data_5DCF # _entry.id 5DCF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5DCF pdb_00005dcf 10.2210/pdb5dcf/pdb WWPDB D_1000213003 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5DCF _pdbx_database_status.recvd_initial_deposition_date 2015-08-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Keller, A.N.' 1 ? 'Xin, Y.' 2 ? 'Lowe, J.' 3 ? 'Grainge, I.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 6 _citation.language ? _citation.page_first 33357 _citation.page_last 33357 _citation.title 'Activation of Xer-recombination at dif: structural basis of the FtsK gamma-XerD interaction.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/srep33357 _citation.pdbx_database_id_PubMed 27708355 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Keller, A.N.' 1 ? primary 'Xin, Y.' 2 ? primary 'Boer, S.' 3 ? primary 'Reinhardt, J.' 4 ? primary 'Baker, R.' 5 ? primary 'Arciszewska, L.K.' 6 ? primary 'Lewis, P.J.' 7 ? primary 'Sherratt, D.J.' 8 ? primary 'Lowe, J.' 9 ? primary 'Grainge, I.' 10 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5DCF _cell.details ? _cell.formula_units_Z ? _cell.length_a 83.451 _cell.length_a_esd ? _cell.length_b 83.451 _cell.length_b_esd ? _cell.length_c 88.672 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5DCF _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tyrosine recombinase XerD,DNA translocase FtsK' 30725.848 1 ? ? 'unp residues 111-298 and 1261-1329' ? 2 water nat water 18.015 61 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKDLSEAQVERLLQAPLIDQPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVYWL ETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLRHAFATHLLNHGADLRVVQMLLG HSDLSTTQIYTHVATERLRQLHQQHHPRAGGGSEGGGSEGGSGSRTGAEELDPLFDQAVQFVTEKRKASISGVQRQFRIG YNRAARIIEQMEAQGIVSEQGHNGNREVLAPPPFD ; _entity_poly.pdbx_seq_one_letter_code_can ;MKDLSEAQVERLLQAPLIDQPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVYWL ETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLRHAFATHLLNHGADLRVVQMLLG HSDLSTTQIYTHVATERLRQLHQQHHPRAGGGSEGGGSEGGSGSRTGAEELDPLFDQAVQFVTEKRKASISGVQRQFRIG YNRAARIIEQMEAQGIVSEQGHNGNREVLAPPPFD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 ASP n 1 4 LEU n 1 5 SER n 1 6 GLU n 1 7 ALA n 1 8 GLN n 1 9 VAL n 1 10 GLU n 1 11 ARG n 1 12 LEU n 1 13 LEU n 1 14 GLN n 1 15 ALA n 1 16 PRO n 1 17 LEU n 1 18 ILE n 1 19 ASP n 1 20 GLN n 1 21 PRO n 1 22 LEU n 1 23 GLU n 1 24 LEU n 1 25 ARG n 1 26 ASP n 1 27 LYS n 1 28 ALA n 1 29 MET n 1 30 LEU n 1 31 GLU n 1 32 VAL n 1 33 LEU n 1 34 TYR n 1 35 ALA n 1 36 THR n 1 37 GLY n 1 38 LEU n 1 39 ARG n 1 40 VAL n 1 41 SER n 1 42 GLU n 1 43 LEU n 1 44 VAL n 1 45 GLY n 1 46 LEU n 1 47 THR n 1 48 MET n 1 49 SER n 1 50 ASP n 1 51 ILE n 1 52 SER n 1 53 LEU n 1 54 ARG n 1 55 GLN n 1 56 GLY n 1 57 VAL n 1 58 VAL n 1 59 ARG n 1 60 VAL n 1 61 ILE n 1 62 GLY n 1 63 LYS n 1 64 GLY n 1 65 ASN n 1 66 LYS n 1 67 GLU n 1 68 ARG n 1 69 LEU n 1 70 VAL n 1 71 PRO n 1 72 LEU n 1 73 GLY n 1 74 GLU n 1 75 GLU n 1 76 ALA n 1 77 VAL n 1 78 TYR n 1 79 TRP n 1 80 LEU n 1 81 GLU n 1 82 THR n 1 83 TYR n 1 84 LEU n 1 85 GLU n 1 86 HIS n 1 87 GLY n 1 88 ARG n 1 89 PRO n 1 90 TRP n 1 91 LEU n 1 92 LEU n 1 93 ASN n 1 94 GLY n 1 95 VAL n 1 96 SER n 1 97 ILE n 1 98 ASP n 1 99 VAL n 1 100 LEU n 1 101 PHE n 1 102 PRO n 1 103 SER n 1 104 GLN n 1 105 ARG n 1 106 ALA n 1 107 GLN n 1 108 GLN n 1 109 MET n 1 110 THR n 1 111 ARG n 1 112 GLN n 1 113 THR n 1 114 PHE n 1 115 TRP n 1 116 HIS n 1 117 ARG n 1 118 ILE n 1 119 LYS n 1 120 HIS n 1 121 TYR n 1 122 ALA n 1 123 VAL n 1 124 LEU n 1 125 ALA n 1 126 GLY n 1 127 ILE n 1 128 ASP n 1 129 SER n 1 130 GLU n 1 131 LYS n 1 132 LEU n 1 133 SER n 1 134 PRO n 1 135 HIS n 1 136 VAL n 1 137 LEU n 1 138 ARG n 1 139 HIS n 1 140 ALA n 1 141 PHE n 1 142 ALA n 1 143 THR n 1 144 HIS n 1 145 LEU n 1 146 LEU n 1 147 ASN n 1 148 HIS n 1 149 GLY n 1 150 ALA n 1 151 ASP n 1 152 LEU n 1 153 ARG n 1 154 VAL n 1 155 VAL n 1 156 GLN n 1 157 MET n 1 158 LEU n 1 159 LEU n 1 160 GLY n 1 161 HIS n 1 162 SER n 1 163 ASP n 1 164 LEU n 1 165 SER n 1 166 THR n 1 167 THR n 1 168 GLN n 1 169 ILE n 1 170 TYR n 1 171 THR n 1 172 HIS n 1 173 VAL n 1 174 ALA n 1 175 THR n 1 176 GLU n 1 177 ARG n 1 178 LEU n 1 179 ARG n 1 180 GLN n 1 181 LEU n 1 182 HIS n 1 183 GLN n 1 184 GLN n 1 185 HIS n 1 186 HIS n 1 187 PRO n 1 188 ARG n 1 189 ALA n 1 190 GLY n 1 191 GLY n 1 192 GLY n 1 193 SER n 1 194 GLU n 1 195 GLY n 1 196 GLY n 1 197 GLY n 1 198 SER n 1 199 GLU n 1 200 GLY n 1 201 GLY n 1 202 SER n 1 203 GLY n 1 204 SER n 1 205 ARG n 1 206 THR n 1 207 GLY n 1 208 ALA n 1 209 GLU n 1 210 GLU n 1 211 LEU n 1 212 ASP n 1 213 PRO n 1 214 LEU n 1 215 PHE n 1 216 ASP n 1 217 GLN n 1 218 ALA n 1 219 VAL n 1 220 GLN n 1 221 PHE n 1 222 VAL n 1 223 THR n 1 224 GLU n 1 225 LYS n 1 226 ARG n 1 227 LYS n 1 228 ALA n 1 229 SER n 1 230 ILE n 1 231 SER n 1 232 GLY n 1 233 VAL n 1 234 GLN n 1 235 ARG n 1 236 GLN n 1 237 PHE n 1 238 ARG n 1 239 ILE n 1 240 GLY n 1 241 TYR n 1 242 ASN n 1 243 ARG n 1 244 ALA n 1 245 ALA n 1 246 ARG n 1 247 ILE n 1 248 ILE n 1 249 GLU n 1 250 GLN n 1 251 MET n 1 252 GLU n 1 253 ALA n 1 254 GLN n 1 255 GLY n 1 256 ILE n 1 257 VAL n 1 258 SER n 1 259 GLU n 1 260 GLN n 1 261 GLY n 1 262 HIS n 1 263 ASN n 1 264 GLY n 1 265 ASN n 1 266 ARG n 1 267 GLU n 1 268 VAL n 1 269 LEU n 1 270 ALA n 1 271 PRO n 1 272 PRO n 1 273 PRO n 1 274 PHE n 1 275 ASP n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 189 ? ? 'xerD, c3474' ? 'CFT073 / ATCC 700928 / UPEC' ? ? ? ? 'Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)' 199310 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pBAD ? ? 1 2 sample 'Biological sequence' 203 275 ? ? 'ftsK, b0890, JW0873' ? K12 ? ? ? ? 'Escherichia coli' 83333 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pBAD ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP XERD_ECOL6 P0A8P9 ? 1 ;KDLSEAQVERLLQAPLIDQPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVYWLE TYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLRHAFATHLLNHGADLRVVQMLLGH SDLSTTQIYTHVATERLRQLHQQHHPRA ; 111 2 UNP FTSK_ECOLI P46889 ? 1 GAEELDPLFDQAVQFVTEKRKASISGVQRQFRIGYNRAARIIEQMEAQGIVSEQGHNGNREVLAPPPFD 1261 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5DCF A 2 ? 189 ? P0A8P9 111 ? 298 ? 2 191 2 2 5DCF A 207 ? 275 ? P46889 1261 ? 1329 ? 209 277 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5DCF MET A 1 ? UNP P0A8P9 ? ? 'initiating methionine' 1 1 1 5DCF GLY A 190 ? UNP P0A8P9 ? ? linker 192 2 1 5DCF GLY A 191 ? UNP P0A8P9 ? ? linker 193 3 1 5DCF GLY A 192 ? UNP P0A8P9 ? ? linker 194 4 1 5DCF SER A 193 ? UNP P0A8P9 ? ? linker 195 5 1 5DCF GLU A 194 ? UNP P0A8P9 ? ? linker 196 6 1 5DCF GLY A 195 ? UNP P0A8P9 ? ? linker 197 7 1 5DCF GLY A 196 ? UNP P0A8P9 ? ? linker 198 8 1 5DCF GLY A 197 ? UNP P0A8P9 ? ? linker 199 9 1 5DCF SER A 198 ? UNP P0A8P9 ? ? linker 200 10 1 5DCF GLU A 199 ? UNP P0A8P9 ? ? linker 201 11 1 5DCF GLY A 200 ? UNP P0A8P9 ? ? linker 202 12 1 5DCF GLY A 201 ? UNP P0A8P9 ? ? linker 203 13 1 5DCF SER A 202 ? UNP P0A8P9 ? ? linker 204 14 1 5DCF GLY A 203 ? UNP P0A8P9 ? ? linker 205 15 1 5DCF SER A 204 ? UNP P0A8P9 ? ? linker 206 16 1 5DCF ARG A 205 ? UNP P0A8P9 ? ? linker 207 17 1 5DCF THR A 206 ? UNP P0A8P9 ? ? linker 208 18 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5DCF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.90 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.60 _exptl_crystal.description 'Trigonal bipyramidal' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 9 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Bicine, PEG 8000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-04-06 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5DCF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.300 _reflns.d_resolution_low 56.020 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15676 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.800 _reflns.pdbx_Rmerge_I_obs 0.136 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 62.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 3267 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.044 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 169816 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.300 2.380 ? 2.000 17378 ? ? 1552 ? 100.000 ? ? ? ? 1.736 ? ? ? ? ? ? ? ? 11.200 ? ? ? ? ? 0.540 0 1 1 0.531 ? 8.910 56.020 ? 1020.200 2320 ? ? 291 ? 99.700 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 8.000 ? ? ? ? ? 0.020 0 2 1 0.998 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 170.040 _refine.B_iso_mean 74.4091 _refine.B_iso_min 30.900 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5DCF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.3000 _refine.ls_d_res_low 36.1350 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15634 _refine.ls_number_reflns_R_free 781 _refine.ls_number_reflns_R_work 14853 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9900 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1927 _refine.ls_R_factor_R_free 0.2289 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1908 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model '1A0P, 2J5P' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.9000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.3000 _refine_hist.d_res_low 36.1350 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 61 _refine_hist.number_atoms_total 1976 _refine_hist.pdbx_number_residues_total 239 _refine_hist.pdbx_B_iso_mean_solvent 52.61 _refine_hist.pdbx_number_atoms_protein 1915 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 1951 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.162 ? 2639 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.049 ? 299 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 341 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.243 ? 734 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.3001 2.4442 2586 . 125 2461 100.0000 . . . 0.2842 . 0.2750 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.4442 2.6329 2602 . 142 2460 100.0000 . . . 0.2645 . 0.2295 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.6329 2.8977 2594 . 106 2488 100.0000 . . . 0.2544 . 0.2205 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.8977 3.3168 2601 . 132 2469 100.0000 . . . 0.2459 . 0.2087 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.3168 4.1778 2615 . 139 2476 100.0000 . . . 0.2016 . 0.1896 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 4.1778 36.1397 2636 . 137 2499 100.0000 . . . 0.2214 . 0.1588 . . . . . . 6 . . . # _struct.entry_id 5DCF _struct.title 'C-terminal domain of XerD recombinase in complex with gamma domain of FtsK' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5DCF _struct_keywords.text Recombination _struct_keywords.pdbx_keywords RECOMBINATION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 5 ? ALA A 15 ? SER A 5 ALA A 15 1 ? 11 HELX_P HELX_P2 AA2 GLN A 20 ? GLY A 37 ? GLN A 20 GLY A 37 1 ? 18 HELX_P HELX_P3 AA3 ARG A 39 ? VAL A 44 ? ARG A 39 VAL A 44 1 ? 6 HELX_P HELX_P4 AA4 GLY A 45 ? LEU A 46 ? GLY A 45 LEU A 46 5 ? 2 HELX_P HELX_P5 AA5 THR A 47 ? SER A 49 ? THR A 47 SER A 49 5 ? 3 HELX_P HELX_P6 AA6 LYS A 63 ? ASN A 65 ? LYS A 63 ASN A 65 5 ? 3 HELX_P HELX_P7 AA7 GLY A 73 ? GLY A 87 ? GLY A 73 GLY A 87 1 ? 15 HELX_P HELX_P8 AA8 GLY A 87 ? ASN A 93 ? GLY A 87 ASN A 93 1 ? 7 HELX_P HELX_P9 AA9 THR A 110 ? ALA A 125 ? THR A 110 ALA A 125 1 ? 16 HELX_P HELX_P10 AB1 SER A 133 ? GLY A 149 ? SER A 133 GLY A 149 1 ? 17 HELX_P HELX_P11 AB2 LEU A 152 ? GLY A 160 ? LEU A 152 GLY A 160 1 ? 9 HELX_P HELX_P12 AB3 SER A 165 ? GLN A 183 ? SER A 165 GLN A 183 1 ? 19 HELX_P HELX_P13 AB4 LEU A 214 ? ARG A 226 ? LEU A 216 ARG A 228 1 ? 13 HELX_P HELX_P14 AB5 SER A 229 ? PHE A 237 ? SER A 231 PHE A 239 1 ? 9 HELX_P HELX_P15 AB6 GLY A 240 ? GLY A 255 ? GLY A 242 GLY A 257 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 2 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 2 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 ASP _struct_mon_prot_cis.pdbx_label_seq_id_2 3 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 ASP _struct_mon_prot_cis.pdbx_auth_seq_id_2 3 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.25 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 51 ? SER A 52 ? ILE A 51 SER A 52 AA1 2 VAL A 57 ? ILE A 61 ? VAL A 57 ILE A 61 AA1 3 GLU A 67 ? PRO A 71 ? GLU A 67 PRO A 71 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 52 ? N SER A 52 O VAL A 57 ? O VAL A 57 AA1 2 3 N VAL A 60 ? N VAL A 60 O ARG A 68 ? O ARG A 68 # _atom_sites.entry_id 5DCF _atom_sites.fract_transf_matrix[1][1] 0.011983 _atom_sites.fract_transf_matrix[1][2] 0.006918 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013837 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011278 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 TRP 79 79 79 TRP TRP A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 TRP 90 90 90 TRP TRP A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 TRP 115 115 115 TRP TRP A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 HIS 135 135 135 HIS HIS A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 HIS 139 139 139 HIS HIS A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 HIS 144 144 144 HIS HIS A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 ASN 147 147 147 ASN ASN A . n A 1 148 HIS 148 148 148 HIS HIS A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 GLN 156 156 156 GLN GLN A . n A 1 157 MET 157 157 157 MET MET A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 HIS 161 161 161 HIS HIS A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 THR 166 166 166 THR THR A . n A 1 167 THR 167 167 167 THR THR A . n A 1 168 GLN 168 168 168 GLN GLN A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 TYR 170 170 170 TYR TYR A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 HIS 172 172 172 HIS HIS A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 THR 175 175 175 THR THR A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 ARG 179 179 179 ARG ARG A . n A 1 180 GLN 180 180 180 GLN GLN A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 HIS 182 182 182 HIS HIS A . n A 1 183 GLN 183 183 183 GLN GLN A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 HIS 185 187 ? ? ? A . n A 1 186 HIS 186 188 ? ? ? A . n A 1 187 PRO 187 189 ? ? ? A . n A 1 188 ARG 188 190 ? ? ? A . n A 1 189 ALA 189 191 ? ? ? A . n A 1 190 GLY 190 192 ? ? ? A . n A 1 191 GLY 191 193 ? ? ? A . n A 1 192 GLY 192 194 ? ? ? A . n A 1 193 SER 193 195 ? ? ? A . n A 1 194 GLU 194 196 ? ? ? A . n A 1 195 GLY 195 197 ? ? ? A . n A 1 196 GLY 196 198 ? ? ? A . n A 1 197 GLY 197 199 ? ? ? A . n A 1 198 SER 198 200 ? ? ? A . n A 1 199 GLU 199 201 ? ? ? A . n A 1 200 GLY 200 202 ? ? ? A . n A 1 201 GLY 201 203 ? ? ? A . n A 1 202 SER 202 204 ? ? ? A . n A 1 203 GLY 203 205 ? ? ? A . n A 1 204 SER 204 206 ? ? ? A . n A 1 205 ARG 205 207 ? ? ? A . n A 1 206 THR 206 208 ? ? ? A . n A 1 207 GLY 207 209 ? ? ? A . n A 1 208 ALA 208 210 ? ? ? A . n A 1 209 GLU 209 211 ? ? ? A . n A 1 210 GLU 210 212 ? ? ? A . n A 1 211 LEU 211 213 ? ? ? A . n A 1 212 ASP 212 214 214 ASP ASP A . n A 1 213 PRO 213 215 215 PRO PRO A . n A 1 214 LEU 214 216 216 LEU LEU A . n A 1 215 PHE 215 217 217 PHE PHE A . n A 1 216 ASP 216 218 218 ASP ASP A . n A 1 217 GLN 217 219 219 GLN GLN A . n A 1 218 ALA 218 220 220 ALA ALA A . n A 1 219 VAL 219 221 221 VAL VAL A . n A 1 220 GLN 220 222 222 GLN GLN A . n A 1 221 PHE 221 223 223 PHE PHE A . n A 1 222 VAL 222 224 224 VAL VAL A . n A 1 223 THR 223 225 225 THR THR A . n A 1 224 GLU 224 226 226 GLU GLU A . n A 1 225 LYS 225 227 227 LYS LYS A . n A 1 226 ARG 226 228 228 ARG ARG A . n A 1 227 LYS 227 229 229 LYS LYS A . n A 1 228 ALA 228 230 230 ALA ALA A . n A 1 229 SER 229 231 231 SER SER A . n A 1 230 ILE 230 232 232 ILE ILE A . n A 1 231 SER 231 233 233 SER SER A . n A 1 232 GLY 232 234 234 GLY GLY A . n A 1 233 VAL 233 235 235 VAL VAL A . n A 1 234 GLN 234 236 236 GLN GLN A . n A 1 235 ARG 235 237 237 ARG ARG A . n A 1 236 GLN 236 238 238 GLN GLN A . n A 1 237 PHE 237 239 239 PHE PHE A . n A 1 238 ARG 238 240 240 ARG ARG A . n A 1 239 ILE 239 241 241 ILE ILE A . n A 1 240 GLY 240 242 242 GLY GLY A . n A 1 241 TYR 241 243 243 TYR TYR A . n A 1 242 ASN 242 244 244 ASN ASN A . n A 1 243 ARG 243 245 245 ARG ARG A . n A 1 244 ALA 244 246 246 ALA ALA A . n A 1 245 ALA 245 247 247 ALA ALA A . n A 1 246 ARG 246 248 248 ARG ARG A . n A 1 247 ILE 247 249 249 ILE ILE A . n A 1 248 ILE 248 250 250 ILE ILE A . n A 1 249 GLU 249 251 251 GLU GLU A . n A 1 250 GLN 250 252 252 GLN GLN A . n A 1 251 MET 251 253 253 MET MET A . n A 1 252 GLU 252 254 254 GLU GLU A . n A 1 253 ALA 253 255 255 ALA ALA A . n A 1 254 GLN 254 256 256 GLN GLN A . n A 1 255 GLY 255 257 257 GLY GLY A . n A 1 256 ILE 256 258 258 ILE ILE A . n A 1 257 VAL 257 259 259 VAL VAL A . n A 1 258 SER 258 260 260 SER SER A . n A 1 259 GLU 259 261 261 GLU GLU A . n A 1 260 GLN 260 262 262 GLN GLN A . n A 1 261 GLY 261 263 263 GLY GLY A . n A 1 262 HIS 262 264 ? ? ? A . n A 1 263 ASN 263 265 ? ? ? A . n A 1 264 GLY 264 266 ? ? ? A . n A 1 265 ASN 265 267 ? ? ? A . n A 1 266 ARG 266 268 ? ? ? A . n A 1 267 GLU 267 269 ? ? ? A . n A 1 268 VAL 268 270 ? ? ? A . n A 1 269 LEU 269 271 271 LEU LEU A . n A 1 270 ALA 270 272 272 ALA ALA A . n A 1 271 PRO 271 273 273 PRO PRO A . n A 1 272 PRO 272 274 274 PRO PRO A . n A 1 273 PRO 273 275 275 PRO PRO A . n A 1 274 PHE 274 276 276 PHE PHE A . n A 1 275 ASP 275 277 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 59 HOH HOH A . B 2 HOH 2 302 60 HOH HOH A . B 2 HOH 3 303 41 HOH HOH A . B 2 HOH 4 304 13 HOH HOH A . B 2 HOH 5 305 36 HOH HOH A . B 2 HOH 6 306 12 HOH HOH A . B 2 HOH 7 307 3 HOH HOH A . B 2 HOH 8 308 10 HOH HOH A . B 2 HOH 9 309 30 HOH HOH A . B 2 HOH 10 310 2 HOH HOH A . B 2 HOH 11 311 15 HOH HOH A . B 2 HOH 12 312 9 HOH HOH A . B 2 HOH 13 313 31 HOH HOH A . B 2 HOH 14 314 39 HOH HOH A . B 2 HOH 15 315 58 HOH HOH A . B 2 HOH 16 316 8 HOH HOH A . B 2 HOH 17 317 5 HOH HOH A . B 2 HOH 18 318 17 HOH HOH A . B 2 HOH 19 319 40 HOH HOH A . B 2 HOH 20 320 27 HOH HOH A . B 2 HOH 21 321 43 HOH HOH A . B 2 HOH 22 322 1 HOH HOH A . B 2 HOH 23 323 6 HOH HOH A . B 2 HOH 24 324 14 HOH HOH A . B 2 HOH 25 325 44 HOH HOH A . B 2 HOH 26 326 4 HOH HOH A . B 2 HOH 27 327 23 HOH HOH A . B 2 HOH 28 328 49 HOH HOH A . B 2 HOH 29 329 11 HOH HOH A . B 2 HOH 30 330 61 HOH HOH A . B 2 HOH 31 331 21 HOH HOH A . B 2 HOH 32 332 55 HOH HOH A . B 2 HOH 33 333 52 HOH HOH A . B 2 HOH 34 334 53 HOH HOH A . B 2 HOH 35 335 51 HOH HOH A . B 2 HOH 36 336 56 HOH HOH A . B 2 HOH 37 337 32 HOH HOH A . B 2 HOH 38 338 37 HOH HOH A . B 2 HOH 39 339 22 HOH HOH A . B 2 HOH 40 340 57 HOH HOH A . B 2 HOH 41 341 48 HOH HOH A . B 2 HOH 42 342 18 HOH HOH A . B 2 HOH 43 343 16 HOH HOH A . B 2 HOH 44 344 24 HOH HOH A . B 2 HOH 45 345 19 HOH HOH A . B 2 HOH 46 346 38 HOH HOH A . B 2 HOH 47 347 35 HOH HOH A . B 2 HOH 48 348 25 HOH HOH A . B 2 HOH 49 349 34 HOH HOH A . B 2 HOH 50 350 29 HOH HOH A . B 2 HOH 51 351 54 HOH HOH A . B 2 HOH 52 352 26 HOH HOH A . B 2 HOH 53 353 46 HOH HOH A . B 2 HOH 54 354 33 HOH HOH A . B 2 HOH 55 355 7 HOH HOH A . B 2 HOH 56 356 42 HOH HOH A . B 2 HOH 57 357 45 HOH HOH A . B 2 HOH 58 358 50 HOH HOH A . B 2 HOH 59 359 28 HOH HOH A . B 2 HOH 60 360 47 HOH HOH A . B 2 HOH 61 361 20 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-09-07 2 'Structure model' 1 1 2016-11-16 3 'Structure model' 1 2 2017-09-20 4 'Structure model' 1 3 2020-01-08 5 'Structure model' 1 4 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Structure summary' 6 4 'Structure model' 'Author supporting evidence' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' diffrn_source 2 3 'Structure model' pdbx_audit_support 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' struct_keywords 5 4 'Structure model' pdbx_audit_support 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 9 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 2 3 'Structure model' '_pdbx_audit_support.country' 3 3 'Structure model' '_pdbx_audit_support.funding_organization' 4 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 5 3 'Structure model' '_struct_keywords.pdbx_keywords' 6 4 'Structure model' '_pdbx_audit_support.funding_organization' 7 5 'Structure model' '_database_2.pdbx_DOI' 8 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -13.4718 60.4389 3.3607 0.4547 ? -0.0243 ? -0.0037 ? 0.3256 ? 0.0053 ? 0.3948 ? 3.7563 ? 0.4901 ? -0.7162 ? 3.4808 ? -0.7948 ? 4.2119 ? -0.1427 ? 0.0185 ? 0.0186 ? -0.3688 ? 0.1996 ? 0.1294 ? 0.3058 ? -0.2747 ? -0.0883 ? 2 'X-RAY DIFFRACTION' ? refined -5.1012 59.6716 -6.2910 0.7857 ? -0.0665 ? 0.0978 ? 0.4800 ? 0.0094 ? 0.4832 ? 7.3819 ? 1.1635 ? 2.1460 ? 3.8205 ? 0.4309 ? 5.1665 ? -0.2605 ? 0.7539 ? -0.0500 ? -1.1062 ? 0.0955 ? -0.2132 ? 0.4301 ? 0.0553 ? 0.2150 ? 3 'X-RAY DIFFRACTION' ? refined -5.3696 51.7653 15.3015 0.4539 ? 0.0522 ? -0.0079 ? 0.4112 ? 0.0223 ? 0.3887 ? 3.3039 ? 1.3382 ? 0.1843 ? 3.6030 ? -1.4236 ? 3.6001 ? -0.0651 ? -0.7136 ? -0.2207 ? -0.0039 ? -0.1160 ? -0.2903 ? 0.4842 ? 0.3585 ? 0.1859 ? 4 'X-RAY DIFFRACTION' ? refined -4.7933 78.0285 21.5434 1.6038 ? 0.0403 ? -0.1772 ? 0.9354 ? -0.0647 ? 1.0963 ? 1.4938 ? 0.9967 ? 0.2143 ? 4.3191 ? 0.2475 ? 2.3171 ? 0.0255 ? -0.0683 ? 0.2488 ? 0.9585 ? -0.1091 ? -0.1218 ? -1.0608 ? 0.2165 ? 0.0535 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 2 through 102 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 103 through 124 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 125 through 182 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 183 through 276 ) ; # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.2.7 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 2 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? ARP ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A LEU 164 ? ? O A HOH 306 ? ? 1.55 2 1 OD1 A ASP 98 ? ? O A HOH 301 ? ? 1.92 3 1 O A HOH 340 ? ? O A HOH 351 ? ? 1.97 4 1 OE1 A GLN 55 ? ? O A HOH 302 ? ? 2.10 5 1 O A HOH 350 ? ? O A HOH 353 ? ? 2.13 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 93 ? ? 48.16 70.24 2 1 PHE A 101 ? ? -116.67 73.52 3 1 ARG A 228 ? ? 71.29 -27.69 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A HIS 187 ? A HIS 185 3 1 Y 1 A HIS 188 ? A HIS 186 4 1 Y 1 A PRO 189 ? A PRO 187 5 1 Y 1 A ARG 190 ? A ARG 188 6 1 Y 1 A ALA 191 ? A ALA 189 7 1 Y 1 A GLY 192 ? A GLY 190 8 1 Y 1 A GLY 193 ? A GLY 191 9 1 Y 1 A GLY 194 ? A GLY 192 10 1 Y 1 A SER 195 ? A SER 193 11 1 Y 1 A GLU 196 ? A GLU 194 12 1 Y 1 A GLY 197 ? A GLY 195 13 1 Y 1 A GLY 198 ? A GLY 196 14 1 Y 1 A GLY 199 ? A GLY 197 15 1 Y 1 A SER 200 ? A SER 198 16 1 Y 1 A GLU 201 ? A GLU 199 17 1 Y 1 A GLY 202 ? A GLY 200 18 1 Y 1 A GLY 203 ? A GLY 201 19 1 Y 1 A SER 204 ? A SER 202 20 1 Y 1 A GLY 205 ? A GLY 203 21 1 Y 1 A SER 206 ? A SER 204 22 1 Y 1 A ARG 207 ? A ARG 205 23 1 Y 1 A THR 208 ? A THR 206 24 1 Y 1 A GLY 209 ? A GLY 207 25 1 Y 1 A ALA 210 ? A ALA 208 26 1 Y 1 A GLU 211 ? A GLU 209 27 1 Y 1 A GLU 212 ? A GLU 210 28 1 Y 1 A LEU 213 ? A LEU 211 29 1 Y 1 A HIS 264 ? A HIS 262 30 1 Y 1 A ASN 265 ? A ASN 263 31 1 Y 1 A GLY 266 ? A GLY 264 32 1 Y 1 A ASN 267 ? A ASN 265 33 1 Y 1 A ARG 268 ? A ARG 266 34 1 Y 1 A GLU 269 ? A GLU 267 35 1 Y 1 A VAL 270 ? A VAL 268 36 1 Y 1 A ASP 277 ? A ASP 275 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TRP N N N N 307 TRP CA C N S 308 TRP C C N N 309 TRP O O N N 310 TRP CB C N N 311 TRP CG C Y N 312 TRP CD1 C Y N 313 TRP CD2 C Y N 314 TRP NE1 N Y N 315 TRP CE2 C Y N 316 TRP CE3 C Y N 317 TRP CZ2 C Y N 318 TRP CZ3 C Y N 319 TRP CH2 C Y N 320 TRP OXT O N N 321 TRP H H N N 322 TRP H2 H N N 323 TRP HA H N N 324 TRP HB2 H N N 325 TRP HB3 H N N 326 TRP HD1 H N N 327 TRP HE1 H N N 328 TRP HE3 H N N 329 TRP HZ2 H N N 330 TRP HZ3 H N N 331 TRP HH2 H N N 332 TRP HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 VAL N N N N 358 VAL CA C N S 359 VAL C C N N 360 VAL O O N N 361 VAL CB C N N 362 VAL CG1 C N N 363 VAL CG2 C N N 364 VAL OXT O N N 365 VAL H H N N 366 VAL H2 H N N 367 VAL HA H N N 368 VAL HB H N N 369 VAL HG11 H N N 370 VAL HG12 H N N 371 VAL HG13 H N N 372 VAL HG21 H N N 373 VAL HG22 H N N 374 VAL HG23 H N N 375 VAL HXT H N N 376 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.country Australia _pdbx_audit_support.funding_organization 'National Health and Medical Research Council (NHMRC, Australia)' _pdbx_audit_support.grant_number 'APP1005697 to I. Grainge' _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_initial_refinement_model.id _pdbx_initial_refinement_model.entity_id_list _pdbx_initial_refinement_model.type _pdbx_initial_refinement_model.source_name _pdbx_initial_refinement_model.accession_code _pdbx_initial_refinement_model.details 1 ? 'experimental model' PDB 1A0P '1A0P, 2J5P' 2 ? 'experimental model' PDB 2J5P '1A0P, 2J5P' #