data_5D9J # _entry.id 5D9J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5D9J pdb_00005d9j 10.2210/pdb5d9j/pdb WWPDB D_1000212793 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5CGV unspecified PDB . 5CCY unspecified PDB . 5CL0 unspecified PDB . 5D2O unspecified PDB . 5D42 unspecified PDB . 5D4G unspecified PDB . 5CZN unspecified PDB . 5D8U unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5D9J _pdbx_database_status.recvd_initial_deposition_date 2015-08-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kumar, G.' 1 'White, S.W.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 113 _citation.language ? _citation.page_first 3669 _citation.page_last 3674 _citation.title 'Identification and characterization of influenza variants resistant to a viral endonuclease inhibitor.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1519772113 _citation.pdbx_database_id_PubMed 26976575 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Song, M.S.' 1 ? primary 'Kumar, G.' 2 ? primary 'Shadrick, W.R.' 3 ? primary 'Zhou, W.' 4 ? primary 'Jeevan, T.' 5 ? primary 'Li, Z.' 6 ? primary 'Slavish, P.J.' 7 ? primary 'Fabrizio, T.P.' 8 ? primary 'Yoon, S.W.' 9 ? primary 'Webb, T.R.' 10 ? primary 'Webby, R.J.' 11 ? primary 'White, S.W.' 12 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5D9J _cell.details ? _cell.formula_units_Z ? _cell.length_a 60.585 _cell.length_a_esd ? _cell.length_b 60.585 _cell.length_b_esd ? _cell.length_c 95.980 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5D9J _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase acidic protein' 21910.064 1 ? F105S 'endonuclease domain (UNP residues 1-50, 73-196 connected by GGS linker)' ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 3 non-polymer syn '(2Z)-4-[1-benzyl-4-(4-chlorobenzyl)piperidin-4-yl]-2-hydroxy-4-oxobut-2-enoic acid' 413.894 1 ? ? ? ? 4 water nat water 18.015 64 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PA endonuclease' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSKHRFEIIEGRDRIMAWTVVNSICNTTG VEKPKSLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIR QEMASRSLWDSFRQSERAAAELALVPR ; _entity_poly.pdbx_seq_one_letter_code_can ;MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSKHRFEIIEGRDRIMAWTVVNSICNTTG VEKPKSLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIR QEMASRSLWDSFRQSERAAAELALVPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ASP n 1 4 PHE n 1 5 VAL n 1 6 ARG n 1 7 GLN n 1 8 CYS n 1 9 PHE n 1 10 ASN n 1 11 PRO n 1 12 MET n 1 13 ILE n 1 14 VAL n 1 15 GLU n 1 16 LEU n 1 17 ALA n 1 18 GLU n 1 19 LYS n 1 20 ALA n 1 21 MET n 1 22 LYS n 1 23 GLU n 1 24 TYR n 1 25 GLY n 1 26 GLU n 1 27 ASP n 1 28 PRO n 1 29 LYS n 1 30 ILE n 1 31 GLU n 1 32 THR n 1 33 ASN n 1 34 LYS n 1 35 PHE n 1 36 ALA n 1 37 ALA n 1 38 ILE n 1 39 CYS n 1 40 THR n 1 41 HIS n 1 42 LEU n 1 43 GLU n 1 44 VAL n 1 45 CYS n 1 46 PHE n 1 47 MET n 1 48 TYR n 1 49 SER n 1 50 ASP n 1 51 GLY n 1 52 GLY n 1 53 SER n 1 54 LYS n 1 55 HIS n 1 56 ARG n 1 57 PHE n 1 58 GLU n 1 59 ILE n 1 60 ILE n 1 61 GLU n 1 62 GLY n 1 63 ARG n 1 64 ASP n 1 65 ARG n 1 66 ILE n 1 67 MET n 1 68 ALA n 1 69 TRP n 1 70 THR n 1 71 VAL n 1 72 VAL n 1 73 ASN n 1 74 SER n 1 75 ILE n 1 76 CYS n 1 77 ASN n 1 78 THR n 1 79 THR n 1 80 GLY n 1 81 VAL n 1 82 GLU n 1 83 LYS n 1 84 PRO n 1 85 LYS n 1 86 SER n 1 87 LEU n 1 88 PRO n 1 89 ASP n 1 90 LEU n 1 91 TYR n 1 92 ASP n 1 93 TYR n 1 94 LYS n 1 95 GLU n 1 96 ASN n 1 97 ARG n 1 98 PHE n 1 99 ILE n 1 100 GLU n 1 101 ILE n 1 102 GLY n 1 103 VAL n 1 104 THR n 1 105 ARG n 1 106 ARG n 1 107 GLU n 1 108 VAL n 1 109 HIS n 1 110 ILE n 1 111 TYR n 1 112 TYR n 1 113 LEU n 1 114 GLU n 1 115 LYS n 1 116 ALA n 1 117 ASN n 1 118 LYS n 1 119 ILE n 1 120 LYS n 1 121 SER n 1 122 GLU n 1 123 LYS n 1 124 THR n 1 125 HIS n 1 126 ILE n 1 127 HIS n 1 128 ILE n 1 129 PHE n 1 130 SER n 1 131 PHE n 1 132 THR n 1 133 GLY n 1 134 GLU n 1 135 GLU n 1 136 MET n 1 137 ALA n 1 138 THR n 1 139 LYS n 1 140 ALA n 1 141 ASP n 1 142 TYR n 1 143 THR n 1 144 LEU n 1 145 ASP n 1 146 GLU n 1 147 GLU n 1 148 SER n 1 149 ARG n 1 150 ALA n 1 151 ARG n 1 152 ILE n 1 153 LYS n 1 154 THR n 1 155 ARG n 1 156 LEU n 1 157 PHE n 1 158 THR n 1 159 ILE n 1 160 ARG n 1 161 GLN n 1 162 GLU n 1 163 MET n 1 164 ALA n 1 165 SER n 1 166 ARG n 1 167 SER n 1 168 LEU n 1 169 TRP n 1 170 ASP n 1 171 SER n 1 172 PHE n 1 173 ARG n 1 174 GLN n 1 175 SER n 1 176 GLU n 1 177 ARG n 1 178 ALA n 1 179 ALA n 1 180 ALA n 1 181 GLU n 1 182 LEU n 1 183 ALA n 1 184 LEU n 1 185 VAL n 1 186 PRO n 1 187 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 50 ? ? PA ? 'swl A/California/04/2009 H1N1' ? ? ? ? 'Influenza A virus' 641501 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? pET52b ? ? 1 2 sample 'Biological sequence' 51 187 ? ? PA ? 'swl A/California/04/2009 H1N1' ? ? ? ? 'Influenza A virus' 641501 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? pET52b ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP C3W5S0_I09A0 C3W5S0 ? 1 MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD 1 2 UNP C3W5S0_I09A0 C3W5S0 ? 1 ;KHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTG EEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSER ; 73 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5D9J A 1 ? 50 ? C3W5S0 1 ? 50 ? 1 50 2 2 5D9J A 54 ? 177 ? C3W5S0 73 ? 196 ? 54 177 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5D9J GLY A 51 ? UNP C3W5S0 ? ? linker 51 1 1 5D9J GLY A 52 ? UNP C3W5S0 ? ? linker 52 2 1 5D9J SER A 53 ? UNP C3W5S0 ? ? linker 53 3 2 5D9J SER A 86 ? UNP C3W5S0 PHE 105 'engineered mutation' 86 4 2 5D9J ALA A 178 ? UNP C3W5S0 ? ? 'expression tag' 178 5 2 5D9J ALA A 179 ? UNP C3W5S0 ? ? 'expression tag' 179 6 2 5D9J ALA A 180 ? UNP C3W5S0 ? ? 'expression tag' 180 7 2 5D9J GLU A 181 ? UNP C3W5S0 ? ? 'expression tag' 181 8 2 5D9J LEU A 182 ? UNP C3W5S0 ? ? 'expression tag' 182 9 2 5D9J ALA A 183 ? UNP C3W5S0 ? ? 'expression tag' 183 10 2 5D9J LEU A 184 ? UNP C3W5S0 ? ? 'expression tag' 184 11 2 5D9J VAL A 185 ? UNP C3W5S0 ? ? 'expression tag' 185 12 2 5D9J PRO A 186 ? UNP C3W5S0 ? ? 'expression tag' 186 13 2 5D9J ARG A 187 ? UNP C3W5S0 ? ? 'expression tag' 187 14 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 0N8 non-polymer . '(2Z)-4-[1-benzyl-4-(4-chlorobenzyl)piperidin-4-yl]-2-hydroxy-4-oxobut-2-enoic acid' ? 'C23 H24 Cl N O4' 413.894 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5D9J _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.00 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.8 M succinic acid, pH 7.0, 5 mM magnesium chloride, 5 mM manganese chloride' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX300-HS' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-08-09 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'double crystal Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5D9J _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.850 _reflns.d_resolution_low 40.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17865 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.800 _reflns.pdbx_Rmerge_I_obs 0.063 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 43.273 _reflns.pdbx_netI_over_sigmaI 10.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.920 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.065 _reflns.pdbx_Rpim_I_all 0.015 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 335403 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.850 1.920 ? ? ? ? ? 1764 ? 100.000 ? ? ? ? 0.883 ? ? ? ? ? ? ? ? 15.700 ? 0.686 ? ? 0.912 0.226 0 1 1 0.889 ? 1.920 1.990 ? ? ? ? ? 1742 ? 100.000 ? ? ? ? 0.622 ? ? ? ? ? ? ? ? 18.800 ? 0.735 ? ? 0.639 0.146 0 2 1 0.953 ? 1.990 2.080 ? ? ? ? ? 1768 ? 100.000 ? ? ? ? 0.402 ? ? ? ? ? ? ? ? 19.400 ? 0.786 ? ? 0.413 0.093 0 3 1 0.981 ? 2.080 2.190 ? ? ? ? ? 1741 ? 100.000 ? ? ? ? 0.262 ? ? ? ? ? ? ? ? 19.400 ? 0.864 ? ? 0.269 0.061 0 4 1 0.991 ? 2.190 2.330 ? ? ? ? ? 1778 ? 100.000 ? ? ? ? 0.183 ? ? ? ? ? ? ? ? 19.500 ? 0.947 ? ? 0.188 0.042 0 5 1 0.995 ? 2.330 2.510 ? ? ? ? ? 1771 ? 100.000 ? ? ? ? 0.130 ? ? ? ? ? ? ? ? 19.400 ? 1.025 ? ? 0.133 0.030 0 6 1 0.997 ? 2.510 2.760 ? ? ? ? ? 1785 ? 100.000 ? ? ? ? 0.093 ? ? ? ? ? ? ? ? 19.400 ? 0.997 ? ? 0.095 0.022 0 7 1 0.999 ? 2.760 3.160 ? ? ? ? ? 1785 ? 100.000 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 19.300 ? 1.026 ? ? 0.070 0.016 0 8 1 0.999 ? 3.160 3.980 ? ? ? ? ? 1806 ? 100.000 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 19.100 ? 0.992 ? ? 0.050 0.011 0 9 1 0.999 ? 3.980 40.000 ? ? ? ? ? 1925 ? 99.700 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? 17.900 ? 1.086 ? ? 0.039 0.009 0 10 1 0.999 ? # _refine.aniso_B[1][1] 0.0600 _refine.aniso_B[1][2] 0.0300 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.0600 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -0.2000 _refine.B_iso_max 83.220 _refine.B_iso_mean 42.0790 _refine.B_iso_min 23.900 _refine.correlation_coeff_Fo_to_Fc 0.9680 _refine.correlation_coeff_Fo_to_Fc_free 0.9500 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : WITH TLS ADDED' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5D9J _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.8500 _refine.ls_d_res_low 35.4100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16871 _refine.ls_number_reflns_R_free 960 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8200 _refine.ls_percent_reflns_R_free 5.4000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1851 _refine.ls_R_factor_R_free 0.2295 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1826 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 4E5E' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1280 _refine.pdbx_overall_ESU_R_Free 0.1290 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 6.2020 _refine.overall_SU_ML 0.1060 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.8500 _refine_hist.d_res_low 35.4100 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.number_atoms_solvent 64 _refine_hist.number_atoms_total 1501 _refine_hist.pdbx_number_residues_total 179 _refine_hist.pdbx_B_iso_mean_ligand 40.21 _refine_hist.pdbx_B_iso_mean_solvent 42.85 _refine_hist.pdbx_number_atoms_protein 1413 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.029 0.019 1464 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 1344 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.615 1.960 1975 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.288 3.000 3080 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.395 5.000 178 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 35.532 22.687 67 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.554 15.000 250 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 17.892 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.170 0.200 215 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.014 0.020 1642 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 349 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 2.362 2.612 715 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.359 2.608 714 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.298 3.899 892 ? r_mcangle_it ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.8540 _refine_ls_shell.d_res_low 1.9020 _refine_ls_shell.number_reflns_all 1294 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 63 _refine_ls_shell.number_reflns_R_work 1231 _refine_ls_shell.percent_reflns_obs 98.3300 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3070 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2490 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5D9J _struct.title '2009 H1N1 PA endonuclease mutant F105S in complex with L-742,001' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5D9J _struct_keywords.text 'influenza, resistance, endonuclease inhibitor, viral protein, HYDROLASE-HYDROLASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 1 ? PHE A 9 ? MET A 1 PHE A 9 1 ? 9 HELX_P HELX_P2 AA2 ASN A 10 ? TYR A 24 ? ASN A 10 TYR A 24 1 ? 15 HELX_P HELX_P3 AA3 GLU A 31 ? GLY A 51 ? GLU A 31 GLY A 51 1 ? 21 HELX_P HELX_P4 AA4 ASP A 64 ? GLY A 80 ? ASP A 64 GLY A 80 1 ? 17 HELX_P HELX_P5 AA5 GLU A 107 ? LYS A 120 ? GLU A 107 LYS A 120 1 ? 14 HELX_P HELX_P6 AA6 LYS A 139 ? ASP A 141 ? LYS A 139 ASP A 141 5 ? 3 HELX_P HELX_P7 AA7 ASP A 145 ? ARG A 166 ? ASP A 145 ARG A 166 1 ? 22 HELX_P HELX_P8 AA8 LEU A 168 ? ALA A 179 ? LEU A 168 ALA A 179 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 41 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 41 A MN 201 1_555 ? ? ? ? ? ? ? 2.290 ? ? metalc2 metalc ? ? A GLU 61 OE2 ? ? ? 1_555 C MN . MN ? ? A GLU 61 A MN 202 1_555 ? ? ? ? ? ? ? 2.060 ? ? metalc3 metalc ? ? A ASP 89 OD2 ? ? ? 1_555 B MN . MN ? ? A ASP 89 A MN 201 1_555 ? ? ? ? ? ? ? 1.971 ? ? metalc4 metalc ? ? A ASP 89 OD1 ? ? ? 1_555 C MN . MN ? ? A ASP 89 A MN 202 1_555 ? ? ? ? ? ? ? 2.160 ? ? metalc5 metalc ? ? A GLU 100 OE2 ? ? ? 1_555 B MN . MN ? ? A GLU 100 A MN 201 1_555 ? ? ? ? ? ? ? 2.203 ? ? metalc6 metalc ? ? A ILE 101 O ? ? ? 1_555 B MN . MN ? ? A ILE 101 A MN 201 1_555 ? ? ? ? ? ? ? 2.222 ? ? metalc7 metalc ? ? B MN . MN ? ? ? 1_555 D 0N8 . O25 ? ? A MN 201 A 0N8 203 1_555 ? ? ? ? ? ? ? 1.906 ? ? metalc8 metalc ? ? B MN . MN ? ? ? 1_555 D 0N8 . O28 ? ? A MN 201 A 0N8 203 1_555 ? ? ? ? ? ? ? 2.180 ? ? metalc9 metalc ? ? C MN . MN ? ? ? 1_555 D 0N8 . O28 ? ? A MN 202 A 0N8 203 1_555 ? ? ? ? ? ? ? 2.126 ? ? metalc10 metalc ? ? C MN . MN ? ? ? 1_555 D 0N8 . O27 ? ? A MN 202 A 0N8 203 1_555 ? ? ? ? ? ? ? 2.036 ? ? metalc11 metalc ? ? C MN . MN ? ? ? 1_555 E HOH . O ? ? A MN 202 A HOH 313 1_555 ? ? ? ? ? ? ? 2.250 ? ? metalc12 metalc ? ? C MN . MN ? ? ? 1_555 E HOH . O ? ? A MN 202 A HOH 333 1_555 ? ? ? ? ? ? ? 1.959 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 57 ? ILE A 59 ? PHE A 57 ILE A 59 AA1 2 LEU A 90 ? ASP A 92 ? LEU A 90 ASP A 92 AA1 3 ARG A 97 ? THR A 104 ? ARG A 97 THR A 104 AA1 4 HIS A 125 ? SER A 130 ? HIS A 125 SER A 130 AA1 5 GLU A 135 ? ALA A 137 ? GLU A 135 ALA A 137 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 58 ? N GLU A 58 O TYR A 91 ? O TYR A 91 AA1 2 3 N ASP A 92 ? N ASP A 92 O ARG A 97 ? O ARG A 97 AA1 3 4 N GLY A 102 ? N GLY A 102 O HIS A 127 ? O HIS A 127 AA1 4 5 N ILE A 128 ? N ILE A 128 O MET A 136 ? O MET A 136 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MN 201 ? 5 'binding site for residue MN A 201' AC2 Software A MN 202 ? 5 'binding site for residue MN A 202' AC3 Software A 0N8 203 ? 12 'binding site for residue 0N8 A 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 HIS A 41 ? HIS A 41 . ? 1_555 ? 2 AC1 5 ASP A 89 ? ASP A 89 . ? 1_555 ? 3 AC1 5 GLU A 100 ? GLU A 100 . ? 1_555 ? 4 AC1 5 ILE A 101 ? ILE A 101 . ? 1_555 ? 5 AC1 5 0N8 D . ? 0N8 A 203 . ? 1_555 ? 6 AC2 5 GLU A 61 ? GLU A 61 . ? 1_555 ? 7 AC2 5 ASP A 89 ? ASP A 89 . ? 1_555 ? 8 AC2 5 0N8 D . ? 0N8 A 203 . ? 1_555 ? 9 AC2 5 HOH E . ? HOH A 313 . ? 1_555 ? 10 AC2 5 HOH E . ? HOH A 333 . ? 1_555 ? 11 AC3 12 ILE A 38 ? ILE A 38 . ? 1_555 ? 12 AC3 12 HIS A 41 ? HIS A 41 . ? 1_555 ? 13 AC3 12 GLU A 61 ? GLU A 61 . ? 1_555 ? 14 AC3 12 ASP A 89 ? ASP A 89 . ? 1_555 ? 15 AC3 12 GLU A 100 ? GLU A 100 . ? 1_555 ? 16 AC3 12 ILE A 101 ? ILE A 101 . ? 1_555 ? 17 AC3 12 LYS A 115 ? LYS A 115 . ? 1_555 ? 18 AC3 12 MN B . ? MN A 201 . ? 1_555 ? 19 AC3 12 MN C . ? MN A 202 . ? 1_555 ? 20 AC3 12 HOH E . ? HOH A 313 . ? 1_555 ? 21 AC3 12 HOH E . ? HOH A 329 . ? 1_555 ? 22 AC3 12 HOH E . ? HOH A 333 . ? 1_555 ? # _atom_sites.entry_id 5D9J _atom_sites.fract_transf_matrix[1][1] 0.016506 _atom_sites.fract_transf_matrix[1][2] 0.009530 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019059 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010419 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL MN N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 MET 67 67 67 MET MET A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 TRP 69 69 69 TRP TRP A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 MET 136 136 136 MET MET A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 TYR 142 142 142 TYR TYR A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 PHE 157 157 157 PHE PHE A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 GLN 161 161 161 GLN GLN A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 MET 163 163 163 MET MET A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 TRP 169 169 169 TRP TRP A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 PHE 172 172 172 PHE PHE A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 ALA 180 180 ? ? ? A . n A 1 181 GLU 181 181 ? ? ? A . n A 1 182 LEU 182 182 ? ? ? A . n A 1 183 ALA 183 183 ? ? ? A . n A 1 184 LEU 184 184 ? ? ? A . n A 1 185 VAL 185 185 ? ? ? A . n A 1 186 PRO 186 186 ? ? ? A . n A 1 187 ARG 187 187 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 201 201 MN MN A . C 2 MN 1 202 202 MN MN A . D 3 0N8 1 203 1 0N8 0N8 A . E 4 HOH 1 301 63 HOH HOH A . E 4 HOH 2 302 65 HOH HOH A . E 4 HOH 3 303 27 HOH HOH A . E 4 HOH 4 304 64 HOH HOH A . E 4 HOH 5 305 38 HOH HOH A . E 4 HOH 6 306 59 HOH HOH A . E 4 HOH 7 307 17 HOH HOH A . E 4 HOH 8 308 50 HOH HOH A . E 4 HOH 9 309 5 HOH HOH A . E 4 HOH 10 310 58 HOH HOH A . E 4 HOH 11 311 6 HOH HOH A . E 4 HOH 12 312 11 HOH HOH A . E 4 HOH 13 313 2 HOH HOH A . E 4 HOH 14 314 45 HOH HOH A . E 4 HOH 15 315 23 HOH HOH A . E 4 HOH 16 316 42 HOH HOH A . E 4 HOH 17 317 62 HOH HOH A . E 4 HOH 18 318 12 HOH HOH A . E 4 HOH 19 319 34 HOH HOH A . E 4 HOH 20 320 49 HOH HOH A . E 4 HOH 21 321 18 HOH HOH A . E 4 HOH 22 322 30 HOH HOH A . E 4 HOH 23 323 20 HOH HOH A . E 4 HOH 24 324 47 HOH HOH A . E 4 HOH 25 325 29 HOH HOH A . E 4 HOH 26 326 28 HOH HOH A . E 4 HOH 27 327 66 HOH HOH A . E 4 HOH 28 328 19 HOH HOH A . E 4 HOH 29 329 3 HOH HOH A . E 4 HOH 30 330 31 HOH HOH A . E 4 HOH 31 331 9 HOH HOH A . E 4 HOH 32 332 43 HOH HOH A . E 4 HOH 33 333 1 HOH HOH A . E 4 HOH 34 334 8 HOH HOH A . E 4 HOH 35 335 37 HOH HOH A . E 4 HOH 36 336 7 HOH HOH A . E 4 HOH 37 337 24 HOH HOH A . E 4 HOH 38 338 41 HOH HOH A . E 4 HOH 39 339 44 HOH HOH A . E 4 HOH 40 340 39 HOH HOH A . E 4 HOH 41 341 40 HOH HOH A . E 4 HOH 42 342 14 HOH HOH A . E 4 HOH 43 343 26 HOH HOH A . E 4 HOH 44 344 16 HOH HOH A . E 4 HOH 45 345 35 HOH HOH A . E 4 HOH 46 346 15 HOH HOH A . E 4 HOH 47 347 56 HOH HOH A . E 4 HOH 48 348 51 HOH HOH A . E 4 HOH 49 349 10 HOH HOH A . E 4 HOH 50 350 33 HOH HOH A . E 4 HOH 51 351 22 HOH HOH A . E 4 HOH 52 352 60 HOH HOH A . E 4 HOH 53 353 36 HOH HOH A . E 4 HOH 54 354 25 HOH HOH A . E 4 HOH 55 355 32 HOH HOH A . E 4 HOH 56 356 55 HOH HOH A . E 4 HOH 57 357 4 HOH HOH A . E 4 HOH 58 358 54 HOH HOH A . E 4 HOH 59 359 53 HOH HOH A . E 4 HOH 60 360 52 HOH HOH A . E 4 HOH 61 361 61 HOH HOH A . E 4 HOH 62 362 13 HOH HOH A . E 4 HOH 63 363 21 HOH HOH A . E 4 HOH 64 364 48 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 150 ? 1 MORE -7 ? 1 'SSA (A^2)' 9230 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 97.8 ? 2 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OE2 ? A GLU 100 ? A GLU 100 ? 1_555 174.6 ? 3 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OE2 ? A GLU 100 ? A GLU 100 ? 1_555 86.5 ? 4 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? A ILE 101 ? A ILE 101 ? 1_555 89.8 ? 5 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? A ILE 101 ? A ILE 101 ? 1_555 91.8 ? 6 OE2 ? A GLU 100 ? A GLU 100 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? A ILE 101 ? A ILE 101 ? 1_555 86.7 ? 7 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O25 ? D 0N8 . ? A 0N8 203 ? 1_555 89.3 ? 8 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O25 ? D 0N8 . ? A 0N8 203 ? 1_555 171.2 ? 9 OE2 ? A GLU 100 ? A GLU 100 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O25 ? D 0N8 . ? A 0N8 203 ? 1_555 86.7 ? 10 O ? A ILE 101 ? A ILE 101 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O25 ? D 0N8 . ? A 0N8 203 ? 1_555 93.4 ? 11 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O28 ? D 0N8 . ? A 0N8 203 ? 1_555 91.9 ? 12 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O28 ? D 0N8 . ? A 0N8 203 ? 1_555 99.7 ? 13 OE2 ? A GLU 100 ? A GLU 100 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O28 ? D 0N8 . ? A 0N8 203 ? 1_555 90.6 ? 14 O ? A ILE 101 ? A ILE 101 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O28 ? D 0N8 . ? A 0N8 203 ? 1_555 168.0 ? 15 O25 ? D 0N8 . ? A 0N8 203 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O28 ? D 0N8 . ? A 0N8 203 ? 1_555 74.7 ? 16 OE2 ? A GLU 61 ? A GLU 61 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 89.1 ? 17 OE2 ? A GLU 61 ? A GLU 61 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O28 ? D 0N8 . ? A 0N8 203 ? 1_555 102.9 ? 18 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O28 ? D 0N8 . ? A 0N8 203 ? 1_555 93.6 ? 19 OE2 ? A GLU 61 ? A GLU 61 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O27 ? D 0N8 . ? A 0N8 203 ? 1_555 88.2 ? 20 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O27 ? D 0N8 . ? A 0N8 203 ? 1_555 176.0 ? 21 O28 ? D 0N8 . ? A 0N8 203 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O27 ? D 0N8 . ? A 0N8 203 ? 1_555 84.2 ? 22 OE2 ? A GLU 61 ? A GLU 61 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? E HOH . ? A HOH 313 ? 1_555 86.9 ? 23 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? E HOH . ? A HOH 313 ? 1_555 92.3 ? 24 O28 ? D 0N8 . ? A 0N8 203 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? E HOH . ? A HOH 313 ? 1_555 168.6 ? 25 O27 ? D 0N8 . ? A 0N8 203 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? E HOH . ? A HOH 313 ? 1_555 90.4 ? 26 OE2 ? A GLU 61 ? A GLU 61 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? E HOH . ? A HOH 333 ? 1_555 169.7 ? 27 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? E HOH . ? A HOH 333 ? 1_555 89.3 ? 28 O28 ? D 0N8 . ? A 0N8 203 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? E HOH . ? A HOH 333 ? 1_555 87.3 ? 29 O27 ? D 0N8 . ? A 0N8 203 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? E HOH . ? A HOH 333 ? 1_555 93.9 ? 30 O ? E HOH . ? A HOH 313 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O ? E HOH . ? A HOH 333 ? 1_555 83.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-03-16 2 'Structure model' 1 1 2016-03-30 3 'Structure model' 1 2 2016-04-13 4 'Structure model' 1 3 2017-09-13 5 'Structure model' 1 4 2019-12-11 6 'Structure model' 1 5 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Author supporting evidence' 7 6 'Structure model' 'Data collection' 8 6 'Structure model' 'Database references' 9 6 'Structure model' 'Derived calculations' 10 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' pdbx_audit_support 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' pdbx_audit_support 5 6 'Structure model' chem_comp_atom 6 6 'Structure model' chem_comp_bond 7 6 'Structure model' database_2 8 6 'Structure model' pdbx_initial_refinement_model 9 6 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_id_CSD' 2 4 'Structure model' '_pdbx_audit_support.funding_organization' 3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 4 5 'Structure model' '_pdbx_audit_support.funding_organization' 5 6 'Structure model' '_database_2.pdbx_DOI' 6 6 'Structure model' '_database_2.pdbx_database_accession' 7 6 'Structure model' '_struct_conn.pdbx_dist_value' 8 6 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 10 6 'Structure model' '_struct_conn.ptnr2_label_asym_id' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 82.7650 88.3615 0.5986 0.2505 ? -0.1018 ? 0.0172 ? 0.1322 ? 0.0049 ? 0.0289 ? 0.7611 ? -0.0412 ? -0.4250 ? 1.9908 ? 0.4488 ? 0.8854 ? -0.1864 ? -0.1005 ? -0.0294 ? -0.0114 ? 0.2957 ? -0.0049 ? 0.0095 ? 0.1374 ? -0.1093 ? 2 'X-RAY DIFFRACTION' ? refined 84.5688 88.0953 8.4652 0.0970 ? -0.0383 ? -0.0263 ? 0.0850 ? 0.0311 ? 0.1031 ? 12.1493 ? -0.3279 ? -7.5186 ? 1.4557 ? -0.8628 ? 5.4852 ? 0.2082 ? -0.5758 ? 0.0839 ? 0.0245 ? -0.0679 ? 0.1961 ? -0.1743 ? 0.4619 ? -0.1402 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 1 ? ? A 180 ? ? 2 'X-RAY DIFFRACTION' 2 ? ? C 1 ? ? C 1 ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0124 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A CYS 8 ? ? SG A CYS 8 ? ? 1.928 1.818 0.110 0.017 N 2 1 CE1 A TYR 24 ? ? CZ A TYR 24 ? ? 1.473 1.381 0.092 0.013 N 3 1 CD A GLU 43 ? ? OE2 A GLU 43 ? ? 1.184 1.252 -0.068 0.011 N 4 1 CD A GLU 61 ? ? OE1 A GLU 61 ? ? 1.322 1.252 0.070 0.011 N 5 1 CD A ARG 105 ? ? NE A ARG 105 ? ? 1.342 1.460 -0.118 0.017 N 6 1 CG A TYR 112 ? ? CD2 A TYR 112 ? ? 1.283 1.387 -0.104 0.013 N 7 1 CE1 A TYR 112 ? ? CZ A TYR 112 ? ? 1.285 1.381 -0.096 0.013 N 8 1 CA A SER 130 ? ? CB A SER 130 ? ? 1.622 1.525 0.097 0.015 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG A MET 67 ? ? SD A MET 67 ? ? CE A MET 67 ? ? 88.82 100.20 -11.38 1.60 N 2 1 CB A ASP 89 ? ? CG A ASP 89 ? ? OD2 A ASP 89 ? ? 126.94 118.30 8.64 0.90 N 3 1 NE A ARG 105 ? ? CZ A ARG 105 ? ? NH1 A ARG 105 ? ? 128.75 120.30 8.45 0.50 N 4 1 NE A ARG 105 ? ? CZ A ARG 105 ? ? NH2 A ARG 105 ? ? 112.27 120.30 -8.03 0.50 N 5 1 NE A ARG 106 ? ? CZ A ARG 106 ? ? NH1 A ARG 106 ? ? 123.42 120.30 3.12 0.50 N 6 1 CG A MET 136 ? ? SD A MET 136 ? ? CE A MET 136 ? ? 87.79 100.20 -12.41 1.60 N 7 1 CB A ASP 145 ? ? CG A ASP 145 ? ? OD1 A ASP 145 ? ? 124.32 118.30 6.02 0.90 N 8 1 N A GLU 146 ? ? CA A GLU 146 ? ? CB A GLU 146 ? ? 99.78 110.60 -10.82 1.80 N 9 1 NE A ARG 149 ? ? CZ A ARG 149 ? ? NH1 A ARG 149 ? ? 126.17 120.30 5.87 0.50 N 10 1 NE A ARG 149 ? ? CZ A ARG 149 ? ? NH2 A ARG 149 ? ? 110.84 120.30 -9.46 0.50 N 11 1 NE A ARG 177 ? ? CZ A ARG 177 ? ? NH1 A ARG 177 ? ? 123.72 120.30 3.42 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 106 ? ? -102.95 -166.38 2 1 THR A 143 ? ? 69.14 -57.32 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 2 ? CG ? A GLU 2 CG 2 1 Y 1 A GLU 2 ? CD ? A GLU 2 CD 3 1 Y 1 A GLU 2 ? OE1 ? A GLU 2 OE1 4 1 Y 1 A GLU 2 ? OE2 ? A GLU 2 OE2 5 1 Y 1 A ASP 3 ? CG ? A ASP 3 CG 6 1 Y 1 A ASP 3 ? OD1 ? A ASP 3 OD1 7 1 Y 1 A ASP 3 ? OD2 ? A ASP 3 OD2 8 1 Y 1 A GLN 7 ? CG ? A GLN 7 CG 9 1 Y 1 A GLN 7 ? CD ? A GLN 7 CD 10 1 Y 1 A GLN 7 ? OE1 ? A GLN 7 OE1 11 1 Y 1 A GLN 7 ? NE2 ? A GLN 7 NE2 12 1 Y 1 A LYS 22 ? CG ? A LYS 22 CG 13 1 Y 1 A LYS 22 ? CD ? A LYS 22 CD 14 1 Y 1 A LYS 22 ? CE ? A LYS 22 CE 15 1 Y 1 A LYS 22 ? NZ ? A LYS 22 NZ 16 1 Y 1 A LYS 29 ? CG ? A LYS 29 CG 17 1 Y 1 A LYS 29 ? CD ? A LYS 29 CD 18 1 Y 1 A LYS 29 ? CE ? A LYS 29 CE 19 1 Y 1 A LYS 29 ? NZ ? A LYS 29 NZ 20 1 Y 1 A ILE 30 ? CG1 ? A ILE 30 CG1 21 1 Y 1 A ILE 30 ? CG2 ? A ILE 30 CG2 22 1 Y 1 A ILE 30 ? CD1 ? A ILE 30 CD1 23 1 Y 1 A HIS 55 ? CG ? A HIS 55 CG 24 1 Y 1 A HIS 55 ? ND1 ? A HIS 55 ND1 25 1 Y 1 A HIS 55 ? CD2 ? A HIS 55 CD2 26 1 Y 1 A HIS 55 ? CE1 ? A HIS 55 CE1 27 1 Y 1 A HIS 55 ? NE2 ? A HIS 55 NE2 28 1 Y 1 A ARG 65 ? CG ? A ARG 65 CG 29 1 Y 1 A ARG 65 ? CD ? A ARG 65 CD 30 1 Y 1 A ARG 65 ? NE ? A ARG 65 NE 31 1 Y 1 A ARG 65 ? CZ ? A ARG 65 CZ 32 1 Y 1 A ARG 65 ? NH1 ? A ARG 65 NH1 33 1 Y 1 A ARG 65 ? NH2 ? A ARG 65 NH2 34 1 Y 1 A LYS 118 ? CE ? A LYS 118 CE 35 1 Y 1 A LYS 118 ? NZ ? A LYS 118 NZ 36 1 Y 1 A LYS 120 ? CG ? A LYS 120 CG 37 1 Y 1 A LYS 120 ? CD ? A LYS 120 CD 38 1 Y 1 A LYS 120 ? CE ? A LYS 120 CE 39 1 Y 1 A LYS 120 ? NZ ? A LYS 120 NZ 40 1 Y 1 A GLU 122 ? CG ? A GLU 122 CG 41 1 Y 1 A GLU 122 ? CD ? A GLU 122 CD 42 1 Y 1 A GLU 122 ? OE1 ? A GLU 122 OE1 43 1 Y 1 A GLU 122 ? OE2 ? A GLU 122 OE2 44 1 Y 1 A LYS 123 ? CE ? A LYS 123 CE 45 1 Y 1 A LYS 123 ? NZ ? A LYS 123 NZ 46 1 Y 1 A GLU 147 ? CG ? A GLU 147 CG 47 1 Y 1 A GLU 147 ? CD ? A GLU 147 CD 48 1 Y 1 A GLU 147 ? OE1 ? A GLU 147 OE1 49 1 Y 1 A GLU 147 ? OE2 ? A GLU 147 OE2 50 1 Y 1 A GLN 161 ? CG ? A GLN 161 CG 51 1 Y 1 A GLN 161 ? CD ? A GLN 161 CD 52 1 Y 1 A GLN 161 ? OE1 ? A GLN 161 OE1 53 1 Y 1 A GLN 161 ? NE2 ? A GLN 161 NE2 54 1 Y 1 A GLU 162 ? CG ? A GLU 162 CG 55 1 Y 1 A GLU 162 ? CD ? A GLU 162 CD 56 1 Y 1 A GLU 162 ? OE1 ? A GLU 162 OE1 57 1 Y 1 A GLU 162 ? OE2 ? A GLU 162 OE2 58 1 Y 1 A GLN 174 ? CG ? A GLN 174 CG 59 1 Y 1 A GLN 174 ? CD ? A GLN 174 CD 60 1 Y 1 A GLN 174 ? OE1 ? A GLN 174 OE1 61 1 Y 1 A GLN 174 ? NE2 ? A GLN 174 NE2 62 1 N 1 A 0N8 203 ? C7 ? D 0N8 1 C7 63 1 N 1 A 0N8 203 ? C2 ? D 0N8 1 C2 64 1 N 1 A 0N8 203 ? C3 ? D 0N8 1 C3 65 1 N 1 A 0N8 203 ? C4 ? D 0N8 1 C4 66 1 N 1 A 0N8 203 ? C5 ? D 0N8 1 C5 67 1 N 1 A 0N8 203 ? C6 ? D 0N8 1 C6 68 1 N 1 A 0N8 203 ? C1 ? D 0N8 1 C1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 180 ? A ALA 180 2 1 Y 1 A GLU 181 ? A GLU 181 3 1 Y 1 A LEU 182 ? A LEU 182 4 1 Y 1 A ALA 183 ? A ALA 183 5 1 Y 1 A LEU 184 ? A LEU 184 6 1 Y 1 A VAL 185 ? A VAL 185 7 1 Y 1 A PRO 186 ? A PRO 186 8 1 Y 1 A ARG 187 ? A ARG 187 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 0N8 CL2 CL N N 1 0N8 C19 C Y N 2 0N8 C18 C Y N 3 0N8 C17 C Y N 4 0N8 C20 C Y N 5 0N8 C21 C Y N 6 0N8 C16 C Y N 7 0N8 C15 C N N 8 0N8 C11 C N N 9 0N8 C10 C N N 10 0N8 C9 C N N 11 0N8 C14 C N N 12 0N8 O27 O N N 13 0N8 C22 C N N 14 0N8 C23 C N N 15 0N8 O28 O N N 16 0N8 C24 C N N 17 0N8 O26 O N N 18 0N8 O25 O N N 19 0N8 C12 C N N 20 0N8 C13 C N N 21 0N8 N8 N N N 22 0N8 C7 C N N 23 0N8 C2 C Y N 24 0N8 C3 C Y N 25 0N8 C4 C Y N 26 0N8 C5 C Y N 27 0N8 C6 C Y N 28 0N8 C1 C Y N 29 0N8 H1 H N N 30 0N8 H2 H N N 31 0N8 H3 H N N 32 0N8 H4 H N N 33 0N8 H5 H N N 34 0N8 H6 H N N 35 0N8 H7 H N N 36 0N8 H8 H N N 37 0N8 H9 H N N 38 0N8 H10 H N N 39 0N8 H11 H N N 40 0N8 H14 H N N 41 0N8 H15 H N N 42 0N8 H16 H N N 43 0N8 H17 H N N 44 0N8 H18 H N N 45 0N8 H19 H N N 46 0N8 H21 H N N 47 0N8 H22 H N N 48 0N8 H23 H N N 49 0N8 H24 H N N 50 0N8 H25 H N N 51 0N8 H26 H N N 52 0N8 H27 H N N 53 ALA N N N N 54 ALA CA C N S 55 ALA C C N N 56 ALA O O N N 57 ALA CB C N N 58 ALA OXT O N N 59 ALA H H N N 60 ALA H2 H N N 61 ALA HA H N N 62 ALA HB1 H N N 63 ALA HB2 H N N 64 ALA HB3 H N N 65 ALA HXT H N N 66 ARG N N N N 67 ARG CA C N S 68 ARG C C N N 69 ARG O O N N 70 ARG CB C N N 71 ARG CG C N N 72 ARG CD C N N 73 ARG NE N N N 74 ARG CZ C N N 75 ARG NH1 N N N 76 ARG NH2 N N N 77 ARG OXT O N N 78 ARG H H N N 79 ARG H2 H N N 80 ARG HA H N N 81 ARG HB2 H N N 82 ARG HB3 H N N 83 ARG HG2 H N N 84 ARG HG3 H N N 85 ARG HD2 H N N 86 ARG HD3 H N N 87 ARG HE H N N 88 ARG HH11 H N N 89 ARG HH12 H N N 90 ARG HH21 H N N 91 ARG HH22 H N N 92 ARG HXT H N N 93 ASN N N N N 94 ASN CA C N S 95 ASN C C N N 96 ASN O O N N 97 ASN CB C N N 98 ASN CG C N N 99 ASN OD1 O N N 100 ASN ND2 N N N 101 ASN OXT O N N 102 ASN H H N N 103 ASN H2 H N N 104 ASN HA H N N 105 ASN HB2 H N N 106 ASN HB3 H N N 107 ASN HD21 H N N 108 ASN HD22 H N N 109 ASN HXT H N N 110 ASP N N N N 111 ASP CA C N S 112 ASP C C N N 113 ASP O O N N 114 ASP CB C N N 115 ASP CG C N N 116 ASP OD1 O N N 117 ASP OD2 O N N 118 ASP OXT O N N 119 ASP H H N N 120 ASP H2 H N N 121 ASP HA H N N 122 ASP HB2 H N N 123 ASP HB3 H N N 124 ASP HD2 H N N 125 ASP HXT H N N 126 CYS N N N N 127 CYS CA C N R 128 CYS C C N N 129 CYS O O N N 130 CYS CB C N N 131 CYS SG S N N 132 CYS OXT O N N 133 CYS H H N N 134 CYS H2 H N N 135 CYS HA H N N 136 CYS HB2 H N N 137 CYS HB3 H N N 138 CYS HG H N N 139 CYS HXT H N N 140 GLN N N N N 141 GLN CA C N S 142 GLN C C N N 143 GLN O O N N 144 GLN CB C N N 145 GLN CG C N N 146 GLN CD C N N 147 GLN OE1 O N N 148 GLN NE2 N N N 149 GLN OXT O N N 150 GLN H H N N 151 GLN H2 H N N 152 GLN HA H N N 153 GLN HB2 H N N 154 GLN HB3 H N N 155 GLN HG2 H N N 156 GLN HG3 H N N 157 GLN HE21 H N N 158 GLN HE22 H N N 159 GLN HXT H N N 160 GLU N N N N 161 GLU CA C N S 162 GLU C C N N 163 GLU O O N N 164 GLU CB C N N 165 GLU CG C N N 166 GLU CD C N N 167 GLU OE1 O N N 168 GLU OE2 O N N 169 GLU OXT O N N 170 GLU H H N N 171 GLU H2 H N N 172 GLU HA H N N 173 GLU HB2 H N N 174 GLU HB3 H N N 175 GLU HG2 H N N 176 GLU HG3 H N N 177 GLU HE2 H N N 178 GLU HXT H N N 179 GLY N N N N 180 GLY CA C N N 181 GLY C C N N 182 GLY O O N N 183 GLY OXT O N N 184 GLY H H N N 185 GLY H2 H N N 186 GLY HA2 H N N 187 GLY HA3 H N N 188 GLY HXT H N N 189 HIS N N N N 190 HIS CA C N S 191 HIS C C N N 192 HIS O O N N 193 HIS CB C N N 194 HIS CG C Y N 195 HIS ND1 N Y N 196 HIS CD2 C Y N 197 HIS CE1 C Y N 198 HIS NE2 N Y N 199 HIS OXT O N N 200 HIS H H N N 201 HIS H2 H N N 202 HIS HA H N N 203 HIS HB2 H N N 204 HIS HB3 H N N 205 HIS HD1 H N N 206 HIS HD2 H N N 207 HIS HE1 H N N 208 HIS HE2 H N N 209 HIS HXT H N N 210 HOH O O N N 211 HOH H1 H N N 212 HOH H2 H N N 213 ILE N N N N 214 ILE CA C N S 215 ILE C C N N 216 ILE O O N N 217 ILE CB C N S 218 ILE CG1 C N N 219 ILE CG2 C N N 220 ILE CD1 C N N 221 ILE OXT O N N 222 ILE H H N N 223 ILE H2 H N N 224 ILE HA H N N 225 ILE HB H N N 226 ILE HG12 H N N 227 ILE HG13 H N N 228 ILE HG21 H N N 229 ILE HG22 H N N 230 ILE HG23 H N N 231 ILE HD11 H N N 232 ILE HD12 H N N 233 ILE HD13 H N N 234 ILE HXT H N N 235 LEU N N N N 236 LEU CA C N S 237 LEU C C N N 238 LEU O O N N 239 LEU CB C N N 240 LEU CG C N N 241 LEU CD1 C N N 242 LEU CD2 C N N 243 LEU OXT O N N 244 LEU H H N N 245 LEU H2 H N N 246 LEU HA H N N 247 LEU HB2 H N N 248 LEU HB3 H N N 249 LEU HG H N N 250 LEU HD11 H N N 251 LEU HD12 H N N 252 LEU HD13 H N N 253 LEU HD21 H N N 254 LEU HD22 H N N 255 LEU HD23 H N N 256 LEU HXT H N N 257 LYS N N N N 258 LYS CA C N S 259 LYS C C N N 260 LYS O O N N 261 LYS CB C N N 262 LYS CG C N N 263 LYS CD C N N 264 LYS CE C N N 265 LYS NZ N N N 266 LYS OXT O N N 267 LYS H H N N 268 LYS H2 H N N 269 LYS HA H N N 270 LYS HB2 H N N 271 LYS HB3 H N N 272 LYS HG2 H N N 273 LYS HG3 H N N 274 LYS HD2 H N N 275 LYS HD3 H N N 276 LYS HE2 H N N 277 LYS HE3 H N N 278 LYS HZ1 H N N 279 LYS HZ2 H N N 280 LYS HZ3 H N N 281 LYS HXT H N N 282 MET N N N N 283 MET CA C N S 284 MET C C N N 285 MET O O N N 286 MET CB C N N 287 MET CG C N N 288 MET SD S N N 289 MET CE C N N 290 MET OXT O N N 291 MET H H N N 292 MET H2 H N N 293 MET HA H N N 294 MET HB2 H N N 295 MET HB3 H N N 296 MET HG2 H N N 297 MET HG3 H N N 298 MET HE1 H N N 299 MET HE2 H N N 300 MET HE3 H N N 301 MET HXT H N N 302 MN MN MN N N 303 PHE N N N N 304 PHE CA C N S 305 PHE C C N N 306 PHE O O N N 307 PHE CB C N N 308 PHE CG C Y N 309 PHE CD1 C Y N 310 PHE CD2 C Y N 311 PHE CE1 C Y N 312 PHE CE2 C Y N 313 PHE CZ C Y N 314 PHE OXT O N N 315 PHE H H N N 316 PHE H2 H N N 317 PHE HA H N N 318 PHE HB2 H N N 319 PHE HB3 H N N 320 PHE HD1 H N N 321 PHE HD2 H N N 322 PHE HE1 H N N 323 PHE HE2 H N N 324 PHE HZ H N N 325 PHE HXT H N N 326 PRO N N N N 327 PRO CA C N S 328 PRO C C N N 329 PRO O O N N 330 PRO CB C N N 331 PRO CG C N N 332 PRO CD C N N 333 PRO OXT O N N 334 PRO H H N N 335 PRO HA H N N 336 PRO HB2 H N N 337 PRO HB3 H N N 338 PRO HG2 H N N 339 PRO HG3 H N N 340 PRO HD2 H N N 341 PRO HD3 H N N 342 PRO HXT H N N 343 SER N N N N 344 SER CA C N S 345 SER C C N N 346 SER O O N N 347 SER CB C N N 348 SER OG O N N 349 SER OXT O N N 350 SER H H N N 351 SER H2 H N N 352 SER HA H N N 353 SER HB2 H N N 354 SER HB3 H N N 355 SER HG H N N 356 SER HXT H N N 357 THR N N N N 358 THR CA C N S 359 THR C C N N 360 THR O O N N 361 THR CB C N R 362 THR OG1 O N N 363 THR CG2 C N N 364 THR OXT O N N 365 THR H H N N 366 THR H2 H N N 367 THR HA H N N 368 THR HB H N N 369 THR HG1 H N N 370 THR HG21 H N N 371 THR HG22 H N N 372 THR HG23 H N N 373 THR HXT H N N 374 TRP N N N N 375 TRP CA C N S 376 TRP C C N N 377 TRP O O N N 378 TRP CB C N N 379 TRP CG C Y N 380 TRP CD1 C Y N 381 TRP CD2 C Y N 382 TRP NE1 N Y N 383 TRP CE2 C Y N 384 TRP CE3 C Y N 385 TRP CZ2 C Y N 386 TRP CZ3 C Y N 387 TRP CH2 C Y N 388 TRP OXT O N N 389 TRP H H N N 390 TRP H2 H N N 391 TRP HA H N N 392 TRP HB2 H N N 393 TRP HB3 H N N 394 TRP HD1 H N N 395 TRP HE1 H N N 396 TRP HE3 H N N 397 TRP HZ2 H N N 398 TRP HZ3 H N N 399 TRP HH2 H N N 400 TRP HXT H N N 401 TYR N N N N 402 TYR CA C N S 403 TYR C C N N 404 TYR O O N N 405 TYR CB C N N 406 TYR CG C Y N 407 TYR CD1 C Y N 408 TYR CD2 C Y N 409 TYR CE1 C Y N 410 TYR CE2 C Y N 411 TYR CZ C Y N 412 TYR OH O N N 413 TYR OXT O N N 414 TYR H H N N 415 TYR H2 H N N 416 TYR HA H N N 417 TYR HB2 H N N 418 TYR HB3 H N N 419 TYR HD1 H N N 420 TYR HD2 H N N 421 TYR HE1 H N N 422 TYR HE2 H N N 423 TYR HH H N N 424 TYR HXT H N N 425 VAL N N N N 426 VAL CA C N S 427 VAL C C N N 428 VAL O O N N 429 VAL CB C N N 430 VAL CG1 C N N 431 VAL CG2 C N N 432 VAL OXT O N N 433 VAL H H N N 434 VAL H2 H N N 435 VAL HA H N N 436 VAL HB H N N 437 VAL HG11 H N N 438 VAL HG12 H N N 439 VAL HG13 H N N 440 VAL HG21 H N N 441 VAL HG22 H N N 442 VAL HG23 H N N 443 VAL HXT H N N 444 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 0N8 C6 C1 doub Y N 1 0N8 C6 C5 sing Y N 2 0N8 C1 C2 sing Y N 3 0N8 O27 C14 doub N N 4 0N8 C12 C13 sing N N 5 0N8 C12 C11 sing N N 6 0N8 C5 C4 doub Y N 7 0N8 C13 N8 sing N N 8 0N8 C2 C7 sing N N 9 0N8 C2 C3 doub Y N 10 0N8 O28 C23 sing N N 11 0N8 C7 N8 sing N N 12 0N8 C15 C11 sing N N 13 0N8 C15 C16 sing N N 14 0N8 C14 C11 sing N N 15 0N8 C14 C22 sing N N 16 0N8 C11 C10 sing N N 17 0N8 N8 C9 sing N N 18 0N8 C4 C3 sing Y N 19 0N8 C16 C21 doub Y N 20 0N8 C16 C17 sing Y N 21 0N8 C23 C22 doub N Z 22 0N8 C23 C24 sing N N 23 0N8 C21 C20 sing Y N 24 0N8 C17 C18 doub Y N 25 0N8 O25 C24 doub N N 26 0N8 C10 C9 sing N N 27 0N8 C24 O26 sing N N 28 0N8 C20 C19 doub Y N 29 0N8 C18 C19 sing Y N 30 0N8 C19 CL2 sing N N 31 0N8 C18 H1 sing N N 32 0N8 C17 H2 sing N N 33 0N8 C20 H3 sing N N 34 0N8 C21 H4 sing N N 35 0N8 C15 H5 sing N N 36 0N8 C15 H6 sing N N 37 0N8 C10 H7 sing N N 38 0N8 C10 H8 sing N N 39 0N8 C9 H9 sing N N 40 0N8 C9 H10 sing N N 41 0N8 C22 H11 sing N N 42 0N8 O28 H14 sing N N 43 0N8 O26 H15 sing N N 44 0N8 C12 H16 sing N N 45 0N8 C12 H17 sing N N 46 0N8 C13 H18 sing N N 47 0N8 C13 H19 sing N N 48 0N8 C7 H21 sing N N 49 0N8 C7 H22 sing N N 50 0N8 C3 H23 sing N N 51 0N8 C4 H24 sing N N 52 0N8 C5 H25 sing N N 53 0N8 C6 H26 sing N N 54 0N8 C1 H27 sing N N 55 ALA N CA sing N N 56 ALA N H sing N N 57 ALA N H2 sing N N 58 ALA CA C sing N N 59 ALA CA CB sing N N 60 ALA CA HA sing N N 61 ALA C O doub N N 62 ALA C OXT sing N N 63 ALA CB HB1 sing N N 64 ALA CB HB2 sing N N 65 ALA CB HB3 sing N N 66 ALA OXT HXT sing N N 67 ARG N CA sing N N 68 ARG N H sing N N 69 ARG N H2 sing N N 70 ARG CA C sing N N 71 ARG CA CB sing N N 72 ARG CA HA sing N N 73 ARG C O doub N N 74 ARG C OXT sing N N 75 ARG CB CG sing N N 76 ARG CB HB2 sing N N 77 ARG CB HB3 sing N N 78 ARG CG CD sing N N 79 ARG CG HG2 sing N N 80 ARG CG HG3 sing N N 81 ARG CD NE sing N N 82 ARG CD HD2 sing N N 83 ARG CD HD3 sing N N 84 ARG NE CZ sing N N 85 ARG NE HE sing N N 86 ARG CZ NH1 sing N N 87 ARG CZ NH2 doub N N 88 ARG NH1 HH11 sing N N 89 ARG NH1 HH12 sing N N 90 ARG NH2 HH21 sing N N 91 ARG NH2 HH22 sing N N 92 ARG OXT HXT sing N N 93 ASN N CA sing N N 94 ASN N H sing N N 95 ASN N H2 sing N N 96 ASN CA C sing N N 97 ASN CA CB sing N N 98 ASN CA HA sing N N 99 ASN C O doub N N 100 ASN C OXT sing N N 101 ASN CB CG sing N N 102 ASN CB HB2 sing N N 103 ASN CB HB3 sing N N 104 ASN CG OD1 doub N N 105 ASN CG ND2 sing N N 106 ASN ND2 HD21 sing N N 107 ASN ND2 HD22 sing N N 108 ASN OXT HXT sing N N 109 ASP N CA sing N N 110 ASP N H sing N N 111 ASP N H2 sing N N 112 ASP CA C sing N N 113 ASP CA CB sing N N 114 ASP CA HA sing N N 115 ASP C O doub N N 116 ASP C OXT sing N N 117 ASP CB CG sing N N 118 ASP CB HB2 sing N N 119 ASP CB HB3 sing N N 120 ASP CG OD1 doub N N 121 ASP CG OD2 sing N N 122 ASP OD2 HD2 sing N N 123 ASP OXT HXT sing N N 124 CYS N CA sing N N 125 CYS N H sing N N 126 CYS N H2 sing N N 127 CYS CA C sing N N 128 CYS CA CB sing N N 129 CYS CA HA sing N N 130 CYS C O doub N N 131 CYS C OXT sing N N 132 CYS CB SG sing N N 133 CYS CB HB2 sing N N 134 CYS CB HB3 sing N N 135 CYS SG HG sing N N 136 CYS OXT HXT sing N N 137 GLN N CA sing N N 138 GLN N H sing N N 139 GLN N H2 sing N N 140 GLN CA C sing N N 141 GLN CA CB sing N N 142 GLN CA HA sing N N 143 GLN C O doub N N 144 GLN C OXT sing N N 145 GLN CB CG sing N N 146 GLN CB HB2 sing N N 147 GLN CB HB3 sing N N 148 GLN CG CD sing N N 149 GLN CG HG2 sing N N 150 GLN CG HG3 sing N N 151 GLN CD OE1 doub N N 152 GLN CD NE2 sing N N 153 GLN NE2 HE21 sing N N 154 GLN NE2 HE22 sing N N 155 GLN OXT HXT sing N N 156 GLU N CA sing N N 157 GLU N H sing N N 158 GLU N H2 sing N N 159 GLU CA C sing N N 160 GLU CA CB sing N N 161 GLU CA HA sing N N 162 GLU C O doub N N 163 GLU C OXT sing N N 164 GLU CB CG sing N N 165 GLU CB HB2 sing N N 166 GLU CB HB3 sing N N 167 GLU CG CD sing N N 168 GLU CG HG2 sing N N 169 GLU CG HG3 sing N N 170 GLU CD OE1 doub N N 171 GLU CD OE2 sing N N 172 GLU OE2 HE2 sing N N 173 GLU OXT HXT sing N N 174 GLY N CA sing N N 175 GLY N H sing N N 176 GLY N H2 sing N N 177 GLY CA C sing N N 178 GLY CA HA2 sing N N 179 GLY CA HA3 sing N N 180 GLY C O doub N N 181 GLY C OXT sing N N 182 GLY OXT HXT sing N N 183 HIS N CA sing N N 184 HIS N H sing N N 185 HIS N H2 sing N N 186 HIS CA C sing N N 187 HIS CA CB sing N N 188 HIS CA HA sing N N 189 HIS C O doub N N 190 HIS C OXT sing N N 191 HIS CB CG sing N N 192 HIS CB HB2 sing N N 193 HIS CB HB3 sing N N 194 HIS CG ND1 sing Y N 195 HIS CG CD2 doub Y N 196 HIS ND1 CE1 doub Y N 197 HIS ND1 HD1 sing N N 198 HIS CD2 NE2 sing Y N 199 HIS CD2 HD2 sing N N 200 HIS CE1 NE2 sing Y N 201 HIS CE1 HE1 sing N N 202 HIS NE2 HE2 sing N N 203 HIS OXT HXT sing N N 204 HOH O H1 sing N N 205 HOH O H2 sing N N 206 ILE N CA sing N N 207 ILE N H sing N N 208 ILE N H2 sing N N 209 ILE CA C sing N N 210 ILE CA CB sing N N 211 ILE CA HA sing N N 212 ILE C O doub N N 213 ILE C OXT sing N N 214 ILE CB CG1 sing N N 215 ILE CB CG2 sing N N 216 ILE CB HB sing N N 217 ILE CG1 CD1 sing N N 218 ILE CG1 HG12 sing N N 219 ILE CG1 HG13 sing N N 220 ILE CG2 HG21 sing N N 221 ILE CG2 HG22 sing N N 222 ILE CG2 HG23 sing N N 223 ILE CD1 HD11 sing N N 224 ILE CD1 HD12 sing N N 225 ILE CD1 HD13 sing N N 226 ILE OXT HXT sing N N 227 LEU N CA sing N N 228 LEU N H sing N N 229 LEU N H2 sing N N 230 LEU CA C sing N N 231 LEU CA CB sing N N 232 LEU CA HA sing N N 233 LEU C O doub N N 234 LEU C OXT sing N N 235 LEU CB CG sing N N 236 LEU CB HB2 sing N N 237 LEU CB HB3 sing N N 238 LEU CG CD1 sing N N 239 LEU CG CD2 sing N N 240 LEU CG HG sing N N 241 LEU CD1 HD11 sing N N 242 LEU CD1 HD12 sing N N 243 LEU CD1 HD13 sing N N 244 LEU CD2 HD21 sing N N 245 LEU CD2 HD22 sing N N 246 LEU CD2 HD23 sing N N 247 LEU OXT HXT sing N N 248 LYS N CA sing N N 249 LYS N H sing N N 250 LYS N H2 sing N N 251 LYS CA C sing N N 252 LYS CA CB sing N N 253 LYS CA HA sing N N 254 LYS C O doub N N 255 LYS C OXT sing N N 256 LYS CB CG sing N N 257 LYS CB HB2 sing N N 258 LYS CB HB3 sing N N 259 LYS CG CD sing N N 260 LYS CG HG2 sing N N 261 LYS CG HG3 sing N N 262 LYS CD CE sing N N 263 LYS CD HD2 sing N N 264 LYS CD HD3 sing N N 265 LYS CE NZ sing N N 266 LYS CE HE2 sing N N 267 LYS CE HE3 sing N N 268 LYS NZ HZ1 sing N N 269 LYS NZ HZ2 sing N N 270 LYS NZ HZ3 sing N N 271 LYS OXT HXT sing N N 272 MET N CA sing N N 273 MET N H sing N N 274 MET N H2 sing N N 275 MET CA C sing N N 276 MET CA CB sing N N 277 MET CA HA sing N N 278 MET C O doub N N 279 MET C OXT sing N N 280 MET CB CG sing N N 281 MET CB HB2 sing N N 282 MET CB HB3 sing N N 283 MET CG SD sing N N 284 MET CG HG2 sing N N 285 MET CG HG3 sing N N 286 MET SD CE sing N N 287 MET CE HE1 sing N N 288 MET CE HE2 sing N N 289 MET CE HE3 sing N N 290 MET OXT HXT sing N N 291 PHE N CA sing N N 292 PHE N H sing N N 293 PHE N H2 sing N N 294 PHE CA C sing N N 295 PHE CA CB sing N N 296 PHE CA HA sing N N 297 PHE C O doub N N 298 PHE C OXT sing N N 299 PHE CB CG sing N N 300 PHE CB HB2 sing N N 301 PHE CB HB3 sing N N 302 PHE CG CD1 doub Y N 303 PHE CG CD2 sing Y N 304 PHE CD1 CE1 sing Y N 305 PHE CD1 HD1 sing N N 306 PHE CD2 CE2 doub Y N 307 PHE CD2 HD2 sing N N 308 PHE CE1 CZ doub Y N 309 PHE CE1 HE1 sing N N 310 PHE CE2 CZ sing Y N 311 PHE CE2 HE2 sing N N 312 PHE CZ HZ sing N N 313 PHE OXT HXT sing N N 314 PRO N CA sing N N 315 PRO N CD sing N N 316 PRO N H sing N N 317 PRO CA C sing N N 318 PRO CA CB sing N N 319 PRO CA HA sing N N 320 PRO C O doub N N 321 PRO C OXT sing N N 322 PRO CB CG sing N N 323 PRO CB HB2 sing N N 324 PRO CB HB3 sing N N 325 PRO CG CD sing N N 326 PRO CG HG2 sing N N 327 PRO CG HG3 sing N N 328 PRO CD HD2 sing N N 329 PRO CD HD3 sing N N 330 PRO OXT HXT sing N N 331 SER N CA sing N N 332 SER N H sing N N 333 SER N H2 sing N N 334 SER CA C sing N N 335 SER CA CB sing N N 336 SER CA HA sing N N 337 SER C O doub N N 338 SER C OXT sing N N 339 SER CB OG sing N N 340 SER CB HB2 sing N N 341 SER CB HB3 sing N N 342 SER OG HG sing N N 343 SER OXT HXT sing N N 344 THR N CA sing N N 345 THR N H sing N N 346 THR N H2 sing N N 347 THR CA C sing N N 348 THR CA CB sing N N 349 THR CA HA sing N N 350 THR C O doub N N 351 THR C OXT sing N N 352 THR CB OG1 sing N N 353 THR CB CG2 sing N N 354 THR CB HB sing N N 355 THR OG1 HG1 sing N N 356 THR CG2 HG21 sing N N 357 THR CG2 HG22 sing N N 358 THR CG2 HG23 sing N N 359 THR OXT HXT sing N N 360 TRP N CA sing N N 361 TRP N H sing N N 362 TRP N H2 sing N N 363 TRP CA C sing N N 364 TRP CA CB sing N N 365 TRP CA HA sing N N 366 TRP C O doub N N 367 TRP C OXT sing N N 368 TRP CB CG sing N N 369 TRP CB HB2 sing N N 370 TRP CB HB3 sing N N 371 TRP CG CD1 doub Y N 372 TRP CG CD2 sing Y N 373 TRP CD1 NE1 sing Y N 374 TRP CD1 HD1 sing N N 375 TRP CD2 CE2 doub Y N 376 TRP CD2 CE3 sing Y N 377 TRP NE1 CE2 sing Y N 378 TRP NE1 HE1 sing N N 379 TRP CE2 CZ2 sing Y N 380 TRP CE3 CZ3 doub Y N 381 TRP CE3 HE3 sing N N 382 TRP CZ2 CH2 doub Y N 383 TRP CZ2 HZ2 sing N N 384 TRP CZ3 CH2 sing Y N 385 TRP CZ3 HZ3 sing N N 386 TRP CH2 HH2 sing N N 387 TRP OXT HXT sing N N 388 TYR N CA sing N N 389 TYR N H sing N N 390 TYR N H2 sing N N 391 TYR CA C sing N N 392 TYR CA CB sing N N 393 TYR CA HA sing N N 394 TYR C O doub N N 395 TYR C OXT sing N N 396 TYR CB CG sing N N 397 TYR CB HB2 sing N N 398 TYR CB HB3 sing N N 399 TYR CG CD1 doub Y N 400 TYR CG CD2 sing Y N 401 TYR CD1 CE1 sing Y N 402 TYR CD1 HD1 sing N N 403 TYR CD2 CE2 doub Y N 404 TYR CD2 HD2 sing N N 405 TYR CE1 CZ doub Y N 406 TYR CE1 HE1 sing N N 407 TYR CE2 CZ sing Y N 408 TYR CE2 HE2 sing N N 409 TYR CZ OH sing N N 410 TYR OH HH sing N N 411 TYR OXT HXT sing N N 412 VAL N CA sing N N 413 VAL N H sing N N 414 VAL N H2 sing N N 415 VAL CA C sing N N 416 VAL CA CB sing N N 417 VAL CA HA sing N N 418 VAL C O doub N N 419 VAL C OXT sing N N 420 VAL CB CG1 sing N N 421 VAL CB CG2 sing N N 422 VAL CB HB sing N N 423 VAL CG1 HG11 sing N N 424 VAL CG1 HG12 sing N N 425 VAL CG1 HG13 sing N N 426 VAL CG2 HG21 sing N N 427 VAL CG2 HG22 sing N N 428 VAL CG2 HG23 sing N N 429 VAL OXT HXT sing N N 430 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' R01AI098757 1 ;St. Jude Children's Research Hospital (ALSAC) ; 'United States' ? 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 '(2Z)-4-[1-benzyl-4-(4-chlorobenzyl)piperidin-4-yl]-2-hydroxy-4-oxobut-2-enoic acid' 0N8 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4E5E _pdbx_initial_refinement_model.details 'PDB entry 4E5E' #