data_5D47 # _entry.id 5D47 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5D47 pdb_00005d47 10.2210/pdb5d47/pdb WWPDB D_1000212647 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5D45 PDB . unspecified 5D48 PDB . unspecified 5D4A PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5D47 _pdbx_database_status.recvd_initial_deposition_date 2015-08-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tagami, U.' 1 'Takahashi, K.' 2 'Igarashi, S.' 3 'Ejima, C.' 4 'Yoshida, T.' 5 'Takeshita, S.' 6 'Miyanaga, W.' 7 'Sugiki, M.' 8 'Tokumasu, M.' 9 'Hatanaka, T.' 10 'Kashiwagi, T.' 11 'Ishikawa, K.' 12 'Miyano, H.' 13 'Mizukoshi, T.' 14 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Med.Chem.Lett.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1948-5875 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first 435 _citation.page_last 439 _citation.title 'Interaction Analysis of FABP4 Inhibitors by X-ray Crystallography and Fragment Molecular Orbital Analysis' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsmedchemlett.6b00040 _citation.pdbx_database_id_PubMed 27096055 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tagami, U.' 1 ? primary 'Takahashi, K.' 2 ? primary 'Igarashi, S.' 3 ? primary 'Ejima, C.' 4 ? primary 'Yoshida, T.' 5 ? primary 'Takeshita, S.' 6 ? primary 'Miyanaga, W.' 7 ? primary 'Sugiki, M.' 8 ? primary 'Tokumasu, M.' 9 ? primary 'Hatanaka, T.' 10 ? primary 'Kashiwagi, T.' 11 ? primary 'Ishikawa, K.' 12 ? primary 'Miyano, H.' 13 ? primary 'Mizukoshi, T.' 14 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5D47 _cell.details ? _cell.formula_units_Z ? _cell.length_a 32.300 _cell.length_a_esd ? _cell.length_b 53.830 _cell.length_b_esd ? _cell.length_c 74.860 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5D47 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Fatty acid-binding protein, adipocyte' 16911.268 1 ? ? ? ? 2 non-polymer syn '3-[5-cyclopropyl-3-(3-methoxypyridin-4-yl)-2-phenyl-1H-indol-1-yl]propanoic acid' 412.480 1 ? ? ? ? 3 water nat water 18.015 119 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Adipocyte lipid-binding protein,ALBP,Adipocyte-type fatty acid-binding protein,AFABP,Fatty acid-binding protein 4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 CYS n 1 23 ASP n 1 24 ALA n 1 25 PHE n 1 26 VAL n 1 27 GLY n 1 28 THR n 1 29 TRP n 1 30 LYS n 1 31 LEU n 1 32 VAL n 1 33 SER n 1 34 SER n 1 35 GLU n 1 36 ASN n 1 37 PHE n 1 38 ASP n 1 39 ASP n 1 40 TYR n 1 41 MET n 1 42 LYS n 1 43 GLU n 1 44 VAL n 1 45 GLY n 1 46 VAL n 1 47 GLY n 1 48 PHE n 1 49 ALA n 1 50 THR n 1 51 ARG n 1 52 LYS n 1 53 VAL n 1 54 ALA n 1 55 GLY n 1 56 MET n 1 57 ALA n 1 58 LYS n 1 59 PRO n 1 60 ASN n 1 61 MET n 1 62 ILE n 1 63 ILE n 1 64 SER n 1 65 VAL n 1 66 ASN n 1 67 GLY n 1 68 ASP n 1 69 VAL n 1 70 ILE n 1 71 THR n 1 72 ILE n 1 73 LYS n 1 74 SER n 1 75 GLU n 1 76 SER n 1 77 THR n 1 78 PHE n 1 79 LYS n 1 80 ASN n 1 81 THR n 1 82 GLU n 1 83 ILE n 1 84 SER n 1 85 PHE n 1 86 ILE n 1 87 LEU n 1 88 GLY n 1 89 GLN n 1 90 GLU n 1 91 PHE n 1 92 ASP n 1 93 GLU n 1 94 VAL n 1 95 THR n 1 96 ALA n 1 97 ASP n 1 98 ASP n 1 99 ARG n 1 100 LYS n 1 101 VAL n 1 102 LYS n 1 103 SER n 1 104 THR n 1 105 ILE n 1 106 THR n 1 107 LEU n 1 108 ASP n 1 109 GLY n 1 110 GLY n 1 111 VAL n 1 112 LEU n 1 113 VAL n 1 114 HIS n 1 115 VAL n 1 116 GLN n 1 117 LYS n 1 118 TRP n 1 119 ASP n 1 120 GLY n 1 121 LYS n 1 122 SER n 1 123 THR n 1 124 THR n 1 125 ILE n 1 126 LYS n 1 127 ARG n 1 128 LYS n 1 129 ARG n 1 130 GLU n 1 131 ASP n 1 132 ASP n 1 133 LYS n 1 134 LEU n 1 135 VAL n 1 136 VAL n 1 137 GLU n 1 138 CYS n 1 139 VAL n 1 140 MET n 1 141 LYS n 1 142 GLY n 1 143 VAL n 1 144 THR n 1 145 SER n 1 146 THR n 1 147 ARG n 1 148 VAL n 1 149 TYR n 1 150 GLU n 1 151 ARG n 1 152 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 152 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FABP4 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FABP4_HUMAN _struct_ref.pdbx_db_accession P15090 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRK VKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5D47 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 152 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P15090 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 132 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 131 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5D47 MET A 1 ? UNP P15090 ? ? 'expression tag' -20 1 1 5D47 GLY A 2 ? UNP P15090 ? ? 'expression tag' -19 2 1 5D47 SER A 3 ? UNP P15090 ? ? 'expression tag' -18 3 1 5D47 SER A 4 ? UNP P15090 ? ? 'expression tag' -17 4 1 5D47 HIS A 5 ? UNP P15090 ? ? 'expression tag' -16 5 1 5D47 HIS A 6 ? UNP P15090 ? ? 'expression tag' -15 6 1 5D47 HIS A 7 ? UNP P15090 ? ? 'expression tag' -14 7 1 5D47 HIS A 8 ? UNP P15090 ? ? 'expression tag' -13 8 1 5D47 HIS A 9 ? UNP P15090 ? ? 'expression tag' -12 9 1 5D47 HIS A 10 ? UNP P15090 ? ? 'expression tag' -11 10 1 5D47 SER A 11 ? UNP P15090 ? ? 'expression tag' -10 11 1 5D47 SER A 12 ? UNP P15090 ? ? 'expression tag' -9 12 1 5D47 GLY A 13 ? UNP P15090 ? ? 'expression tag' -8 13 1 5D47 LEU A 14 ? UNP P15090 ? ? 'expression tag' -7 14 1 5D47 VAL A 15 ? UNP P15090 ? ? 'expression tag' -6 15 1 5D47 PRO A 16 ? UNP P15090 ? ? 'expression tag' -5 16 1 5D47 ARG A 17 ? UNP P15090 ? ? 'expression tag' -4 17 1 5D47 GLY A 18 ? UNP P15090 ? ? 'expression tag' -3 18 1 5D47 SER A 19 ? UNP P15090 ? ? 'expression tag' -2 19 1 5D47 HIS A 20 ? UNP P15090 ? ? 'expression tag' -1 20 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 L19 non-polymer . '3-[5-cyclopropyl-3-(3-methoxypyridin-4-yl)-2-phenyl-1H-indol-1-yl]propanoic acid' ? 'C26 H24 N2 O3' 412.480 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5D47 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.92 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 36.08 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 296 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.4 M NaH2PO4/K2HPO4' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-11-16 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE AR-NW12A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline AR-NW12A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate 22.424 _reflns.entry_id 5D47 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.700 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14733 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.000 _reflns.percent_possible_obs 98.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs 0.049 _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 17.7 _reflns.pdbx_Rmerge_I_obs 0.045 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 29.230 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.049 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 104930 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.700 1.800 ? 7.640 ? 16385 2302 ? 2248 97.700 ? ? 0.205 ? 0.262 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.282 ? 0 1 1 ? ? 1.800 2.000 ? 14.050 ? 23792 3347 ? 3288 98.200 ? ? 0.117 ? 0.139 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.150 ? 0 2 1 ? ? 2.000 2.500 ? 26.750 ? 31523 4448 ? 4396 98.800 ? ? 0.048 ? 0.064 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.069 ? 0 3 1 ? ? 2.500 3.000 ? 39.760 ? 14081 1996 ? 1980 99.200 ? ? 0.028 ? 0.040 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.043 ? 0 4 1 ? ? 3.000 4.000 ? 57.580 ? 11122 1601 ? 1594 99.600 ? ? 0.015 ? 0.028 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.030 ? 0 5 1 ? ? 4.000 5.000 ? 66.210 ? 3907 587 ? 575 98.000 ? ? 0.012 ? 0.023 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.025 ? 0 6 1 ? ? 5.000 10.000 ? 63.560 ? 3665 574 ? 565 98.400 ? ? 0.012 ? 0.023 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.025 ? 0 7 1 ? ? 10.000 ? ? 60.040 ? 455 95 ? 87 91.600 ? ? 0.013 ? 0.024 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.026 ? 0 8 1 ? ? # _refine.aniso_B[1][1] 1.5200 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -0.5500 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -0.9700 _refine.B_iso_max 74.970 _refine.B_iso_mean 18.3270 _refine.B_iso_min 7.220 _refine.correlation_coeff_Fo_to_Fc 0.9540 _refine.correlation_coeff_Fo_to_Fc_free 0.9360 _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5D47 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.7000 _refine.ls_d_res_low 43.7000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13985 _refine.ls_number_reflns_R_free 747 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.5500 _refine.ls_percent_reflns_R_free 5.1000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1786 _refine.ls_R_factor_R_free 0.2124 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1769 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.2026 _refine.ls_wR_factor_R_work 0.1740 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2HNX _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1110 _refine.pdbx_overall_ESU_R_Free 0.1080 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 1.9820 _refine.overall_SU_ML 0.0670 _refine.overall_SU_R_Cruickshank_DPI 0.1112 _refine.overall_SU_R_free 0.1082 _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.8736 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.7000 _refine_hist.d_res_low 43.7000 _refine_hist.pdbx_number_atoms_ligand 31 _refine_hist.number_atoms_solvent 119 _refine_hist.number_atoms_total 1200 _refine_hist.pdbx_number_residues_total 135 _refine_hist.pdbx_B_iso_mean_ligand 28.36 _refine_hist.pdbx_B_iso_mean_solvent 32.09 _refine_hist.pdbx_number_atoms_protein 1050 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.023 0.020 1099 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 2.302 1.984 1480 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 6.623 5.000 134 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.141 24.545 44 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.801 15.000 205 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.395 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.178 0.200 167 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.012 0.020 800 ? r_gen_planes_refined ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.7000 _refine_ls_shell.d_res_low 1.7440 _refine_ls_shell.number_reflns_all 949 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 56 _refine_ls_shell.number_reflns_R_work 893 _refine_ls_shell.percent_reflns_obs 97.1300 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2350 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.1960 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5D47 _struct.title 'Crystal Structure of FABP4 in complex with 3-[5-cyclopropyl-3-(3-methoxypyridin-4-yl)-2-phenyl-1H-indol-1-yl] propanoic acid' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5D47 _struct_keywords.text 'FATTY ACID BINDING PROTEIN, LIPID BINDING PROTEIN' _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 20 ? PHE A 25 ? HIS A -1 PHE A 4 5 ? 6 HELX_P HELX_P2 AA2 ASN A 36 ? GLY A 45 ? ASN A 15 GLY A 24 1 ? 10 HELX_P HELX_P3 AA3 GLY A 47 ? ALA A 57 ? GLY A 26 ALA A 36 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASN A 80 ? ILE A 86 ? ASN A 59 ILE A 65 AA1 2 VAL A 69 ? GLU A 75 ? VAL A 48 GLU A 54 AA1 3 ASN A 60 ? ASN A 66 ? ASN A 39 ASN A 45 AA1 4 GLY A 27 ? GLU A 35 ? GLY A 6 GLU A 14 AA1 5 VAL A 143 ? ARG A 151 ? VAL A 122 ARG A 130 AA1 6 LYS A 133 ? MET A 140 ? LYS A 112 MET A 119 AA1 7 LYS A 121 ? GLU A 130 ? LYS A 100 GLU A 109 AA1 8 VAL A 111 ? TRP A 118 ? VAL A 90 TRP A 97 AA1 9 LYS A 100 ? ASP A 108 ? LYS A 79 ASP A 87 AA1 10 PHE A 91 ? VAL A 94 ? PHE A 70 VAL A 73 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 85 ? O PHE A 64 N ILE A 70 ? N ILE A 49 AA1 2 3 O THR A 71 ? O THR A 50 N SER A 64 ? N SER A 43 AA1 3 4 O MET A 61 ? O MET A 40 N TRP A 29 ? N TRP A 8 AA1 4 5 N VAL A 32 ? N VAL A 11 O VAL A 148 ? O VAL A 127 AA1 5 6 O ARG A 147 ? O ARG A 126 N VAL A 136 ? N VAL A 115 AA1 6 7 O VAL A 135 ? O VAL A 114 N LYS A 128 ? N LYS A 107 AA1 7 8 O LYS A 121 ? O LYS A 100 N TRP A 118 ? N TRP A 97 AA1 8 9 O VAL A 113 ? O VAL A 92 N THR A 106 ? N THR A 85 AA1 9 10 O SER A 103 ? O SER A 82 N PHE A 91 ? N PHE A 70 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id L19 _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 11 _struct_site.details 'binding site for residue L19 A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 PHE A 37 ? PHE A 16 . ? 1_555 ? 2 AC1 11 MET A 41 ? MET A 20 . ? 1_555 ? 3 AC1 11 ALA A 54 ? ALA A 33 . ? 1_555 ? 4 AC1 11 MET A 61 ? MET A 40 . ? 1_555 ? 5 AC1 11 SER A 74 ? SER A 53 . ? 1_555 ? 6 AC1 11 SER A 76 ? SER A 55 . ? 1_555 ? 7 AC1 11 LYS A 79 ? LYS A 58 . ? 1_555 ? 8 AC1 11 ASP A 97 ? ASP A 76 . ? 1_555 ? 9 AC1 11 ARG A 147 ? ARG A 126 . ? 1_555 ? 10 AC1 11 TYR A 149 ? TYR A 128 . ? 1_555 ? 11 AC1 11 HOH C . ? HOH A 326 . ? 1_555 ? # _atom_sites.entry_id 5D47 _atom_sites.fract_transf_matrix[1][1] 0.030960 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018577 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013358 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -20 ? ? ? A . n A 1 2 GLY 2 -19 ? ? ? A . n A 1 3 SER 3 -18 ? ? ? A . n A 1 4 SER 4 -17 ? ? ? A . n A 1 5 HIS 5 -16 ? ? ? A . n A 1 6 HIS 6 -15 ? ? ? A . n A 1 7 HIS 7 -14 ? ? ? A . n A 1 8 HIS 8 -13 ? ? ? A . n A 1 9 HIS 9 -12 ? ? ? A . n A 1 10 HIS 10 -11 ? ? ? A . n A 1 11 SER 11 -10 ? ? ? A . n A 1 12 SER 12 -9 ? ? ? A . n A 1 13 GLY 13 -8 ? ? ? A . n A 1 14 LEU 14 -7 ? ? ? A . n A 1 15 VAL 15 -6 ? ? ? A . n A 1 16 PRO 16 -5 ? ? ? A . n A 1 17 ARG 17 -4 ? ? ? A . n A 1 18 GLY 18 -3 -3 GLY GLY A . n A 1 19 SER 19 -2 -2 SER SER A . n A 1 20 HIS 20 -1 -1 HIS HIS A . n A 1 21 MET 21 0 0 MET MET A . n A 1 22 CYS 22 1 1 CYS CYS A . n A 1 23 ASP 23 2 2 ASP ASP A . n A 1 24 ALA 24 3 3 ALA ALA A . n A 1 25 PHE 25 4 4 PHE PHE A . n A 1 26 VAL 26 5 5 VAL VAL A . n A 1 27 GLY 27 6 6 GLY GLY A . n A 1 28 THR 28 7 7 THR THR A . n A 1 29 TRP 29 8 8 TRP TRP A . n A 1 30 LYS 30 9 9 LYS LYS A . n A 1 31 LEU 31 10 10 LEU LEU A . n A 1 32 VAL 32 11 11 VAL VAL A . n A 1 33 SER 33 12 12 SER SER A . n A 1 34 SER 34 13 13 SER SER A . n A 1 35 GLU 35 14 14 GLU GLU A . n A 1 36 ASN 36 15 15 ASN ASN A . n A 1 37 PHE 37 16 16 PHE PHE A . n A 1 38 ASP 38 17 17 ASP ASP A . n A 1 39 ASP 39 18 18 ASP ASP A . n A 1 40 TYR 40 19 19 TYR TYR A . n A 1 41 MET 41 20 20 MET MET A . n A 1 42 LYS 42 21 21 LYS LYS A . n A 1 43 GLU 43 22 22 GLU GLU A . n A 1 44 VAL 44 23 23 VAL VAL A . n A 1 45 GLY 45 24 24 GLY GLY A . n A 1 46 VAL 46 25 25 VAL VAL A . n A 1 47 GLY 47 26 26 GLY GLY A . n A 1 48 PHE 48 27 27 PHE PHE A . n A 1 49 ALA 49 28 28 ALA ALA A . n A 1 50 THR 50 29 29 THR THR A . n A 1 51 ARG 51 30 30 ARG ARG A . n A 1 52 LYS 52 31 31 LYS LYS A . n A 1 53 VAL 53 32 32 VAL VAL A . n A 1 54 ALA 54 33 33 ALA ALA A . n A 1 55 GLY 55 34 34 GLY GLY A . n A 1 56 MET 56 35 35 MET MET A . n A 1 57 ALA 57 36 36 ALA ALA A . n A 1 58 LYS 58 37 37 LYS LYS A . n A 1 59 PRO 59 38 38 PRO PRO A . n A 1 60 ASN 60 39 39 ASN ASN A . n A 1 61 MET 61 40 40 MET MET A . n A 1 62 ILE 62 41 41 ILE ILE A . n A 1 63 ILE 63 42 42 ILE ILE A . n A 1 64 SER 64 43 43 SER SER A . n A 1 65 VAL 65 44 44 VAL VAL A . n A 1 66 ASN 66 45 45 ASN ASN A . n A 1 67 GLY 67 46 46 GLY GLY A . n A 1 68 ASP 68 47 47 ASP ASP A . n A 1 69 VAL 69 48 48 VAL VAL A . n A 1 70 ILE 70 49 49 ILE ILE A . n A 1 71 THR 71 50 50 THR THR A . n A 1 72 ILE 72 51 51 ILE ILE A . n A 1 73 LYS 73 52 52 LYS LYS A . n A 1 74 SER 74 53 53 SER SER A . n A 1 75 GLU 75 54 54 GLU GLU A . n A 1 76 SER 76 55 55 SER SER A . n A 1 77 THR 77 56 56 THR THR A . n A 1 78 PHE 78 57 57 PHE PHE A . n A 1 79 LYS 79 58 58 LYS LYS A . n A 1 80 ASN 80 59 59 ASN ASN A . n A 1 81 THR 81 60 60 THR THR A . n A 1 82 GLU 82 61 61 GLU GLU A . n A 1 83 ILE 83 62 62 ILE ILE A . n A 1 84 SER 84 63 63 SER SER A . n A 1 85 PHE 85 64 64 PHE PHE A . n A 1 86 ILE 86 65 65 ILE ILE A . n A 1 87 LEU 87 66 66 LEU LEU A . n A 1 88 GLY 88 67 67 GLY GLY A . n A 1 89 GLN 89 68 68 GLN GLN A . n A 1 90 GLU 90 69 69 GLU GLU A . n A 1 91 PHE 91 70 70 PHE PHE A . n A 1 92 ASP 92 71 71 ASP ASP A . n A 1 93 GLU 93 72 72 GLU GLU A . n A 1 94 VAL 94 73 73 VAL VAL A . n A 1 95 THR 95 74 74 THR THR A . n A 1 96 ALA 96 75 75 ALA ALA A . n A 1 97 ASP 97 76 76 ASP ASP A . n A 1 98 ASP 98 77 77 ASP ASP A . n A 1 99 ARG 99 78 78 ARG ARG A . n A 1 100 LYS 100 79 79 LYS LYS A . n A 1 101 VAL 101 80 80 VAL VAL A . n A 1 102 LYS 102 81 81 LYS LYS A . n A 1 103 SER 103 82 82 SER SER A . n A 1 104 THR 104 83 83 THR THR A . n A 1 105 ILE 105 84 84 ILE ILE A . n A 1 106 THR 106 85 85 THR THR A . n A 1 107 LEU 107 86 86 LEU LEU A . n A 1 108 ASP 108 87 87 ASP ASP A . n A 1 109 GLY 109 88 88 GLY GLY A . n A 1 110 GLY 110 89 89 GLY GLY A . n A 1 111 VAL 111 90 90 VAL VAL A . n A 1 112 LEU 112 91 91 LEU LEU A . n A 1 113 VAL 113 92 92 VAL VAL A . n A 1 114 HIS 114 93 93 HIS HIS A . n A 1 115 VAL 115 94 94 VAL VAL A . n A 1 116 GLN 116 95 95 GLN GLN A . n A 1 117 LYS 117 96 96 LYS LYS A . n A 1 118 TRP 118 97 97 TRP TRP A . n A 1 119 ASP 119 98 98 ASP ASP A . n A 1 120 GLY 120 99 99 GLY GLY A . n A 1 121 LYS 121 100 100 LYS LYS A . n A 1 122 SER 122 101 101 SER SER A . n A 1 123 THR 123 102 102 THR THR A . n A 1 124 THR 124 103 103 THR THR A . n A 1 125 ILE 125 104 104 ILE ILE A . n A 1 126 LYS 126 105 105 LYS LYS A . n A 1 127 ARG 127 106 106 ARG ARG A . n A 1 128 LYS 128 107 107 LYS LYS A . n A 1 129 ARG 129 108 108 ARG ARG A . n A 1 130 GLU 130 109 109 GLU GLU A . n A 1 131 ASP 131 110 110 ASP ASP A . n A 1 132 ASP 132 111 111 ASP ASP A . n A 1 133 LYS 133 112 112 LYS LYS A . n A 1 134 LEU 134 113 113 LEU LEU A . n A 1 135 VAL 135 114 114 VAL VAL A . n A 1 136 VAL 136 115 115 VAL VAL A . n A 1 137 GLU 137 116 116 GLU GLU A . n A 1 138 CYS 138 117 117 CYS CYS A . n A 1 139 VAL 139 118 118 VAL VAL A . n A 1 140 MET 140 119 119 MET MET A . n A 1 141 LYS 141 120 120 LYS LYS A . n A 1 142 GLY 142 121 121 GLY GLY A . n A 1 143 VAL 143 122 122 VAL VAL A . n A 1 144 THR 144 123 123 THR THR A . n A 1 145 SER 145 124 124 SER SER A . n A 1 146 THR 146 125 125 THR THR A . n A 1 147 ARG 147 126 126 ARG ARG A . n A 1 148 VAL 148 127 127 VAL VAL A . n A 1 149 TYR 149 128 128 TYR TYR A . n A 1 150 GLU 150 129 129 GLU GLU A . n A 1 151 ARG 151 130 130 ARG ARG A . n A 1 152 ALA 152 131 131 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 L19 1 201 1 L19 L19 A . C 3 HOH 1 301 102 HOH HOH A . C 3 HOH 2 302 117 HOH HOH A . C 3 HOH 3 303 66 HOH HOH A . C 3 HOH 4 304 53 HOH HOH A . C 3 HOH 5 305 76 HOH HOH A . C 3 HOH 6 306 87 HOH HOH A . C 3 HOH 7 307 27 HOH HOH A . C 3 HOH 8 308 57 HOH HOH A . C 3 HOH 9 309 26 HOH HOH A . C 3 HOH 10 310 20 HOH HOH A . C 3 HOH 11 311 59 HOH HOH A . C 3 HOH 12 312 55 HOH HOH A . C 3 HOH 13 313 105 HOH HOH A . C 3 HOH 14 314 34 HOH HOH A . C 3 HOH 15 315 22 HOH HOH A . C 3 HOH 16 316 94 HOH HOH A . C 3 HOH 17 317 91 HOH HOH A . C 3 HOH 18 318 12 HOH HOH A . C 3 HOH 19 319 75 HOH HOH A . C 3 HOH 20 320 86 HOH HOH A . C 3 HOH 21 321 9 HOH HOH A . C 3 HOH 22 322 49 HOH HOH A . C 3 HOH 23 323 25 HOH HOH A . C 3 HOH 24 324 10 HOH HOH A . C 3 HOH 25 325 73 HOH HOH A . C 3 HOH 26 326 42 HOH HOH A . C 3 HOH 27 327 11 HOH HOH A . C 3 HOH 28 328 69 HOH HOH A . C 3 HOH 29 329 5 HOH HOH A . C 3 HOH 30 330 16 HOH HOH A . C 3 HOH 31 331 83 HOH HOH A . C 3 HOH 32 332 24 HOH HOH A . C 3 HOH 33 333 23 HOH HOH A . C 3 HOH 34 334 28 HOH HOH A . C 3 HOH 35 335 29 HOH HOH A . C 3 HOH 36 336 61 HOH HOH A . C 3 HOH 37 337 1 HOH HOH A . C 3 HOH 38 338 3 HOH HOH A . C 3 HOH 39 339 56 HOH HOH A . C 3 HOH 40 340 37 HOH HOH A . C 3 HOH 41 341 21 HOH HOH A . C 3 HOH 42 342 46 HOH HOH A . C 3 HOH 43 343 15 HOH HOH A . C 3 HOH 44 344 89 HOH HOH A . C 3 HOH 45 345 18 HOH HOH A . C 3 HOH 46 346 71 HOH HOH A . C 3 HOH 47 347 44 HOH HOH A . C 3 HOH 48 348 119 HOH HOH A . C 3 HOH 49 349 8 HOH HOH A . C 3 HOH 50 350 110 HOH HOH A . C 3 HOH 51 351 45 HOH HOH A . C 3 HOH 52 352 104 HOH HOH A . C 3 HOH 53 353 93 HOH HOH A . C 3 HOH 54 354 92 HOH HOH A . C 3 HOH 55 355 41 HOH HOH A . C 3 HOH 56 356 96 HOH HOH A . C 3 HOH 57 357 72 HOH HOH A . C 3 HOH 58 358 48 HOH HOH A . C 3 HOH 59 359 98 HOH HOH A . C 3 HOH 60 360 112 HOH HOH A . C 3 HOH 61 361 113 HOH HOH A . C 3 HOH 62 362 32 HOH HOH A . C 3 HOH 63 363 19 HOH HOH A . C 3 HOH 64 364 17 HOH HOH A . C 3 HOH 65 365 7 HOH HOH A . C 3 HOH 66 366 36 HOH HOH A . C 3 HOH 67 367 60 HOH HOH A . C 3 HOH 68 368 52 HOH HOH A . C 3 HOH 69 369 103 HOH HOH A . C 3 HOH 70 370 35 HOH HOH A . C 3 HOH 71 371 40 HOH HOH A . C 3 HOH 72 372 88 HOH HOH A . C 3 HOH 73 373 43 HOH HOH A . C 3 HOH 74 374 97 HOH HOH A . C 3 HOH 75 375 4 HOH HOH A . C 3 HOH 76 376 78 HOH HOH A . C 3 HOH 77 377 50 HOH HOH A . C 3 HOH 78 378 39 HOH HOH A . C 3 HOH 79 379 6 HOH HOH A . C 3 HOH 80 380 33 HOH HOH A . C 3 HOH 81 381 30 HOH HOH A . C 3 HOH 82 382 2 HOH HOH A . C 3 HOH 83 383 74 HOH HOH A . C 3 HOH 84 384 68 HOH HOH A . C 3 HOH 85 385 38 HOH HOH A . C 3 HOH 86 386 58 HOH HOH A . C 3 HOH 87 387 70 HOH HOH A . C 3 HOH 88 388 13 HOH HOH A . C 3 HOH 89 389 51 HOH HOH A . C 3 HOH 90 390 85 HOH HOH A . C 3 HOH 91 391 14 HOH HOH A . C 3 HOH 92 392 65 HOH HOH A . C 3 HOH 93 393 100 HOH HOH A . C 3 HOH 94 394 31 HOH HOH A . C 3 HOH 95 395 64 HOH HOH A . C 3 HOH 96 396 111 HOH HOH A . C 3 HOH 97 397 47 HOH HOH A . C 3 HOH 98 398 80 HOH HOH A . C 3 HOH 99 399 77 HOH HOH A . C 3 HOH 100 400 84 HOH HOH A . C 3 HOH 101 401 106 HOH HOH A . C 3 HOH 102 402 63 HOH HOH A . C 3 HOH 103 403 90 HOH HOH A . C 3 HOH 104 404 108 HOH HOH A . C 3 HOH 105 405 109 HOH HOH A . C 3 HOH 106 406 107 HOH HOH A . C 3 HOH 107 407 82 HOH HOH A . C 3 HOH 108 408 67 HOH HOH A . C 3 HOH 109 409 99 HOH HOH A . C 3 HOH 110 410 79 HOH HOH A . C 3 HOH 111 411 120 HOH HOH A . C 3 HOH 112 412 115 HOH HOH A . C 3 HOH 113 413 118 HOH HOH A . C 3 HOH 114 414 81 HOH HOH A . C 3 HOH 115 415 114 HOH HOH A . C 3 HOH 116 416 95 HOH HOH A . C 3 HOH 117 417 62 HOH HOH A . C 3 HOH 118 418 54 HOH HOH A . C 3 HOH 119 419 101 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7050 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-06-22 2 'Structure model' 1 1 2020-02-19 3 'Structure model' 1 2 2023-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' diffrn_source 2 2 'Structure model' pdbx_struct_oper_list 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 2 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 3 'Structure model' '_database_2.pdbx_DOI' 4 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? 11.0.02 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.6.0117 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 71 ? ? O A HOH 301 ? ? 1.96 2 1 N A GLY 89 ? ? O A HOH 302 ? ? 2.17 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 2 ? ? CG A ASP 2 ? ? OD1 A ASP 2 ? ? 124.74 118.30 6.44 0.90 N 2 1 NE A ARG 106 ? ? CZ A ARG 106 ? ? NH1 A ARG 106 ? ? 124.04 120.30 3.74 0.50 N 3 1 NE A ARG 126 ? ? CZ A ARG 126 ? ? NH2 A ARG 126 ? ? 115.56 120.30 -4.74 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 110 ? ? 49.12 -131.43 2 1 LYS A 120 ? ? 49.45 -117.89 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -20 ? A MET 1 2 1 Y 1 A GLY -19 ? A GLY 2 3 1 Y 1 A SER -18 ? A SER 3 4 1 Y 1 A SER -17 ? A SER 4 5 1 Y 1 A HIS -16 ? A HIS 5 6 1 Y 1 A HIS -15 ? A HIS 6 7 1 Y 1 A HIS -14 ? A HIS 7 8 1 Y 1 A HIS -13 ? A HIS 8 9 1 Y 1 A HIS -12 ? A HIS 9 10 1 Y 1 A HIS -11 ? A HIS 10 11 1 Y 1 A SER -10 ? A SER 11 12 1 Y 1 A SER -9 ? A SER 12 13 1 Y 1 A GLY -8 ? A GLY 13 14 1 Y 1 A LEU -7 ? A LEU 14 15 1 Y 1 A VAL -6 ? A VAL 15 16 1 Y 1 A PRO -5 ? A PRO 16 17 1 Y 1 A ARG -4 ? A ARG 17 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 L19 O1 O N N 183 L19 C22 C N N 184 L19 O2 O N N 185 L19 C21 C N N 186 L19 C20 C N N 187 L19 N1 N Y N 188 L19 C13 C Y N 189 L19 C14 C Y N 190 L19 C15 C Y N 191 L19 C16 C Y N 192 L19 C17 C Y N 193 L19 C18 C Y N 194 L19 C19 C Y N 195 L19 C6 C Y N 196 L19 C7 C Y N 197 L19 C8 C Y N 198 L19 C9 C Y N 199 L19 C23 C N N 200 L19 C24 C N N 201 L19 C25 C N N 202 L19 C10 C Y N 203 L19 C11 C Y N 204 L19 C12 C Y N 205 L19 C5 C Y N 206 L19 C4 C Y N 207 L19 C3 C Y N 208 L19 N N Y N 209 L19 C2 C Y N 210 L19 C1 C Y N 211 L19 O O N N 212 L19 C C N N 213 L19 H1 H N N 214 L19 H2 H N N 215 L19 H3 H N N 216 L19 H4 H N N 217 L19 H5 H N N 218 L19 H6 H N N 219 L19 H7 H N N 220 L19 H8 H N N 221 L19 H9 H N N 222 L19 H10 H N N 223 L19 H11 H N N 224 L19 H12 H N N 225 L19 H13 H N N 226 L19 H14 H N N 227 L19 H15 H N N 228 L19 H16 H N N 229 L19 H17 H N N 230 L19 H18 H N N 231 L19 H19 H N N 232 L19 H20 H N N 233 L19 H21 H N N 234 L19 H22 H N N 235 L19 H23 H N N 236 L19 H24 H N N 237 LEU N N N N 238 LEU CA C N S 239 LEU C C N N 240 LEU O O N N 241 LEU CB C N N 242 LEU CG C N N 243 LEU CD1 C N N 244 LEU CD2 C N N 245 LEU OXT O N N 246 LEU H H N N 247 LEU H2 H N N 248 LEU HA H N N 249 LEU HB2 H N N 250 LEU HB3 H N N 251 LEU HG H N N 252 LEU HD11 H N N 253 LEU HD12 H N N 254 LEU HD13 H N N 255 LEU HD21 H N N 256 LEU HD22 H N N 257 LEU HD23 H N N 258 LEU HXT H N N 259 LYS N N N N 260 LYS CA C N S 261 LYS C C N N 262 LYS O O N N 263 LYS CB C N N 264 LYS CG C N N 265 LYS CD C N N 266 LYS CE C N N 267 LYS NZ N N N 268 LYS OXT O N N 269 LYS H H N N 270 LYS H2 H N N 271 LYS HA H N N 272 LYS HB2 H N N 273 LYS HB3 H N N 274 LYS HG2 H N N 275 LYS HG3 H N N 276 LYS HD2 H N N 277 LYS HD3 H N N 278 LYS HE2 H N N 279 LYS HE3 H N N 280 LYS HZ1 H N N 281 LYS HZ2 H N N 282 LYS HZ3 H N N 283 LYS HXT H N N 284 MET N N N N 285 MET CA C N S 286 MET C C N N 287 MET O O N N 288 MET CB C N N 289 MET CG C N N 290 MET SD S N N 291 MET CE C N N 292 MET OXT O N N 293 MET H H N N 294 MET H2 H N N 295 MET HA H N N 296 MET HB2 H N N 297 MET HB3 H N N 298 MET HG2 H N N 299 MET HG3 H N N 300 MET HE1 H N N 301 MET HE2 H N N 302 MET HE3 H N N 303 MET HXT H N N 304 PHE N N N N 305 PHE CA C N S 306 PHE C C N N 307 PHE O O N N 308 PHE CB C N N 309 PHE CG C Y N 310 PHE CD1 C Y N 311 PHE CD2 C Y N 312 PHE CE1 C Y N 313 PHE CE2 C Y N 314 PHE CZ C Y N 315 PHE OXT O N N 316 PHE H H N N 317 PHE H2 H N N 318 PHE HA H N N 319 PHE HB2 H N N 320 PHE HB3 H N N 321 PHE HD1 H N N 322 PHE HD2 H N N 323 PHE HE1 H N N 324 PHE HE2 H N N 325 PHE HZ H N N 326 PHE HXT H N N 327 PRO N N N N 328 PRO CA C N S 329 PRO C C N N 330 PRO O O N N 331 PRO CB C N N 332 PRO CG C N N 333 PRO CD C N N 334 PRO OXT O N N 335 PRO H H N N 336 PRO HA H N N 337 PRO HB2 H N N 338 PRO HB3 H N N 339 PRO HG2 H N N 340 PRO HG3 H N N 341 PRO HD2 H N N 342 PRO HD3 H N N 343 PRO HXT H N N 344 SER N N N N 345 SER CA C N S 346 SER C C N N 347 SER O O N N 348 SER CB C N N 349 SER OG O N N 350 SER OXT O N N 351 SER H H N N 352 SER H2 H N N 353 SER HA H N N 354 SER HB2 H N N 355 SER HB3 H N N 356 SER HG H N N 357 SER HXT H N N 358 THR N N N N 359 THR CA C N S 360 THR C C N N 361 THR O O N N 362 THR CB C N R 363 THR OG1 O N N 364 THR CG2 C N N 365 THR OXT O N N 366 THR H H N N 367 THR H2 H N N 368 THR HA H N N 369 THR HB H N N 370 THR HG1 H N N 371 THR HG21 H N N 372 THR HG22 H N N 373 THR HG23 H N N 374 THR HXT H N N 375 TRP N N N N 376 TRP CA C N S 377 TRP C C N N 378 TRP O O N N 379 TRP CB C N N 380 TRP CG C Y N 381 TRP CD1 C Y N 382 TRP CD2 C Y N 383 TRP NE1 N Y N 384 TRP CE2 C Y N 385 TRP CE3 C Y N 386 TRP CZ2 C Y N 387 TRP CZ3 C Y N 388 TRP CH2 C Y N 389 TRP OXT O N N 390 TRP H H N N 391 TRP H2 H N N 392 TRP HA H N N 393 TRP HB2 H N N 394 TRP HB3 H N N 395 TRP HD1 H N N 396 TRP HE1 H N N 397 TRP HE3 H N N 398 TRP HZ2 H N N 399 TRP HZ3 H N N 400 TRP HH2 H N N 401 TRP HXT H N N 402 TYR N N N N 403 TYR CA C N S 404 TYR C C N N 405 TYR O O N N 406 TYR CB C N N 407 TYR CG C Y N 408 TYR CD1 C Y N 409 TYR CD2 C Y N 410 TYR CE1 C Y N 411 TYR CE2 C Y N 412 TYR CZ C Y N 413 TYR OH O N N 414 TYR OXT O N N 415 TYR H H N N 416 TYR H2 H N N 417 TYR HA H N N 418 TYR HB2 H N N 419 TYR HB3 H N N 420 TYR HD1 H N N 421 TYR HD2 H N N 422 TYR HE1 H N N 423 TYR HE2 H N N 424 TYR HH H N N 425 TYR HXT H N N 426 VAL N N N N 427 VAL CA C N S 428 VAL C C N N 429 VAL O O N N 430 VAL CB C N N 431 VAL CG1 C N N 432 VAL CG2 C N N 433 VAL OXT O N N 434 VAL H H N N 435 VAL H2 H N N 436 VAL HA H N N 437 VAL HB H N N 438 VAL HG11 H N N 439 VAL HG12 H N N 440 VAL HG13 H N N 441 VAL HG21 H N N 442 VAL HG22 H N N 443 VAL HG23 H N N 444 VAL HXT H N N 445 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 L19 C17 C18 doub Y N 173 L19 C17 C16 sing Y N 174 L19 C18 C19 sing Y N 175 L19 C16 C15 doub Y N 176 L19 O1 C22 doub N N 177 L19 C19 C14 doub Y N 178 L19 C15 C14 sing Y N 179 L19 C14 C13 sing N N 180 L19 C22 O2 sing N N 181 L19 C22 C21 sing N N 182 L19 C21 C20 sing N N 183 L19 C20 N1 sing N N 184 L19 C13 N1 sing Y N 185 L19 C13 C6 doub Y N 186 L19 C3 C4 sing Y N 187 L19 C3 N doub Y N 188 L19 N1 C12 sing Y N 189 L19 C4 C5 doub Y N 190 L19 N C2 sing Y N 191 L19 C5 C6 sing N N 192 L19 C5 C1 sing Y N 193 L19 C6 C7 sing Y N 194 L19 C2 C1 doub Y N 195 L19 C1 O sing N N 196 L19 C12 C7 sing Y N 197 L19 C12 C11 doub Y N 198 L19 O C sing N N 199 L19 C7 C8 doub Y N 200 L19 C11 C10 sing Y N 201 L19 C8 C9 sing Y N 202 L19 C10 C9 doub Y N 203 L19 C9 C23 sing N N 204 L19 C23 C25 sing N N 205 L19 C23 C24 sing N N 206 L19 C25 C24 sing N N 207 L19 O2 H1 sing N N 208 L19 C21 H2 sing N N 209 L19 C21 H3 sing N N 210 L19 C20 H4 sing N N 211 L19 C20 H5 sing N N 212 L19 C15 H6 sing N N 213 L19 C16 H7 sing N N 214 L19 C17 H8 sing N N 215 L19 C18 H9 sing N N 216 L19 C19 H10 sing N N 217 L19 C8 H11 sing N N 218 L19 C23 H12 sing N N 219 L19 C24 H13 sing N N 220 L19 C24 H14 sing N N 221 L19 C25 H15 sing N N 222 L19 C25 H16 sing N N 223 L19 C10 H17 sing N N 224 L19 C11 H18 sing N N 225 L19 C4 H19 sing N N 226 L19 C3 H20 sing N N 227 L19 C2 H21 sing N N 228 L19 C H22 sing N N 229 L19 C H23 sing N N 230 L19 C H24 sing N N 231 LEU N CA sing N N 232 LEU N H sing N N 233 LEU N H2 sing N N 234 LEU CA C sing N N 235 LEU CA CB sing N N 236 LEU CA HA sing N N 237 LEU C O doub N N 238 LEU C OXT sing N N 239 LEU CB CG sing N N 240 LEU CB HB2 sing N N 241 LEU CB HB3 sing N N 242 LEU CG CD1 sing N N 243 LEU CG CD2 sing N N 244 LEU CG HG sing N N 245 LEU CD1 HD11 sing N N 246 LEU CD1 HD12 sing N N 247 LEU CD1 HD13 sing N N 248 LEU CD2 HD21 sing N N 249 LEU CD2 HD22 sing N N 250 LEU CD2 HD23 sing N N 251 LEU OXT HXT sing N N 252 LYS N CA sing N N 253 LYS N H sing N N 254 LYS N H2 sing N N 255 LYS CA C sing N N 256 LYS CA CB sing N N 257 LYS CA HA sing N N 258 LYS C O doub N N 259 LYS C OXT sing N N 260 LYS CB CG sing N N 261 LYS CB HB2 sing N N 262 LYS CB HB3 sing N N 263 LYS CG CD sing N N 264 LYS CG HG2 sing N N 265 LYS CG HG3 sing N N 266 LYS CD CE sing N N 267 LYS CD HD2 sing N N 268 LYS CD HD3 sing N N 269 LYS CE NZ sing N N 270 LYS CE HE2 sing N N 271 LYS CE HE3 sing N N 272 LYS NZ HZ1 sing N N 273 LYS NZ HZ2 sing N N 274 LYS NZ HZ3 sing N N 275 LYS OXT HXT sing N N 276 MET N CA sing N N 277 MET N H sing N N 278 MET N H2 sing N N 279 MET CA C sing N N 280 MET CA CB sing N N 281 MET CA HA sing N N 282 MET C O doub N N 283 MET C OXT sing N N 284 MET CB CG sing N N 285 MET CB HB2 sing N N 286 MET CB HB3 sing N N 287 MET CG SD sing N N 288 MET CG HG2 sing N N 289 MET CG HG3 sing N N 290 MET SD CE sing N N 291 MET CE HE1 sing N N 292 MET CE HE2 sing N N 293 MET CE HE3 sing N N 294 MET OXT HXT sing N N 295 PHE N CA sing N N 296 PHE N H sing N N 297 PHE N H2 sing N N 298 PHE CA C sing N N 299 PHE CA CB sing N N 300 PHE CA HA sing N N 301 PHE C O doub N N 302 PHE C OXT sing N N 303 PHE CB CG sing N N 304 PHE CB HB2 sing N N 305 PHE CB HB3 sing N N 306 PHE CG CD1 doub Y N 307 PHE CG CD2 sing Y N 308 PHE CD1 CE1 sing Y N 309 PHE CD1 HD1 sing N N 310 PHE CD2 CE2 doub Y N 311 PHE CD2 HD2 sing N N 312 PHE CE1 CZ doub Y N 313 PHE CE1 HE1 sing N N 314 PHE CE2 CZ sing Y N 315 PHE CE2 HE2 sing N N 316 PHE CZ HZ sing N N 317 PHE OXT HXT sing N N 318 PRO N CA sing N N 319 PRO N CD sing N N 320 PRO N H sing N N 321 PRO CA C sing N N 322 PRO CA CB sing N N 323 PRO CA HA sing N N 324 PRO C O doub N N 325 PRO C OXT sing N N 326 PRO CB CG sing N N 327 PRO CB HB2 sing N N 328 PRO CB HB3 sing N N 329 PRO CG CD sing N N 330 PRO CG HG2 sing N N 331 PRO CG HG3 sing N N 332 PRO CD HD2 sing N N 333 PRO CD HD3 sing N N 334 PRO OXT HXT sing N N 335 SER N CA sing N N 336 SER N H sing N N 337 SER N H2 sing N N 338 SER CA C sing N N 339 SER CA CB sing N N 340 SER CA HA sing N N 341 SER C O doub N N 342 SER C OXT sing N N 343 SER CB OG sing N N 344 SER CB HB2 sing N N 345 SER CB HB3 sing N N 346 SER OG HG sing N N 347 SER OXT HXT sing N N 348 THR N CA sing N N 349 THR N H sing N N 350 THR N H2 sing N N 351 THR CA C sing N N 352 THR CA CB sing N N 353 THR CA HA sing N N 354 THR C O doub N N 355 THR C OXT sing N N 356 THR CB OG1 sing N N 357 THR CB CG2 sing N N 358 THR CB HB sing N N 359 THR OG1 HG1 sing N N 360 THR CG2 HG21 sing N N 361 THR CG2 HG22 sing N N 362 THR CG2 HG23 sing N N 363 THR OXT HXT sing N N 364 TRP N CA sing N N 365 TRP N H sing N N 366 TRP N H2 sing N N 367 TRP CA C sing N N 368 TRP CA CB sing N N 369 TRP CA HA sing N N 370 TRP C O doub N N 371 TRP C OXT sing N N 372 TRP CB CG sing N N 373 TRP CB HB2 sing N N 374 TRP CB HB3 sing N N 375 TRP CG CD1 doub Y N 376 TRP CG CD2 sing Y N 377 TRP CD1 NE1 sing Y N 378 TRP CD1 HD1 sing N N 379 TRP CD2 CE2 doub Y N 380 TRP CD2 CE3 sing Y N 381 TRP NE1 CE2 sing Y N 382 TRP NE1 HE1 sing N N 383 TRP CE2 CZ2 sing Y N 384 TRP CE3 CZ3 doub Y N 385 TRP CE3 HE3 sing N N 386 TRP CZ2 CH2 doub Y N 387 TRP CZ2 HZ2 sing N N 388 TRP CZ3 CH2 sing Y N 389 TRP CZ3 HZ3 sing N N 390 TRP CH2 HH2 sing N N 391 TRP OXT HXT sing N N 392 TYR N CA sing N N 393 TYR N H sing N N 394 TYR N H2 sing N N 395 TYR CA C sing N N 396 TYR CA CB sing N N 397 TYR CA HA sing N N 398 TYR C O doub N N 399 TYR C OXT sing N N 400 TYR CB CG sing N N 401 TYR CB HB2 sing N N 402 TYR CB HB3 sing N N 403 TYR CG CD1 doub Y N 404 TYR CG CD2 sing Y N 405 TYR CD1 CE1 sing Y N 406 TYR CD1 HD1 sing N N 407 TYR CD2 CE2 doub Y N 408 TYR CD2 HD2 sing N N 409 TYR CE1 CZ doub Y N 410 TYR CE1 HE1 sing N N 411 TYR CE2 CZ sing Y N 412 TYR CE2 HE2 sing N N 413 TYR CZ OH sing N N 414 TYR OH HH sing N N 415 TYR OXT HXT sing N N 416 VAL N CA sing N N 417 VAL N H sing N N 418 VAL N H2 sing N N 419 VAL CA C sing N N 420 VAL CA CB sing N N 421 VAL CA HA sing N N 422 VAL C O doub N N 423 VAL C OXT sing N N 424 VAL CB CG1 sing N N 425 VAL CB CG2 sing N N 426 VAL CB HB sing N N 427 VAL CG1 HG11 sing N N 428 VAL CG1 HG12 sing N N 429 VAL CG1 HG13 sing N N 430 VAL CG2 HG21 sing N N 431 VAL CG2 HG22 sing N N 432 VAL CG2 HG23 sing N N 433 VAL OXT HXT sing N N 434 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '3-[5-cyclopropyl-3-(3-methoxypyridin-4-yl)-2-phenyl-1H-indol-1-yl]propanoic acid' L19 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2HNX _pdbx_initial_refinement_model.details ? #