1 95 GLU n 1 96 ASN n 1 97 MET n 1 98 ARG n 1 99 VAL n 1 100 MET n 1 101 LEU n 1 102 LYS n 1 103 LEU n 1 104 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 104 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene mntAb _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Diaphorobacter sp. DS2' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1302548 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ Bacteria _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET21a, pDS2' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.db_code M9PSS0_9BURK _struct_ref.db_name UNP _struct_ref.details ? _struct_ref.entity_id 1 _struct_ref.id 1 _struct_ref.seq_align ? _struct_ref.seq_dif ? _struct_ref.pdbx_db_accession M9PSS0 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ;MSENWIDAAARDEVPEGDVIGINIVGKEIALYEVAGEIYATDNTCTHGAARMSDGFLEGREIECPLHQGRFDVCTGKALC TPLTQDIKTYPVKIENMRVMLKLD ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_align_end ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5BOK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession M9PSS0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 104 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 104 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 FES non-polymer . 'FE2/S2 (INORGANIC) CLUSTER' ? 'Fe2 S2' 175.820 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5BOK _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.75 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 67.26 _exptl_crystal.description 'chocolate brown hexagonal plated crystal' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '200mM calcium chloride, 100mM HEPES pH 7.5, 25-28% PEG 400' _exptl_crystal_grow.pdbx_pH_range 7.1-7.7 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-06-24 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.873 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.873 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 48.39 _reflns.entry_id 5BOK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.1 _reflns.d_resolution_low 56.27 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10628 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.6 _reflns.pdbx_Rmerge_I_obs 0.063 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.022 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.28 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.1 _reflns_shell.d_res_low 2.21 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.3 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 8.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5BOK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.400 _refine.ls_d_res_low 13.74 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7088 _refine.ls_number_reflns_R_free 336 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.12 _refine.ls_percent_reflns_R_free 4.74 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2328 _refine.ls_R_factor_R_free 0.2619 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2312 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.46 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2QPZ _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details Random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.28 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.37 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 785 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 805 _refine_hist.d_res_high 2.400 _refine_hist.d_res_low 13.74 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 ? 818 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.344 ? 1102 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 15.896 ? 304 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.052 ? 124 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 145 ? f_plane_restr ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.4000 _refine_ls_shell.d_res_low 3.0235 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 151 _refine_ls_shell.number_reflns_R_work 3327 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3324 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2826 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5BOK _struct.title 'Ferredoxin component of 3-nitrotoluene dioxygenase from Diaphorobacter sp. strain DS2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5BOK _struct_keywords.text 'electron transport protein, Rieske iron sulfur cluster, ferredoxin, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 12 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 14 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 12 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 14 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLY 17 O ? ? ? 1_555 C FE . FE ? ? A GLY 17 A FE 202 6_557 ? ? ? ? ? ? ? 2.456 ? ? metalc2 metalc ? ? A CYS 45 SG ? ? ? 1_555 B FES . FE1 ? ? A CYS 45 A FES 201 1_555 ? ? ? ? ? ? ? 2.316 ? ? metalc3 metalc ? ? A HIS 47 ND1 ? ? ? 1_555 B FES . FE2 ? ? A HIS 47 A FES 201 1_555 ? ? ? ? ? ? ? 2.061 ? ? metalc4 metalc ? ? A LEU 57 O ? ? ? 1_555 C FE . FE ? ? A LEU 57 A FE 202 6_557 ? ? ? ? ? ? ? 2.349 ? ? metalc5 metalc ? ? A GLU 58 OE1 ? ? ? 1_555 C FE . FE ? ? A GLU 58 A FE 202 1_555 ? ? ? ? ? ? ? 2.791 ? ? metalc6 metalc ? ? A GLU 58 OE2 ? ? ? 1_555 C FE . FE ? ? A GLU 58 A FE 202 1_555 ? ? ? ? ? ? ? 2.754 ? ? metalc7 metalc ? ? A CYS 64 SG ? ? ? 1_555 B FES . FE1 ? ? A CYS 64 A FES 201 1_555 ? ? ? ? ? ? ? 2.277 ? ? metalc8 metalc ? ? A HIS 67 ND1 ? ? ? 1_555 B FES . FE2 ? ? A HIS 67 A FES 201 1_555 ? ? ? ? ? ? ? 2.091 ? ? metalc9 metalc ? ? C FE . FE ? ? ? 1_555 D HOH . O ? ? A FE 202 A HOH 304 6_557 ? ? ? ? ? ? ? 2.545 ? ? metalc10 metalc ? ? C FE . FE ? ? ? 1_555 D HOH . O ? ? A FE 202 A HOH 312 6_557 ? ? ? ? ? ? ? 2.547 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASP 54 A . ? ASP 54 A GLY 55 A ? GLY 55 A 1 -2.90 2 THR 81 A . ? THR 81 A PRO 82 A ? PRO 82 A 1 5.10 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TRP A 5 ? ALA A 10 ? TRP A 5 ALA A 10 AA1 2 ARG A 98 ? LYS A 102 ? ARG A 98 LYS A 102 AA1 3 VAL A 92 ? GLU A 95 ? VAL A 92 GLU A 95 AA2 1 VAL A 19 ? ILE A 24 ? VAL A 19 ILE A 24 AA2 2 LYS A 27 ? VAL A 34 ? LYS A 27 VAL A 34 AA2 3 GLU A 37 ? ASP A 42 ? GLU A 37 ASP A 42 AA3 1 LEU A 57 ? GLU A 58 ? LEU A 57 GLU A 58 AA3 2 GLU A 61 ? GLU A 63 ? GLU A 61 GLU A 63 AA3 3 ARG A 70 ? ASP A 72 ? ARG A 70 ASP A 72 AA3 4 ALA A 78 ? CYS A 80 ? ALA A 78 CYS A 80 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 9 ? N ALA A 9 O VAL A 99 ? O VAL A 99 AA1 2 3 O MET A 100 ? O MET A 100 N LYS A 93 ? N LYS A 93 AA2 1 2 N ILE A 22 ? N ILE A 22 O ILE A 29 ? O ILE A 29 AA2 2 3 N ALA A 30 ? N ALA A 30 O THR A 41 ? O THR A 41 AA3 1 2 N GLU A 58 ? N GLU A 58 O GLU A 61 ? O GLU A 61 AA3 2 3 N ILE A 62 ? N ILE A 62 O PHE A 71 ? O PHE A 71 AA3 3 4 N ARG A 70 ? N ARG A 70 O LEU A 79 ? O LEU A 79 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A FES 201 ? 5 'binding site for residue FES A 201' AC2 Software A FE 202 ? 5 'binding site for residue FE A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 45 ? CYS A 45 . ? 1_555 ? 2 AC1 5 HIS A 47 ? HIS A 47 . ? 1_555 ? 3 AC1 5 GLY A 48 ? GLY A 48 . ? 1_555 ? 4 AC1 5 CYS A 64 ? CYS A 64 . ? 1_555 ? 5 AC1 5 HIS A 67 ? HIS A 67 . ? 1_555 ? 6 AC2 5 GLY A 17 ? GLY A 17 . ? 6_557 ? 7 AC2 5 LEU A 57 ? LEU A 57 . ? 6_557 ? 8 AC2 5 GLU A 58 ? GLU A 58 . ? 1_555 ? 9 AC2 5 HOH D . ? HOH A 304 . ? 6_557 ? 10 AC2 5 HOH D . ? HOH A 312 . ? 6_557 ? # _atom_sites.entry_id 5BOK _atom_sites.fract_transf_matrix[1][1] 0.012574 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012574 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009177 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 TRP 5 5 5 TRP TRP A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 CYS 80 80 80 CYS CYS A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ASP 104 104 104 ASP ASP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FES 1 201 201 FES FES A . C 3 FE 1 202 211 FE FE A . D 4 HOH 1 301 4 HOH HOH A . D 4 HOH 2 302 7 HOH HOH A . D 4 HOH 3 303 20 HOH HOH A . D 4 HOH 4 304 3 HOH HOH A . D 4 HOH 5 305 22 HOH HOH A . D 4 HOH 6 306 15 HOH HOH A . D 4 HOH 7 307 1 HOH HOH A . D 4 HOH 8 308 5 HOH HOH A . D 4 HOH 9 309 2 HOH HOH A . D 4 HOH 10 310 8 HOH HOH A . D 4 HOH 11 311 6 HOH HOH A . D 4 HOH 12 312 9 HOH HOH A . D 4 HOH 13 313 17 HOH HOH A . D 4 HOH 14 314 19 HOH HOH A . D 4 HOH 15 315 11 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id PHE _pdbx_struct_special_symmetry.auth_seq_id 56 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id A _pdbx_struct_special_symmetry.label_comp_id PHE _pdbx_struct_special_symmetry.label_seq_id 56 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A GLY 17 ? A GLY 17 ? 1_555 FE ? C FE . ? A FE 202 ? 6_557 O ? A LEU 57 ? A LEU 57 ? 1_555 85.4 ? 2 O ? A GLY 17 ? A GLY 17 ? 1_555 FE ? C FE . ? A FE 202 ? 6_557 OE1 ? A GLU 58 ? A GLU 58 ? 1_555 133.9 ? 3 O ? A LEU 57 ? A LEU 57 ? 1_555 FE ? C FE . ? A FE 202 ? 6_557 OE1 ? A GLU 58 ? A GLU 58 ? 1_555 50.4 ? 4 O ? A GLY 17 ? A GLY 17 ? 1_555 FE ? C FE . ? A FE 202 ? 6_557 OE2 ? A GLU 58 ? A GLU 58 ? 1_555 147.0 ? 5 O ? A LEU 57 ? A LEU 57 ? 1_555 FE ? C FE . ? A FE 202 ? 6_557 OE2 ? A GLU 58 ? A GLU 58 ? 1_555 67.5 ? 6 OE1 ? A GLU 58 ? A GLU 58 ? 1_555 FE ? C FE . ? A FE 202 ? 6_557 OE2 ? A GLU 58 ? A GLU 58 ? 1_555 17.6 ? 7 O ? A GLY 17 ? A GLY 17 ? 1_555 FE ? C FE . ? A FE 202 ? 6_557 O ? D HOH . ? A HOH 304 ? 6_557 158.5 ? 8 O ? A LEU 57 ? A LEU 57 ? 1_555 FE ? C FE . ? A FE 202 ? 6_557 O ? D HOH . ? A HOH 304 ? 6_557 76.9 ? 9 OE1 ? A GLU 58 ? A GLU 58 ? 1_555 FE ? C FE . ? A FE 202 ? 6_557 O ? D HOH . ? A HOH 304 ? 6_557 26.6 ? 10 OE2 ? A GLU 58 ? A GLU 58 ? 1_555 FE ? C FE . ? A FE 202 ? 6_557 O ? D HOH . ? A HOH 304 ? 6_557 11.5 ? 11 O ? A GLY 17 ? A GLY 17 ? 1_555 FE ? C FE . ? A FE 202 ? 6_557 O ? D HOH . ? A HOH 312 ? 6_557 137.1 ? 12 O ? A LEU 57 ? A LEU 57 ? 1_555 FE ? C FE . ? A FE 202 ? 6_557 O ? D HOH . ? A HOH 312 ? 6_557 51.9 ? 13 OE1 ? A GLU 58 ? A GLU 58 ? 1_555 FE ? C FE . ? A FE 202 ? 6_557 O ? D HOH . ? A HOH 312 ? 6_557 14.8 ? 14 OE2 ? A GLU 58 ? A GLU 58 ? 1_555 FE ? C FE . ? A FE 202 ? 6_557 O ? D HOH . ? A HOH 312 ? 6_557 25.7 ? 15 O ? D HOH . ? A HOH 304 ? 6_557 FE ? C FE . ? A FE 202 ? 6_557 O ? D HOH . ? A HOH 312 ? 6_557 29.2 ? 16 SG ? A CYS 45 ? A CYS 45 ? 1_555 FE1 ? B FES . ? A FES 201 ? 1_555 S1 ? B FES . ? A FES 201 ? 1_555 113.3 ? 17 SG ? A CYS 45 ? A CYS 45 ? 1_555 FE1 ? B FES . ? A FES 201 ? 1_555 S2 ? B FES . ? A FES 201 ? 1_555 105.8 ? 18 S1 ? B FES . ? A FES 201 ? 1_555 FE1 ? B FES . ? A FES 201 ? 1_555 S2 ? B FES . ? A FES 201 ? 1_555 91.8 ? 19 SG ? A CYS 45 ? A CYS 45 ? 1_555 FE1 ? B FES . ? A FES 201 ? 1_555 SG ? A CYS 64 ? A CYS 64 ? 1_555 117.3 ? 20 S1 ? B FES . ? A FES 201 ? 1_555 FE1 ? B FES . ? A FES 201 ? 1_555 SG ? A CYS 64 ? A CYS 64 ? 1_555 114.0 ? 21 S2 ? B FES . ? A FES 201 ? 1_555 FE1 ? B FES . ? A FES 201 ? 1_555 SG ? A CYS 64 ? A CYS 64 ? 1_555 111.3 ? 22 ND1 ? A HIS 47 ? A HIS 47 ? 1_555 FE2 ? B FES . ? A FES 201 ? 1_555 S1 ? B FES . ? A FES 201 ? 1_555 120.8 ? 23 ND1 ? A HIS 47 ? A HIS 47 ? 1_555 FE2 ? B FES . ? A FES 201 ? 1_555 S2 ? B FES . ? A FES 201 ? 1_555 129.1 ? 24 S1 ? B FES . ? A FES 201 ? 1_555 FE2 ? B FES . ? A FES 201 ? 1_555 S2 ? B FES . ? A FES 201 ? 1_555 91.6 ? 25 ND1 ? A HIS 47 ? A HIS 47 ? 1_555 FE2 ? B FES . ? A FES 201 ? 1_555 ND1 ? A HIS 67 ? A HIS 67 ? 1_555 111.6 ? 26 S1 ? B FES . ? A FES 201 ? 1_555 FE2 ? B FES . ? A FES 201 ? 1_555 ND1 ? A HIS 67 ? A HIS 67 ? 1_555 105.3 ? 27 S2 ? B FES . ? A FES 201 ? 1_555 FE2 ? B FES . ? A FES 201 ? 1_555 ND1 ? A HIS 67 ? A HIS 67 ? 1_555 93.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-07-27 2 'Structure model' 1 1 2023-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' pdbx_prerelease_seq 6 2 'Structure model' pdbx_struct_conn_angle 7 2 'Structure model' pdbx_struct_oper_list 8 2 'Structure model' pdbx_struct_special_symmetry 9 2 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 17 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 18 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 19 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 20 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 21 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 22 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 23 2 'Structure model' '_pdbx_struct_conn_angle.value' 24 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 25 2 'Structure model' '_struct_conn.pdbx_dist_value' 26 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 27 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 28 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 29 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 30 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 31 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 32 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 33 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 34 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 35 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 36 2 'Structure model' '_struct_conn.ptnr2_symmetry' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_1839 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? d*TREK ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 56 ? A 77.31 88.86 2 1 PHE A 56 ? B 85.49 84.47 3 1 LEU A 66 ? ? -89.07 -71.35 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FE FE FE N N 88 FES FE1 FE N N 89 FES FE2 FE N N 90 FES S1 S N N 91 FES S2 S N N 92 GLN N N N N 93 GLN CA C N S 94 GLN C C N N 95 GLN O O N N 96 GLN CB C N N 97 GLN CG C N N 98 GLN CD C N N 99 GLN OE1 O N N 100 GLN NE2 N N N 101 GLN OXT O N N 102 GLN H H N N 103 GLN H2 H N N 104 GLN HA H N N 105 GLN HB2 H N N 106 GLN HB3 H N N 107 GLN HG2 H N N 108 GLN HG3 H N N 109 GLN HE21 H N N 110 GLN HE22 H N N 111 GLN HXT H N N 112 GLU N N N N 113 GLU CA C N S 114 GLU C C N N 115 GLU O O N N 116 GLU CB C N N 117 GLU CG C N N 118 GLU CD C N N 119 GLU OE1 O N N 120 GLU OE2 O N N 121 GLU OXT O N N 122 GLU H H N N 123 GLU H2 H N N 124 GLU HA H N N 125 GLU HB2 H N N 126 GLU HB3 H N N 127 GLU HG2 H N N 128 GLU HG3 H N N 129 GLU HE2 H N N 130 GLU HXT H N N 131 GLY N N N N 132 GLY CA C N N 133 GLY C C N N 134 GLY O O N N 135 GLY OXT O N N 136 GLY H H N N 137 GLY H2 H N N 138 GLY HA2 H N N 139 GLY HA3 H N N 140 GLY HXT H N N 141 HIS N N N N 142 HIS CA C N S 143 HIS C C N N 144 HIS O O N N 145 HIS CB C N N 146 HIS CG C Y N 147 HIS ND1 N Y N 148 HIS CD2 C Y N 149 HIS CE1 C Y N 150 HIS NE2 N Y N 151 HIS OXT O N N 152 HIS H H N N 153 HIS H2 H N N 154 HIS HA H N N 155 HIS HB2 H N N 156 HIS HB3 H N N 157 HIS HD1 H N N 158 HIS HD2 H N N 159 HIS HE1 H N N 160 HIS HE2 H N N 161 HIS HXT H N N 162 HOH O O N N 163 HOH H1 H N N 164 HOH H2 H N N 165 ILE N N N N 166 ILE CA C N S 167 ILE C C N N 168 ILE O O N N 169 ILE CB C N S 170 ILE CG1 C N N 171 ILE CG2 C N N 172 ILE CD1 C N N 173 ILE OXT O N N 174 ILE H H N N 175 ILE H2 H N N 176 ILE HA H N N 177 ILE HB H N N 178 ILE HG12 H N N 179 ILE HG13 H N N 180 ILE HG21 H N N 181 ILE HG22 H N N 182 ILE HG23 H N N 183 ILE HD11 H N N 184 ILE HD12 H N N 185 ILE HD13 H N N 186 ILE HXT H N N 187 LEU N N N N 188 LEU CA C N S 189 LEU C C N N 190 LEU O O N N 191 LEU CB C N N 192 LEU CG C N N 193 LEU CD1 C N N 194 LEU CD2 C N N 195 LEU OXT O N N 196 LEU H H N N 197 LEU H2 H N N 198 LEU HA H N N 199 LEU HB2 H N N 200 LEU HB3 H N N 201 LEU HG H N N 202 LEU HD11 H N N 203 LEU HD12 H N N 204 LEU HD13 H N N 205 LEU HD21 H N N 206 LEU HD22 H N N 207 LEU HD23 H N N 208 LEU HXT H N N 209 LYS N N N N 210 LYS CA C N S 211 LYS C C N N 212 LYS O O N N 213 LYS CB C N N 214 LYS CG C N N 215 LYS CD C N N 216 LYS CE C N N 217 LYS NZ N N N 218 LYS OXT O N N 219 LYS H H N N 220 LYS H2 H N N 221 LYS HA H N N 222 LYS HB2 H N N 223 LYS HB3 H N N 224 LYS HG2 H N N 225 LYS HG3 H N N 226 LYS HD2 H N N 227 LYS HD3 H N N 228 LYS HE2 H N N 229 LYS HE3 H N N 230 LYS HZ1 H N N 231 LYS HZ2 H N N 232 LYS HZ3 H N N 233 LYS HXT H N N 234 MET N N N N 235 MET CA C N S 236 MET C C N N 237 MET O O N N 238 MET CB C N N 239 MET CG C N N 240 MET SD S N N 241 MET CE C N N 242 MET OXT O N N 243 MET H H N N 244 MET H2 H N N 245 MET HA H N N 246 MET HB2 H N N 247 MET HB3 H N N 248 MET HG2 H N N 249 MET HG3 H N N 250 MET HE1 H N N 251 MET HE2 H N N 252 MET HE3 H N N 253 MET HXT H N N 254 PHE N N N N 255 PHE CA C N S 256 PHE C C N N 257 PHE O O N N 258 PHE CB C N N 259 PHE CG C Y N 260 PHE CD1 C Y N 261 PHE CD2 C Y N 262 PHE CE1 C Y N 263 PHE CE2 C Y N 264 PHE CZ C Y N 265 PHE OXT O N N 266 PHE H H N N 267 PHE H2 H N N 268 PHE HA H N N 269 PHE HB2 H N N 270 PHE HB3 H N N 271 PHE HD1 H N N 272 PHE HD2 H N N 273 PHE HE1 H N N 274 PHE HE2 H N N 275 PHE HZ H N N 276 PHE HXT H N N 277 PRO N N N N 278 PRO CA C N S 279 PRO C C N N 280 PRO O O N N 281 PRO CB C N N 282 PRO CG C N N 283 PRO CD C N N 284 PRO OXT O N N 285 PRO H H N N 286 PRO HA H N N 287 PRO HB2 H N N 288 PRO HB3 H N N 289 PRO HG2 H N N 290 PRO HG3 H N N 291 PRO HD2 H N N 292 PRO HD3 H N N 293 PRO HXT H N N 294 SER N N N N 295 SER CA C N S 296 SER C C N N 297 SER O O N N 298 SER CB C N N 299 SER OG O N N 300 SER OXT O N N 301 SER H H N N 302 SER H2 H N N 303 SER HA H N N 304 SER HB2 H N N 305 SER HB3 H N N 306 SER HG H N N 307 SER HXT H N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FES FE1 S1 sing N N 83 FES FE1 S2 sing N N 84 FES FE2 S1 sing N N 85 FES FE2 S2 sing N N 86 GLN N CA sing N N 87 GLN N H sing N N 88 GLN N H2 sing N N 89 GLN CA C sing N N 90 GLN CA CB sing N N 91 GLN CA HA sing N N 92 GLN C O doub N N 93 GLN C OXT sing N N 94 GLN CB CG sing N N 95 GLN CB HB2 sing N N 96 GLN CB HB3 sing N N 97 GLN CG CD sing N N 98 GLN CG HG2 sing N N 99 GLN CG HG3 sing N N 100 GLN CD OE1 doub N N 101 GLN CD NE2 sing N N 102 GLN NE2 HE21 sing N N 103 GLN NE2 HE22 sing N N 104 GLN OXT HXT sing N N 105 GLU N CA sing N N 106 GLU N H sing N N 107 GLU N H2 sing N N 108 GLU CA C sing N N 109 GLU CA CB sing N N 110 GLU CA HA sing N N 111 GLU C O doub N N 112 GLU C OXT sing N N 113 GLU CB CG sing N N 114 GLU CB HB2 sing N N 115 GLU CB HB3 sing N N 116 GLU CG CD sing N N 117 GLU CG HG2 sing N N 118 GLU CG HG3 sing N N 119 GLU CD OE1 doub N N 120 GLU CD OE2 sing N N 121 GLU OE2 HE2 sing N N 122 GLU OXT HXT sing N N 123 GLY N CA sing N N 124 GLY N H sing N N 125 GLY N H2 sing N N 126 GLY CA C sing N N 127 GLY CA HA2 sing N N 128 GLY CA HA3 sing N N 129 GLY C O doub N N 130 GLY C OXT sing N N 131 GLY OXT HXT sing N N 132 HIS N CA sing N N 133 HIS N H sing N N 134 HIS N H2 sing N N 135 HIS CA C sing N N 136 HIS CA CB sing N N 137 HIS CA HA sing N N 138 HIS C O doub N N 139 HIS C OXT sing N N 140 HIS CB CG sing N N 141 HIS CB HB2 sing N N 142 HIS CB HB3 sing N N 143 HIS CG ND1 sing Y N 144 HIS CG CD2 doub Y N 145 HIS ND1 CE1 doub Y N 146 HIS ND1 HD1 sing N N 147 HIS CD2 NE2 sing Y N 148 HIS CD2 HD2 sing N N 149 HIS CE1 NE2 sing Y N 150 HIS CE1 HE1 sing N N 151 HIS NE2 HE2 sing N N 152 HIS OXT HXT sing N N 153 HOH O H1 sing N N 154 HOH O H2 sing N N 155 ILE N CA sing N N 156 ILE N H sing N N 157 ILE N H2 sing N N 158 ILE CA C sing N N 159 ILE CA CB sing N N 160 ILE CA HA sing N N 161 ILE C O doub N N 162 ILE C OXT sing N N 163 ILE CB CG1 sing N N 164 ILE CB CG2 sing N N 165 ILE CB HB sing N N 166 ILE CG1 CD1 sing N N 167 ILE CG1 HG12 sing N N 168 ILE CG1 HG13 sing N N 169 ILE CG2 HG21 sing N N 170 ILE CG2 HG22 sing N N 171 ILE CG2 HG23 sing N N 172 ILE CD1 HD11 sing N N 173 ILE CD1 HD12 sing N N 174 ILE CD1 HD13 sing N N 175 ILE OXT HXT sing N N 176 LEU N CA sing N N 177 LEU N H sing N N 178 LEU N H2 sing N N 179 LEU CA C sing N N 180 LEU CA CB sing N N 181 LEU CA HA sing N N 182 LEU C O doub N N 183 LEU C OXT sing N N 184 LEU CB CG sing N N 185 LEU CB HB2 sing N N 186 LEU CB HB3 sing N N 187 LEU CG CD1 sing N N 188 LEU CG CD2 sing N N 189 LEU CG HG sing N N 190 LEU CD1 HD11 sing N N 191 LEU CD1 HD12 sing N N 192 LEU CD1 HD13 sing N N 193 LEU CD2 HD21 sing N N 194 LEU CD2 HD22 sing N N 195 LEU CD2 HD23 sing N N 196 LEU OXT HXT sing N N 197 LYS N CA sing N N 198 LYS N H sing N N 199 LYS N H2 sing N N 200 LYS CA C sing N N 201 LYS CA CB sing N N 202 LYS CA HA sing N N 203 LYS C O doub N N 204 LYS C OXT sing N N 205 LYS CB CG sing N N 206 LYS CB HB2 sing N N 207 LYS CB HB3 sing N N 208 LYS CG CD sing N N 209 LYS CG HG2 sing N N 210 LYS CG HG3 sing N N 211 LYS CD CE sing N N 212 LYS CD HD2 sing N N 213 LYS CD HD3 sing N N 214 LYS CE NZ sing N N 215 LYS CE HE2 sing N N 216 LYS CE HE3 sing N N 217 LYS NZ HZ1 sing N N 218 LYS NZ HZ2 sing N N 219 LYS NZ HZ3 sing N N 220 LYS OXT HXT sing N N 221 MET N CA sing N N 222 MET N H sing N N 223 MET N H2 sing N N 224 MET CA C sing N N 225 MET CA CB sing N N 226 MET CA HA sing N N 227 MET C O doub N N 228 MET C OXT sing N N 229 MET CB CG sing N N 230 MET CB HB2 sing N N 231 MET CB HB3 sing N N 232 MET CG SD sing N N 233 MET CG HG2 sing N N 234 MET CG HG3 sing N N 235 MET SD CE sing N N 236 MET CE HE1 sing N N 237 MET CE HE2 sing N N 238 MET CE HE3 sing N N 239 MET OXT HXT sing N N 240 PHE N CA sing N N 241 PHE N H sing N N 242 PHE N H2 sing N N 243 PHE CA C sing N N 244 PHE CA CB sing N N 245 PHE CA HA sing N N 246 PHE C O doub N N 247 PHE C OXT sing N N 248 PHE CB CG sing N N 249 PHE CB HB2 sing N N 250 PHE CB HB3 sing N N 251 PHE CG CD1 doub Y N 252 PHE CG CD2 sing Y N 253 PHE CD1 CE1 sing Y N 254 PHE CD1 HD1 sing N N 255 PHE CD2 CE2 doub Y N 256 PHE CD2 HD2 sing N N 257 PHE CE1 CZ doub Y N 258 PHE CE1 HE1 sing N N 259 PHE CE2 CZ sing Y N 260 PHE CE2 HE2 sing N N 261 PHE CZ HZ sing N N 262 PHE OXT HXT sing N N 263 PRO N CA sing N N 264 PRO N CD sing N N 265 PRO N H sing N N 266 PRO CA C sing N N 267 PRO CA CB sing N N 268 PRO CA HA sing N N 269 PRO C O doub N N 270 PRO C OXT sing N N 271 PRO CB CG sing N N 272 PRO CB HB2 sing N N 273 PRO CB HB3 sing N N 274 PRO CG CD sing N N 275 PRO CG HG2 sing N N 276 PRO CG HG3 sing N N 277 PRO CD HD2 sing N N 278 PRO CD HD3 sing N N 279 PRO OXT HXT sing N N 280 SER N CA sing N N 281 SER N H sing N N 282 SER N H2 sing N N 283 SER CA C sing N N 284 SER CA CB sing N N 285 SER CA HA sing N N 286 SER C O doub N N 287 SER C OXT sing N N 288 SER CB OG sing N N 289 SER CB HB2 sing N N 290 SER CB HB3 sing N N 291 SER OG HG sing N N 292 SER OXT HXT sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # _pdbx_audit_support.funding_organization 'Department of biotechnology' _pdbx_audit_support.country India _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE2/S2 (INORGANIC) CLUSTER' FES 3 'FE (III) ION' FE 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2QPZ _pdbx_initial_refinement_model.details ? #