data_5DKN # _entry.id 5DKN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5DKN pdb_00005dkn 10.2210/pdb5dkn/pdb WWPDB D_1000213354 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5DKQ PDB . unspecified 5DKR PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5DKN _pdbx_database_status.recvd_initial_deposition_date 2015-09-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cavalier, M.C.' 1 'Ansari, M.I.' 2 'Pierce, A.D.' 3 'Wilder, P.T.' 4 'McKnight, L.E.' 5 'Raman, E.P.' 6 'Neau, D.B.' 7 'Bezawada, P.' 8 'Alasady, M.J.' 9 'Varney, K.M.' 10 'Toth, E.A.' 11 'MacKerell Jr., A.D.' 12 'Coop, A.' 13 'Weber, D.J.' 14 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 59 _citation.language ? _citation.page_first 592 _citation.page_last 608 _citation.title 'Small Molecule Inhibitors of Ca(2+)-S100B Reveal Two Protein Conformations.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.5b01369 _citation.pdbx_database_id_PubMed 26727270 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cavalier, M.C.' 1 ? primary 'Ansari, M.I.' 2 ? primary 'Pierce, A.D.' 3 ? primary 'Wilder, P.T.' 4 ? primary 'McKnight, L.E.' 5 ? primary 'Raman, E.P.' 6 ? primary 'Neau, D.B.' 7 ? primary 'Bezawada, P.' 8 ? primary 'Alasady, M.J.' 9 ? primary 'Charpentier, T.H.' 10 ? primary 'Varney, K.M.' 11 ? primary 'Toth, E.A.' 12 ? primary 'MacKerell, A.D.' 13 ? primary 'Coop, A.' 14 ? primary 'Weber, D.J.' 15 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5DKN _cell.details ? _cell.formula_units_Z ? _cell.length_a 64.046 _cell.length_a_esd ? _cell.length_b 64.046 _cell.length_b_esd ? _cell.length_c 47.563 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5DKN _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein S100-B' 10681.974 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 3 non-polymer syn "2,2'-[heptane-1,7-diylbis(oxybenzene-4,1-diyl)]bis(1H-imidazole)" 416.515 1 ? ? ? ? 4 water nat water 18.015 132 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'S-100 protein beta chain,S-100 protein subunit beta,S100 calcium-binding protein B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM ITTACHEFFEHE ; _entity_poly.pdbx_seq_one_letter_code_can ;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM ITTACHEFFEHE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLU n 1 4 LEU n 1 5 GLU n 1 6 LYS n 1 7 ALA n 1 8 VAL n 1 9 VAL n 1 10 ALA n 1 11 LEU n 1 12 ILE n 1 13 ASP n 1 14 VAL n 1 15 PHE n 1 16 HIS n 1 17 GLN n 1 18 TYR n 1 19 SER n 1 20 GLY n 1 21 ARG n 1 22 GLU n 1 23 GLY n 1 24 ASP n 1 25 LYS n 1 26 HIS n 1 27 LYS n 1 28 LEU n 1 29 LYS n 1 30 LYS n 1 31 SER n 1 32 GLU n 1 33 LEU n 1 34 LYS n 1 35 GLU n 1 36 LEU n 1 37 ILE n 1 38 ASN n 1 39 ASN n 1 40 GLU n 1 41 LEU n 1 42 SER n 1 43 HIS n 1 44 PHE n 1 45 LEU n 1 46 GLU n 1 47 GLU n 1 48 ILE n 1 49 LYS n 1 50 GLU n 1 51 GLN n 1 52 GLU n 1 53 VAL n 1 54 VAL n 1 55 ASP n 1 56 LYS n 1 57 VAL n 1 58 MET n 1 59 GLU n 1 60 THR n 1 61 LEU n 1 62 ASP n 1 63 SER n 1 64 ASP n 1 65 GLY n 1 66 ASP n 1 67 GLY n 1 68 GLU n 1 69 CYS n 1 70 ASP n 1 71 PHE n 1 72 GLN n 1 73 GLU n 1 74 PHE n 1 75 MET n 1 76 ALA n 1 77 PHE n 1 78 VAL n 1 79 ALA n 1 80 MET n 1 81 ILE n 1 82 THR n 1 83 THR n 1 84 ALA n 1 85 CYS n 1 86 HIS n 1 87 GLU n 1 88 PHE n 1 89 PHE n 1 90 GLU n 1 91 HIS n 1 92 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 92 _entity_src_gen.gene_src_common_name Bovine _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene S100B _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code S100B_BOVIN _struct_ref.pdbx_db_accession P02638 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM ITTACHEFFEHE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5DKN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 92 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02638 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 92 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 91 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 B7I non-polymer . "2,2'-[heptane-1,7-diylbis(oxybenzene-4,1-diyl)]bis(1H-imidazole)" ? 'C25 H28 N4 O2' 416.515 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5DKN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.28 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.12 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '10% Peg 3,350; 0.1M Cacodylate, pH 6.4; 7.5mM CaCl2' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-12-01 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 15.870 _reflns.entry_id 5DKN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.528 _reflns.d_resolution_low 45.287 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 15494 _reflns.number_obs 15494 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.800 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.048 _reflns.pdbx_netI_over_av_sigmaI 9.194 _reflns.pdbx_netI_over_sigmaI 26.100 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.060 _reflns.pdbx_Rpim_I_all 0.027 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 74444 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.528 1.610 ? 2.300 10810 ? ? 2197 ? 99.500 ? ? ? ? 0.347 ? ? ? ? ? ? ? ? 4.900 0.347 ? ? 3.800 ? 0.197 0 1 1 ? ? 1.610 1.710 ? 3.500 10405 ? ? 2105 ? 100.000 ? ? ? ? 0.219 ? ? ? ? ? ? ? ? 4.900 0.219 ? ? 6.400 ? 0.124 0 2 1 ? ? 1.710 1.830 ? 5.500 9767 ? ? 1987 ? 100.000 ? ? ? ? 0.137 ? ? ? ? ? ? ? ? 4.900 0.137 ? ? 10.600 ? 0.078 0 3 1 ? ? 1.830 1.970 ? 8.600 9050 ? ? 1839 ? 100.000 ? ? ? ? 0.084 ? ? ? ? ? ? ? ? 4.900 0.084 ? ? 18.300 ? 0.047 0 4 1 ? ? 1.970 2.160 ? 11.400 8439 ? ? 1728 ? 100.000 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 4.900 0.057 ? ? 29.200 ? 0.032 0 5 1 ? ? 2.160 2.420 ? 12.400 7529 ? ? 1558 ? 100.000 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 4.800 0.050 ? ? 38.200 ? 0.028 0 6 1 ? ? 2.420 2.790 ? 11.700 6607 ? ? 1400 ? 100.000 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 4.700 0.052 ? ? 45.500 ? 0.031 0 7 1 ? ? 2.790 3.420 ? 12.200 5322 ? ? 1185 ? 99.700 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 4.500 0.047 ? ? 52.600 ? 0.028 0 8 1 ? ? 3.420 4.830 ? 26.700 4204 ? ? 943 ? 99.300 ? ? ? ? 0.022 ? ? ? ? ? ? ? ? 4.500 0.022 ? ? 62.400 ? 0.012 0 9 1 ? ? 4.830 45.287 ? 11.300 2311 ? ? 552 ? 96.900 ? ? ? ? 0.022 ? ? ? ? ? ? ? ? 4.200 0.022 ? ? 59.000 ? 0.015 0 10 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 47.650 _refine.B_iso_mean 18.5200 _refine.B_iso_min 7.970 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5DKN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.5280 _refine.ls_d_res_low 32.7980 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15456 _refine.ls_number_reflns_R_free 1546 _refine.ls_number_reflns_R_work 13910 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6000 _refine.ls_percent_reflns_R_free 10.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1954 _refine.ls_R_factor_R_free 0.2184 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1927 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1MHO _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.1400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1400 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.8406 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.5280 _refine_hist.d_res_low 32.7980 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.number_atoms_solvent 132 _refine_hist.number_atoms_total 902 _refine_hist.pdbx_number_residues_total 91 _refine_hist.pdbx_B_iso_mean_ligand 21.04 _refine_hist.pdbx_B_iso_mean_solvent 26.08 _refine_hist.pdbx_number_atoms_protein 737 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 ? 797 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.920 ? 1087 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.069 ? 109 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 135 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 20.927 ? 299 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.5278 1.5771 1357 . 136 1221 99.0000 . . . 0.2553 . 0.2112 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.5771 1.6334 1372 . 137 1235 100.0000 . . . 0.2327 . 0.2003 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.6334 1.6988 1398 . 139 1259 100.0000 . . . 0.2002 . 0.1925 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.6988 1.7762 1385 . 139 1246 100.0000 . . . 0.2470 . 0.1988 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.7762 1.8698 1367 . 137 1230 100.0000 . . . 0.2623 . 0.2033 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.8698 1.9869 1412 . 141 1271 100.0000 . . . 0.2481 . 0.2018 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 1.9869 2.1403 1388 . 139 1249 100.0000 . . . 0.2429 . 0.1885 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 2.1403 2.3556 1420 . 142 1278 100.0000 . . . 0.2256 . 0.1888 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 2.3556 2.6964 1416 . 142 1274 100.0000 . . . 0.2100 . 0.1894 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 2.6964 3.3966 1437 . 144 1293 100.0000 . . . 0.2197 . 0.1956 . . . . . . 11 . . . 'X-RAY DIFFRACTION' 3.3966 32.8055 1504 . 150 1354 98.0000 . . . 0.1907 . 0.1873 . . . . . . 11 . . . # _struct.entry_id 5DKN _struct.title 'Crystal Structure of Calcium-loaded S100B bound to SBi4225' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5DKN _struct_keywords.text 'malignant melanoma, calcium binding, covalent inhibitor, METAL BINDING PROTEIN-INHIBITOR complex' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN/INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? GLY A 20 ? SER A 1 GLY A 19 1 ? 19 HELX_P HELX_P2 AA2 LYS A 29 ? LEU A 41 ? LYS A 28 LEU A 40 1 ? 13 HELX_P HELX_P3 AA3 GLU A 50 ? ASP A 62 ? GLU A 49 ASP A 61 1 ? 13 HELX_P HELX_P4 AA4 ASP A 70 ? GLU A 87 ? ASP A 69 GLU A 86 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A SER 19 O ? ? ? 1_555 B CA . CA ? ? A SER 18 A CA 101 1_555 ? ? ? ? ? ? ? 2.334 ? ? metalc2 metalc ? ? A GLU 22 O ? ? ? 1_555 B CA . CA ? ? A GLU 21 A CA 101 1_555 ? ? ? ? ? ? ? 2.365 ? ? metalc3 metalc ? ? A ASP 24 O ? ? ? 1_555 B CA . CA ? ? A ASP 23 A CA 101 1_555 ? ? ? ? ? ? ? 2.350 ? ? metalc4 metalc ? ? A LYS 27 O ? ? ? 1_555 B CA . CA ? ? A LYS 26 A CA 101 1_555 ? ? ? ? ? ? ? 2.382 ? ? metalc5 metalc ? ? A GLU 32 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 31 A CA 101 1_555 ? ? ? ? ? ? ? 2.437 ? ? metalc6 metalc ? ? A GLU 32 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 31 A CA 101 1_555 ? ? ? ? ? ? ? 2.568 ? ? metalc7 metalc ? ? A ASP 62 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 61 A CA 102 1_555 ? ? ? ? ? ? ? 2.296 ? ? metalc8 metalc ? ? A ASP 64 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 63 A CA 102 1_555 ? ? ? ? ? ? ? 2.316 ? ? metalc9 metalc ? ? A ASP 66 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 65 A CA 102 1_555 ? ? ? ? ? ? ? 2.343 ? ? metalc10 metalc ? ? A GLU 68 O ? ? ? 1_555 C CA . CA ? ? A GLU 67 A CA 102 1_555 ? ? ? ? ? ? ? 2.382 ? ? metalc11 metalc ? ? A GLU 73 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 72 A CA 102 1_555 ? ? ? ? ? ? ? 2.436 ? ? metalc12 metalc ? ? A GLU 73 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 72 A CA 102 1_555 ? ? ? ? ? ? ? 2.526 ? ? metalc13 metalc ? ? B CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 101 A HOH 240 1_555 ? ? ? ? ? ? ? 2.316 ? ? metalc14 metalc ? ? C CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 102 A HOH 220 1_555 ? ? ? ? ? ? ? 2.385 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 101 ? 6 'binding site for residue CA A 101' AC2 Software A CA 102 ? 6 'binding site for residue CA A 102' AC3 Software A B7I 103 ? 9 'binding site for residue B7I A 103' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 SER A 19 ? SER A 18 . ? 1_555 ? 2 AC1 6 GLU A 22 ? GLU A 21 . ? 1_555 ? 3 AC1 6 ASP A 24 ? ASP A 23 . ? 1_555 ? 4 AC1 6 LYS A 27 ? LYS A 26 . ? 1_555 ? 5 AC1 6 GLU A 32 ? GLU A 31 . ? 1_555 ? 6 AC1 6 HOH E . ? HOH A 240 . ? 1_555 ? 7 AC2 6 ASP A 62 ? ASP A 61 . ? 1_555 ? 8 AC2 6 ASP A 64 ? ASP A 63 . ? 1_555 ? 9 AC2 6 ASP A 66 ? ASP A 65 . ? 1_555 ? 10 AC2 6 GLU A 68 ? GLU A 67 . ? 1_555 ? 11 AC2 6 GLU A 73 ? GLU A 72 . ? 1_555 ? 12 AC2 6 HOH E . ? HOH A 220 . ? 1_555 ? 13 AC3 9 VAL A 9 ? VAL A 8 . ? 7_647 ? 14 AC3 9 ASP A 13 ? ASP A 12 . ? 7_647 ? 15 AC3 9 HIS A 43 ? HIS A 42 . ? 2_754 ? 16 AC3 9 HIS A 43 ? HIS A 42 . ? 8_667 ? 17 AC3 9 CYS A 85 ? CYS A 84 . ? 8_667 ? 18 AC3 9 HIS A 86 ? HIS A 85 . ? 8_667 ? 19 AC3 9 PHE A 88 ? PHE A 87 . ? 8_667 ? 20 AC3 9 PHE A 89 ? PHE A 88 . ? 8_667 ? 21 AC3 9 HOH E . ? HOH A 288 . ? 1_555 ? # _atom_sites.entry_id 5DKN _atom_sites.fract_transf_matrix[1][1] 0.015614 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015614 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021025 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 SER 2 1 1 SER SER A . n A 1 3 GLU 3 2 2 GLU GLU A . n A 1 4 LEU 4 3 3 LEU LEU A . n A 1 5 GLU 5 4 4 GLU GLU A . n A 1 6 LYS 6 5 5 LYS LYS A . n A 1 7 ALA 7 6 6 ALA ALA A . n A 1 8 VAL 8 7 7 VAL VAL A . n A 1 9 VAL 9 8 8 VAL VAL A . n A 1 10 ALA 10 9 9 ALA ALA A . n A 1 11 LEU 11 10 10 LEU LEU A . n A 1 12 ILE 12 11 11 ILE ILE A . n A 1 13 ASP 13 12 12 ASP ASP A . n A 1 14 VAL 14 13 13 VAL VAL A . n A 1 15 PHE 15 14 14 PHE PHE A . n A 1 16 HIS 16 15 15 HIS HIS A . n A 1 17 GLN 17 16 16 GLN GLN A . n A 1 18 TYR 18 17 17 TYR TYR A . n A 1 19 SER 19 18 18 SER SER A . n A 1 20 GLY 20 19 19 GLY GLY A . n A 1 21 ARG 21 20 20 ARG ARG A . n A 1 22 GLU 22 21 21 GLU GLU A . n A 1 23 GLY 23 22 22 GLY GLY A . n A 1 24 ASP 24 23 23 ASP ASP A . n A 1 25 LYS 25 24 24 LYS LYS A . n A 1 26 HIS 26 25 25 HIS HIS A . n A 1 27 LYS 27 26 26 LYS LYS A . n A 1 28 LEU 28 27 27 LEU LEU A . n A 1 29 LYS 29 28 28 LYS LYS A . n A 1 30 LYS 30 29 29 LYS LYS A . n A 1 31 SER 31 30 30 SER SER A . n A 1 32 GLU 32 31 31 GLU GLU A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 LYS 34 33 33 LYS LYS A . n A 1 35 GLU 35 34 34 GLU GLU A . n A 1 36 LEU 36 35 35 LEU LEU A . n A 1 37 ILE 37 36 36 ILE ILE A . n A 1 38 ASN 38 37 37 ASN ASN A . n A 1 39 ASN 39 38 38 ASN ASN A . n A 1 40 GLU 40 39 39 GLU GLU A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 SER 42 41 41 SER SER A . n A 1 43 HIS 43 42 42 HIS HIS A . n A 1 44 PHE 44 43 43 PHE PHE A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 GLU 46 45 45 GLU GLU A . n A 1 47 GLU 47 46 46 GLU GLU A . n A 1 48 ILE 48 47 47 ILE ILE A . n A 1 49 LYS 49 48 48 LYS LYS A . n A 1 50 GLU 50 49 49 GLU GLU A . n A 1 51 GLN 51 50 50 GLN GLN A . n A 1 52 GLU 52 51 51 GLU GLU A . n A 1 53 VAL 53 52 52 VAL VAL A . n A 1 54 VAL 54 53 53 VAL VAL A . n A 1 55 ASP 55 54 54 ASP ASP A . n A 1 56 LYS 56 55 55 LYS LYS A . n A 1 57 VAL 57 56 56 VAL VAL A . n A 1 58 MET 58 57 57 MET MET A . n A 1 59 GLU 59 58 58 GLU GLU A . n A 1 60 THR 60 59 59 THR THR A . n A 1 61 LEU 61 60 60 LEU LEU A . n A 1 62 ASP 62 61 61 ASP ASP A . n A 1 63 SER 63 62 62 SER SER A . n A 1 64 ASP 64 63 63 ASP ASP A . n A 1 65 GLY 65 64 64 GLY GLY A . n A 1 66 ASP 66 65 65 ASP ASP A . n A 1 67 GLY 67 66 66 GLY GLY A . n A 1 68 GLU 68 67 67 GLU GLU A . n A 1 69 CYS 69 68 68 CYS CYS A . n A 1 70 ASP 70 69 69 ASP ASP A . n A 1 71 PHE 71 70 70 PHE PHE A . n A 1 72 GLN 72 71 71 GLN GLN A . n A 1 73 GLU 73 72 72 GLU GLU A . n A 1 74 PHE 74 73 73 PHE PHE A . n A 1 75 MET 75 74 74 MET MET A . n A 1 76 ALA 76 75 75 ALA ALA A . n A 1 77 PHE 77 76 76 PHE PHE A . n A 1 78 VAL 78 77 77 VAL VAL A . n A 1 79 ALA 79 78 78 ALA ALA A . n A 1 80 MET 80 79 79 MET MET A . n A 1 81 ILE 81 80 80 ILE ILE A . n A 1 82 THR 82 81 81 THR THR A . n A 1 83 THR 83 82 82 THR THR A . n A 1 84 ALA 84 83 83 ALA ALA A . n A 1 85 CYS 85 84 84 CYS CYS A . n A 1 86 HIS 86 85 85 HIS HIS A . n A 1 87 GLU 87 86 86 GLU GLU A . n A 1 88 PHE 88 87 87 PHE PHE A . n A 1 89 PHE 89 88 88 PHE PHE A . n A 1 90 GLU 90 89 89 GLU GLU A . n A 1 91 HIS 91 90 90 HIS HIS A . n A 1 92 GLU 92 91 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 101 1 CA CA A . C 2 CA 1 102 1 CA CA A . D 3 B7I 1 103 1 B7I B7I A . E 4 HOH 1 201 174 HOH HOH A . E 4 HOH 2 202 144 HOH HOH A . E 4 HOH 3 203 168 HOH HOH A . E 4 HOH 4 204 46 HOH HOH A . E 4 HOH 5 205 113 HOH HOH A . E 4 HOH 6 206 9 HOH HOH A . E 4 HOH 7 207 49 HOH HOH A . E 4 HOH 8 208 120 HOH HOH A . E 4 HOH 9 209 121 HOH HOH A . E 4 HOH 10 210 42 HOH HOH A . E 4 HOH 11 211 130 HOH HOH A . E 4 HOH 12 212 162 HOH HOH A . E 4 HOH 13 213 125 HOH HOH A . E 4 HOH 14 214 51 HOH HOH A . E 4 HOH 15 215 30 HOH HOH A . E 4 HOH 16 216 39 HOH HOH A . E 4 HOH 17 217 43 HOH HOH A . E 4 HOH 18 218 118 HOH HOH A . E 4 HOH 19 219 69 HOH HOH A . E 4 HOH 20 220 80 HOH HOH A . E 4 HOH 21 221 52 HOH HOH A . E 4 HOH 22 222 1 HOH HOH A . E 4 HOH 23 223 15 HOH HOH A . E 4 HOH 24 224 23 HOH HOH A . E 4 HOH 25 225 148 HOH HOH A . E 4 HOH 26 226 29 HOH HOH A . E 4 HOH 27 227 32 HOH HOH A . E 4 HOH 28 228 11 HOH HOH A . E 4 HOH 29 229 27 HOH HOH A . E 4 HOH 30 230 152 HOH HOH A . E 4 HOH 31 231 85 HOH HOH A . E 4 HOH 32 232 122 HOH HOH A . E 4 HOH 33 233 19 HOH HOH A . E 4 HOH 34 234 82 HOH HOH A . E 4 HOH 35 235 36 HOH HOH A . E 4 HOH 36 236 38 HOH HOH A . E 4 HOH 37 237 24 HOH HOH A . E 4 HOH 38 238 8 HOH HOH A . E 4 HOH 39 239 62 HOH HOH A . E 4 HOH 40 240 18 HOH HOH A . E 4 HOH 41 241 63 HOH HOH A . E 4 HOH 42 242 17 HOH HOH A . E 4 HOH 43 243 47 HOH HOH A . E 4 HOH 44 244 59 HOH HOH A . E 4 HOH 45 245 50 HOH HOH A . E 4 HOH 46 246 58 HOH HOH A . E 4 HOH 47 247 96 HOH HOH A . E 4 HOH 48 248 110 HOH HOH A . E 4 HOH 49 249 149 HOH HOH A . E 4 HOH 50 250 33 HOH HOH A . E 4 HOH 51 251 150 HOH HOH A . E 4 HOH 52 252 56 HOH HOH A . E 4 HOH 53 253 7 HOH HOH A . E 4 HOH 54 254 13 HOH HOH A . E 4 HOH 55 255 57 HOH HOH A . E 4 HOH 56 256 55 HOH HOH A . E 4 HOH 57 257 68 HOH HOH A . E 4 HOH 58 258 4 HOH HOH A . E 4 HOH 59 259 126 HOH HOH A . E 4 HOH 60 260 115 HOH HOH A . E 4 HOH 61 261 98 HOH HOH A . E 4 HOH 62 262 93 HOH HOH A . E 4 HOH 63 263 155 HOH HOH A . E 4 HOH 64 264 2 HOH HOH A . E 4 HOH 65 265 90 HOH HOH A . E 4 HOH 66 266 101 HOH HOH A . E 4 HOH 67 267 41 HOH HOH A . E 4 HOH 68 268 60 HOH HOH A . E 4 HOH 69 269 103 HOH HOH A . E 4 HOH 70 270 3 HOH HOH A . E 4 HOH 71 271 16 HOH HOH A . E 4 HOH 72 272 48 HOH HOH A . E 4 HOH 73 273 169 HOH HOH A . E 4 HOH 74 274 5 HOH HOH A . E 4 HOH 75 275 136 HOH HOH A . E 4 HOH 76 276 25 HOH HOH A . E 4 HOH 77 277 89 HOH HOH A . E 4 HOH 78 278 61 HOH HOH A . E 4 HOH 79 279 104 HOH HOH A . E 4 HOH 80 280 35 HOH HOH A . E 4 HOH 81 281 99 HOH HOH A . E 4 HOH 82 282 6 HOH HOH A . E 4 HOH 83 283 159 HOH HOH A . E 4 HOH 84 284 37 HOH HOH A . E 4 HOH 85 285 65 HOH HOH A . E 4 HOH 86 286 139 HOH HOH A . E 4 HOH 87 287 79 HOH HOH A . E 4 HOH 88 288 128 HOH HOH A . E 4 HOH 89 289 106 HOH HOH A . E 4 HOH 90 290 53 HOH HOH A . E 4 HOH 91 291 164 HOH HOH A . E 4 HOH 92 292 135 HOH HOH A . E 4 HOH 93 293 161 HOH HOH A . E 4 HOH 94 294 157 HOH HOH A . E 4 HOH 95 295 154 HOH HOH A . E 4 HOH 96 296 64 HOH HOH A . E 4 HOH 97 297 117 HOH HOH A . E 4 HOH 98 298 124 HOH HOH A . E 4 HOH 99 299 146 HOH HOH A . E 4 HOH 100 300 34 HOH HOH A . E 4 HOH 101 301 97 HOH HOH A . E 4 HOH 102 302 26 HOH HOH A . E 4 HOH 103 303 71 HOH HOH A . E 4 HOH 104 304 21 HOH HOH A . E 4 HOH 105 305 119 HOH HOH A . E 4 HOH 106 306 112 HOH HOH A . E 4 HOH 107 307 134 HOH HOH A . E 4 HOH 108 308 140 HOH HOH A . E 4 HOH 109 309 132 HOH HOH A . E 4 HOH 110 310 137 HOH HOH A . E 4 HOH 111 311 54 HOH HOH A . E 4 HOH 112 312 165 HOH HOH A . E 4 HOH 113 313 156 HOH HOH A . E 4 HOH 114 314 84 HOH HOH A . E 4 HOH 115 315 158 HOH HOH A . E 4 HOH 116 316 172 HOH HOH A . E 4 HOH 117 317 94 HOH HOH A . E 4 HOH 118 318 28 HOH HOH A . E 4 HOH 119 319 12 HOH HOH A . E 4 HOH 120 320 114 HOH HOH A . E 4 HOH 121 321 111 HOH HOH A . E 4 HOH 122 322 141 HOH HOH A . E 4 HOH 123 323 14 HOH HOH A . E 4 HOH 124 324 116 HOH HOH A . E 4 HOH 125 325 74 HOH HOH A . E 4 HOH 126 326 22 HOH HOH A . E 4 HOH 127 327 138 HOH HOH A . E 4 HOH 128 328 40 HOH HOH A . E 4 HOH 129 329 142 HOH HOH A . E 4 HOH 130 330 171 HOH HOH A . E 4 HOH 131 331 170 HOH HOH A . E 4 HOH 132 332 173 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3560 ? 1 MORE -82 ? 1 'SSA (A^2)' 10290 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_667 -y+1,-x+1,-z+5/2 0.0000000000 -1.0000000000 0.0000000000 64.0460000000 -1.0000000000 0.0000000000 0.0000000000 64.0460000000 0.0000000000 0.0000000000 -1.0000000000 118.9075000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A B7I 103 ? D B7I . 2 1 A HOH 292 ? E HOH . 3 1 A HOH 294 ? E HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A GLU 22 ? A GLU 21 ? 1_555 101.2 ? 2 O ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ASP 24 ? A ASP 23 ? 1_555 79.7 ? 3 O ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ASP 24 ? A ASP 23 ? 1_555 85.9 ? 4 O ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A LYS 27 ? A LYS 26 ? 1_555 88.4 ? 5 O ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A LYS 27 ? A LYS 26 ? 1_555 164.1 ? 6 O ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A LYS 27 ? A LYS 26 ? 1_555 83.4 ? 7 O ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 103.9 ? 8 O ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 112.9 ? 9 O ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 159.2 ? 10 O ? A LYS 27 ? A LYS 26 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 76.3 ? 11 O ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 78.3 ? 12 O ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 75.0 ? 13 O ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 147.3 ? 14 O ? A LYS 27 ? A LYS 26 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 119.7 ? 15 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 51.8 ? 16 O ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 240 ? 1_555 169.7 ? 17 O ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 240 ? 1_555 83.1 ? 18 O ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 240 ? 1_555 91.3 ? 19 O ? A LYS 27 ? A LYS 26 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 240 ? 1_555 85.5 ? 20 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 240 ? 1_555 82.7 ? 21 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 240 ? 1_555 111.9 ? 22 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 83.2 ? 23 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 84.3 ? 24 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 83.5 ? 25 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A GLU 68 ? A GLU 67 ? 1_555 86.6 ? 26 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A GLU 68 ? A GLU 67 ? 1_555 160.7 ? 27 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A GLU 68 ? A GLU 67 ? 1_555 79.2 ? 28 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 115.9 ? 29 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 123.8 ? 30 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 146.1 ? 31 O ? A GLU 68 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 75.5 ? 32 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 88.4 ? 33 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 78.6 ? 34 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 161.3 ? 35 O ? A GLU 68 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 117.5 ? 36 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 52.0 ? 37 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 220 ? 1_555 160.4 ? 38 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 220 ? 1_555 83.5 ? 39 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 220 ? 1_555 80.0 ? 40 O ? A GLU 68 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 220 ? 1_555 101.8 ? 41 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 220 ? 1_555 83.5 ? 42 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 220 ? 1_555 103.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-01-20 2 'Structure model' 1 1 2016-02-10 3 'Structure model' 1 2 2017-09-27 4 'Structure model' 1 3 2019-12-04 5 'Structure model' 1 4 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' 6 4 'Structure model' 'Author supporting evidence' 7 4 'Structure model' 'Derived calculations' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' 10 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' pdbx_audit_support 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' software 5 4 'Structure model' pdbx_audit_support 6 4 'Structure model' pdbx_struct_special_symmetry 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' database_2 10 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_pdbx_audit_support.funding_organization' 3 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 4 3 'Structure model' '_software.classification' 5 4 'Structure model' '_pdbx_audit_support.funding_organization' 6 5 'Structure model' '_database_2.pdbx_DOI' 7 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.20 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 49 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 201 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.15 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 332 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.02 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id GLU _pdbx_unobs_or_zero_occ_residues.auth_seq_id 91 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id GLU _pdbx_unobs_or_zero_occ_residues.label_seq_id 92 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 B7I C01 C Y N 74 B7I C02 C Y N 75 B7I C03 C Y N 76 B7I C04 C Y N 77 B7I C05 C Y N 78 B7I C06 C Y N 79 B7I C07 C Y N 80 B7I C08 C Y N 81 B7I C09 C Y N 82 B7I C10 C Y N 83 B7I C11 C Y N 84 B7I C12 C Y N 85 B7I O13 O N N 86 B7I C14 C N N 87 B7I C15 C N N 88 B7I C16 C N N 89 B7I C17 C N N 90 B7I C18 C N N 91 B7I C19 C N N 92 B7I C20 C N N 93 B7I O21 O N N 94 B7I C22 C Y N 95 B7I C23 C Y N 96 B7I N24 N Y N 97 B7I C25 C Y N 98 B7I C26 C Y N 99 B7I N27 N Y N 100 B7I N28 N Y N 101 B7I C29 C Y N 102 B7I C30 C Y N 103 B7I N31 N Y N 104 B7I H1 H N N 105 B7I H2 H N N 106 B7I H3 H N N 107 B7I H4 H N N 108 B7I H5 H N N 109 B7I H6 H N N 110 B7I H7 H N N 111 B7I H8 H N N 112 B7I H9 H N N 113 B7I H10 H N N 114 B7I H11 H N N 115 B7I H12 H N N 116 B7I H13 H N N 117 B7I H14 H N N 118 B7I H15 H N N 119 B7I H16 H N N 120 B7I H17 H N N 121 B7I H18 H N N 122 B7I H19 H N N 123 B7I H20 H N N 124 B7I H21 H N N 125 B7I H22 H N N 126 B7I H23 H N N 127 B7I H24 H N N 128 B7I H25 H N N 129 B7I H27 H N N 130 B7I H28 H N N 131 B7I H29 H N N 132 CA CA CA N N 133 CYS N N N N 134 CYS CA C N R 135 CYS C C N N 136 CYS O O N N 137 CYS CB C N N 138 CYS SG S N N 139 CYS OXT O N N 140 CYS H H N N 141 CYS H2 H N N 142 CYS HA H N N 143 CYS HB2 H N N 144 CYS HB3 H N N 145 CYS HG H N N 146 CYS HXT H N N 147 GLN N N N N 148 GLN CA C N S 149 GLN C C N N 150 GLN O O N N 151 GLN CB C N N 152 GLN CG C N N 153 GLN CD C N N 154 GLN OE1 O N N 155 GLN NE2 N N N 156 GLN OXT O N N 157 GLN H H N N 158 GLN H2 H N N 159 GLN HA H N N 160 GLN HB2 H N N 161 GLN HB3 H N N 162 GLN HG2 H N N 163 GLN HG3 H N N 164 GLN HE21 H N N 165 GLN HE22 H N N 166 GLN HXT H N N 167 GLU N N N N 168 GLU CA C N S 169 GLU C C N N 170 GLU O O N N 171 GLU CB C N N 172 GLU CG C N N 173 GLU CD C N N 174 GLU OE1 O N N 175 GLU OE2 O N N 176 GLU OXT O N N 177 GLU H H N N 178 GLU H2 H N N 179 GLU HA H N N 180 GLU HB2 H N N 181 GLU HB3 H N N 182 GLU HG2 H N N 183 GLU HG3 H N N 184 GLU HE2 H N N 185 GLU HXT H N N 186 GLY N N N N 187 GLY CA C N N 188 GLY C C N N 189 GLY O O N N 190 GLY OXT O N N 191 GLY H H N N 192 GLY H2 H N N 193 GLY HA2 H N N 194 GLY HA3 H N N 195 GLY HXT H N N 196 HIS N N N N 197 HIS CA C N S 198 HIS C C N N 199 HIS O O N N 200 HIS CB C N N 201 HIS CG C Y N 202 HIS ND1 N Y N 203 HIS CD2 C Y N 204 HIS CE1 C Y N 205 HIS NE2 N Y N 206 HIS OXT O N N 207 HIS H H N N 208 HIS H2 H N N 209 HIS HA H N N 210 HIS HB2 H N N 211 HIS HB3 H N N 212 HIS HD1 H N N 213 HIS HD2 H N N 214 HIS HE1 H N N 215 HIS HE2 H N N 216 HIS HXT H N N 217 HOH O O N N 218 HOH H1 H N N 219 HOH H2 H N N 220 ILE N N N N 221 ILE CA C N S 222 ILE C C N N 223 ILE O O N N 224 ILE CB C N S 225 ILE CG1 C N N 226 ILE CG2 C N N 227 ILE CD1 C N N 228 ILE OXT O N N 229 ILE H H N N 230 ILE H2 H N N 231 ILE HA H N N 232 ILE HB H N N 233 ILE HG12 H N N 234 ILE HG13 H N N 235 ILE HG21 H N N 236 ILE HG22 H N N 237 ILE HG23 H N N 238 ILE HD11 H N N 239 ILE HD12 H N N 240 ILE HD13 H N N 241 ILE HXT H N N 242 LEU N N N N 243 LEU CA C N S 244 LEU C C N N 245 LEU O O N N 246 LEU CB C N N 247 LEU CG C N N 248 LEU CD1 C N N 249 LEU CD2 C N N 250 LEU OXT O N N 251 LEU H H N N 252 LEU H2 H N N 253 LEU HA H N N 254 LEU HB2 H N N 255 LEU HB3 H N N 256 LEU HG H N N 257 LEU HD11 H N N 258 LEU HD12 H N N 259 LEU HD13 H N N 260 LEU HD21 H N N 261 LEU HD22 H N N 262 LEU HD23 H N N 263 LEU HXT H N N 264 LYS N N N N 265 LYS CA C N S 266 LYS C C N N 267 LYS O O N N 268 LYS CB C N N 269 LYS CG C N N 270 LYS CD C N N 271 LYS CE C N N 272 LYS NZ N N N 273 LYS OXT O N N 274 LYS H H N N 275 LYS H2 H N N 276 LYS HA H N N 277 LYS HB2 H N N 278 LYS HB3 H N N 279 LYS HG2 H N N 280 LYS HG3 H N N 281 LYS HD2 H N N 282 LYS HD3 H N N 283 LYS HE2 H N N 284 LYS HE3 H N N 285 LYS HZ1 H N N 286 LYS HZ2 H N N 287 LYS HZ3 H N N 288 LYS HXT H N N 289 MET N N N N 290 MET CA C N S 291 MET C C N N 292 MET O O N N 293 MET CB C N N 294 MET CG C N N 295 MET SD S N N 296 MET CE C N N 297 MET OXT O N N 298 MET H H N N 299 MET H2 H N N 300 MET HA H N N 301 MET HB2 H N N 302 MET HB3 H N N 303 MET HG2 H N N 304 MET HG3 H N N 305 MET HE1 H N N 306 MET HE2 H N N 307 MET HE3 H N N 308 MET HXT H N N 309 PHE N N N N 310 PHE CA C N S 311 PHE C C N N 312 PHE O O N N 313 PHE CB C N N 314 PHE CG C Y N 315 PHE CD1 C Y N 316 PHE CD2 C Y N 317 PHE CE1 C Y N 318 PHE CE2 C Y N 319 PHE CZ C Y N 320 PHE OXT O N N 321 PHE H H N N 322 PHE H2 H N N 323 PHE HA H N N 324 PHE HB2 H N N 325 PHE HB3 H N N 326 PHE HD1 H N N 327 PHE HD2 H N N 328 PHE HE1 H N N 329 PHE HE2 H N N 330 PHE HZ H N N 331 PHE HXT H N N 332 SER N N N N 333 SER CA C N S 334 SER C C N N 335 SER O O N N 336 SER CB C N N 337 SER OG O N N 338 SER OXT O N N 339 SER H H N N 340 SER H2 H N N 341 SER HA H N N 342 SER HB2 H N N 343 SER HB3 H N N 344 SER HG H N N 345 SER HXT H N N 346 THR N N N N 347 THR CA C N S 348 THR C C N N 349 THR O O N N 350 THR CB C N R 351 THR OG1 O N N 352 THR CG2 C N N 353 THR OXT O N N 354 THR H H N N 355 THR H2 H N N 356 THR HA H N N 357 THR HB H N N 358 THR HG1 H N N 359 THR HG21 H N N 360 THR HG22 H N N 361 THR HG23 H N N 362 THR HXT H N N 363 TYR N N N N 364 TYR CA C N S 365 TYR C C N N 366 TYR O O N N 367 TYR CB C N N 368 TYR CG C Y N 369 TYR CD1 C Y N 370 TYR CD2 C Y N 371 TYR CE1 C Y N 372 TYR CE2 C Y N 373 TYR CZ C Y N 374 TYR OH O N N 375 TYR OXT O N N 376 TYR H H N N 377 TYR H2 H N N 378 TYR HA H N N 379 TYR HB2 H N N 380 TYR HB3 H N N 381 TYR HD1 H N N 382 TYR HD2 H N N 383 TYR HE1 H N N 384 TYR HE2 H N N 385 TYR HH H N N 386 TYR HXT H N N 387 VAL N N N N 388 VAL CA C N S 389 VAL C C N N 390 VAL O O N N 391 VAL CB C N N 392 VAL CG1 C N N 393 VAL CG2 C N N 394 VAL OXT O N N 395 VAL H H N N 396 VAL H2 H N N 397 VAL HA H N N 398 VAL HB H N N 399 VAL HG11 H N N 400 VAL HG12 H N N 401 VAL HG13 H N N 402 VAL HG21 H N N 403 VAL HG22 H N N 404 VAL HG23 H N N 405 VAL HXT H N N 406 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 B7I C29 C30 doub Y N 70 B7I C29 N28 sing Y N 71 B7I N24 C25 sing Y N 72 B7I N24 C22 sing Y N 73 B7I C30 N31 sing Y N 74 B7I C03 C04 doub Y N 75 B7I C03 C02 sing Y N 76 B7I C04 C05 sing Y N 77 B7I C25 C26 doub Y N 78 B7I N28 C23 sing Y N 79 B7I N31 C23 doub Y N 80 B7I C23 C10 sing N N 81 B7I C22 C02 sing N N 82 B7I C22 N27 doub Y N 83 B7I C02 C01 doub Y N 84 B7I C09 C10 doub Y N 85 B7I C09 C08 sing Y N 86 B7I C05 O13 sing N N 87 B7I C05 C06 doub Y N 88 B7I O13 C14 sing N N 89 B7I C10 C11 sing Y N 90 B7I C26 N27 sing Y N 91 B7I C08 C07 doub Y N 92 B7I C11 C12 doub Y N 93 B7I C01 C06 sing Y N 94 B7I C16 C15 sing N N 95 B7I C16 C17 sing N N 96 B7I C14 C15 sing N N 97 B7I C07 C12 sing Y N 98 B7I C07 O21 sing N N 99 B7I C19 C20 sing N N 100 B7I C19 C18 sing N N 101 B7I C20 O21 sing N N 102 B7I C17 C18 sing N N 103 B7I C01 H1 sing N N 104 B7I C03 H2 sing N N 105 B7I C04 H3 sing N N 106 B7I C06 H4 sing N N 107 B7I C08 H5 sing N N 108 B7I C09 H6 sing N N 109 B7I C11 H7 sing N N 110 B7I C12 H8 sing N N 111 B7I C14 H9 sing N N 112 B7I C14 H10 sing N N 113 B7I C15 H11 sing N N 114 B7I C15 H12 sing N N 115 B7I C16 H13 sing N N 116 B7I C16 H14 sing N N 117 B7I C17 H15 sing N N 118 B7I C17 H16 sing N N 119 B7I C18 H17 sing N N 120 B7I C18 H18 sing N N 121 B7I C19 H19 sing N N 122 B7I C19 H20 sing N N 123 B7I C20 H21 sing N N 124 B7I C20 H22 sing N N 125 B7I N24 H23 sing N N 126 B7I C25 H24 sing N N 127 B7I C26 H25 sing N N 128 B7I N28 H27 sing N N 129 B7I C29 H28 sing N N 130 B7I C30 H29 sing N N 131 CYS N CA sing N N 132 CYS N H sing N N 133 CYS N H2 sing N N 134 CYS CA C sing N N 135 CYS CA CB sing N N 136 CYS CA HA sing N N 137 CYS C O doub N N 138 CYS C OXT sing N N 139 CYS CB SG sing N N 140 CYS CB HB2 sing N N 141 CYS CB HB3 sing N N 142 CYS SG HG sing N N 143 CYS OXT HXT sing N N 144 GLN N CA sing N N 145 GLN N H sing N N 146 GLN N H2 sing N N 147 GLN CA C sing N N 148 GLN CA CB sing N N 149 GLN CA HA sing N N 150 GLN C O doub N N 151 GLN C OXT sing N N 152 GLN CB CG sing N N 153 GLN CB HB2 sing N N 154 GLN CB HB3 sing N N 155 GLN CG CD sing N N 156 GLN CG HG2 sing N N 157 GLN CG HG3 sing N N 158 GLN CD OE1 doub N N 159 GLN CD NE2 sing N N 160 GLN NE2 HE21 sing N N 161 GLN NE2 HE22 sing N N 162 GLN OXT HXT sing N N 163 GLU N CA sing N N 164 GLU N H sing N N 165 GLU N H2 sing N N 166 GLU CA C sing N N 167 GLU CA CB sing N N 168 GLU CA HA sing N N 169 GLU C O doub N N 170 GLU C OXT sing N N 171 GLU CB CG sing N N 172 GLU CB HB2 sing N N 173 GLU CB HB3 sing N N 174 GLU CG CD sing N N 175 GLU CG HG2 sing N N 176 GLU CG HG3 sing N N 177 GLU CD OE1 doub N N 178 GLU CD OE2 sing N N 179 GLU OE2 HE2 sing N N 180 GLU OXT HXT sing N N 181 GLY N CA sing N N 182 GLY N H sing N N 183 GLY N H2 sing N N 184 GLY CA C sing N N 185 GLY CA HA2 sing N N 186 GLY CA HA3 sing N N 187 GLY C O doub N N 188 GLY C OXT sing N N 189 GLY OXT HXT sing N N 190 HIS N CA sing N N 191 HIS N H sing N N 192 HIS N H2 sing N N 193 HIS CA C sing N N 194 HIS CA CB sing N N 195 HIS CA HA sing N N 196 HIS C O doub N N 197 HIS C OXT sing N N 198 HIS CB CG sing N N 199 HIS CB HB2 sing N N 200 HIS CB HB3 sing N N 201 HIS CG ND1 sing Y N 202 HIS CG CD2 doub Y N 203 HIS ND1 CE1 doub Y N 204 HIS ND1 HD1 sing N N 205 HIS CD2 NE2 sing Y N 206 HIS CD2 HD2 sing N N 207 HIS CE1 NE2 sing Y N 208 HIS CE1 HE1 sing N N 209 HIS NE2 HE2 sing N N 210 HIS OXT HXT sing N N 211 HOH O H1 sing N N 212 HOH O H2 sing N N 213 ILE N CA sing N N 214 ILE N H sing N N 215 ILE N H2 sing N N 216 ILE CA C sing N N 217 ILE CA CB sing N N 218 ILE CA HA sing N N 219 ILE C O doub N N 220 ILE C OXT sing N N 221 ILE CB CG1 sing N N 222 ILE CB CG2 sing N N 223 ILE CB HB sing N N 224 ILE CG1 CD1 sing N N 225 ILE CG1 HG12 sing N N 226 ILE CG1 HG13 sing N N 227 ILE CG2 HG21 sing N N 228 ILE CG2 HG22 sing N N 229 ILE CG2 HG23 sing N N 230 ILE CD1 HD11 sing N N 231 ILE CD1 HD12 sing N N 232 ILE CD1 HD13 sing N N 233 ILE OXT HXT sing N N 234 LEU N CA sing N N 235 LEU N H sing N N 236 LEU N H2 sing N N 237 LEU CA C sing N N 238 LEU CA CB sing N N 239 LEU CA HA sing N N 240 LEU C O doub N N 241 LEU C OXT sing N N 242 LEU CB CG sing N N 243 LEU CB HB2 sing N N 244 LEU CB HB3 sing N N 245 LEU CG CD1 sing N N 246 LEU CG CD2 sing N N 247 LEU CG HG sing N N 248 LEU CD1 HD11 sing N N 249 LEU CD1 HD12 sing N N 250 LEU CD1 HD13 sing N N 251 LEU CD2 HD21 sing N N 252 LEU CD2 HD22 sing N N 253 LEU CD2 HD23 sing N N 254 LEU OXT HXT sing N N 255 LYS N CA sing N N 256 LYS N H sing N N 257 LYS N H2 sing N N 258 LYS CA C sing N N 259 LYS CA CB sing N N 260 LYS CA HA sing N N 261 LYS C O doub N N 262 LYS C OXT sing N N 263 LYS CB CG sing N N 264 LYS CB HB2 sing N N 265 LYS CB HB3 sing N N 266 LYS CG CD sing N N 267 LYS CG HG2 sing N N 268 LYS CG HG3 sing N N 269 LYS CD CE sing N N 270 LYS CD HD2 sing N N 271 LYS CD HD3 sing N N 272 LYS CE NZ sing N N 273 LYS CE HE2 sing N N 274 LYS CE HE3 sing N N 275 LYS NZ HZ1 sing N N 276 LYS NZ HZ2 sing N N 277 LYS NZ HZ3 sing N N 278 LYS OXT HXT sing N N 279 MET N CA sing N N 280 MET N H sing N N 281 MET N H2 sing N N 282 MET CA C sing N N 283 MET CA CB sing N N 284 MET CA HA sing N N 285 MET C O doub N N 286 MET C OXT sing N N 287 MET CB CG sing N N 288 MET CB HB2 sing N N 289 MET CB HB3 sing N N 290 MET CG SD sing N N 291 MET CG HG2 sing N N 292 MET CG HG3 sing N N 293 MET SD CE sing N N 294 MET CE HE1 sing N N 295 MET CE HE2 sing N N 296 MET CE HE3 sing N N 297 MET OXT HXT sing N N 298 PHE N CA sing N N 299 PHE N H sing N N 300 PHE N H2 sing N N 301 PHE CA C sing N N 302 PHE CA CB sing N N 303 PHE CA HA sing N N 304 PHE C O doub N N 305 PHE C OXT sing N N 306 PHE CB CG sing N N 307 PHE CB HB2 sing N N 308 PHE CB HB3 sing N N 309 PHE CG CD1 doub Y N 310 PHE CG CD2 sing Y N 311 PHE CD1 CE1 sing Y N 312 PHE CD1 HD1 sing N N 313 PHE CD2 CE2 doub Y N 314 PHE CD2 HD2 sing N N 315 PHE CE1 CZ doub Y N 316 PHE CE1 HE1 sing N N 317 PHE CE2 CZ sing Y N 318 PHE CE2 HE2 sing N N 319 PHE CZ HZ sing N N 320 PHE OXT HXT sing N N 321 SER N CA sing N N 322 SER N H sing N N 323 SER N H2 sing N N 324 SER CA C sing N N 325 SER CA CB sing N N 326 SER CA HA sing N N 327 SER C O doub N N 328 SER C OXT sing N N 329 SER CB OG sing N N 330 SER CB HB2 sing N N 331 SER CB HB3 sing N N 332 SER OG HG sing N N 333 SER OXT HXT sing N N 334 THR N CA sing N N 335 THR N H sing N N 336 THR N H2 sing N N 337 THR CA C sing N N 338 THR CA CB sing N N 339 THR CA HA sing N N 340 THR C O doub N N 341 THR C OXT sing N N 342 THR CB OG1 sing N N 343 THR CB CG2 sing N N 344 THR CB HB sing N N 345 THR OG1 HG1 sing N N 346 THR CG2 HG21 sing N N 347 THR CG2 HG22 sing N N 348 THR CG2 HG23 sing N N 349 THR OXT HXT sing N N 350 TYR N CA sing N N 351 TYR N H sing N N 352 TYR N H2 sing N N 353 TYR CA C sing N N 354 TYR CA CB sing N N 355 TYR CA HA sing N N 356 TYR C O doub N N 357 TYR C OXT sing N N 358 TYR CB CG sing N N 359 TYR CB HB2 sing N N 360 TYR CB HB3 sing N N 361 TYR CG CD1 doub Y N 362 TYR CG CD2 sing Y N 363 TYR CD1 CE1 sing Y N 364 TYR CD1 HD1 sing N N 365 TYR CD2 CE2 doub Y N 366 TYR CD2 HD2 sing N N 367 TYR CE1 CZ doub Y N 368 TYR CE1 HE1 sing N N 369 TYR CE2 CZ sing Y N 370 TYR CE2 HE2 sing N N 371 TYR CZ OH sing N N 372 TYR OH HH sing N N 373 TYR OXT HXT sing N N 374 VAL N CA sing N N 375 VAL N H sing N N 376 VAL N H2 sing N N 377 VAL CA C sing N N 378 VAL CA CB sing N N 379 VAL CA HA sing N N 380 VAL C O doub N N 381 VAL C OXT sing N N 382 VAL CB CG1 sing N N 383 VAL CB CG2 sing N N 384 VAL CB HB sing N N 385 VAL CG1 HG11 sing N N 386 VAL CG1 HG12 sing N N 387 VAL CG1 HG13 sing N N 388 VAL CG2 HG21 sing N N 389 VAL CG2 HG22 sing N N 390 VAL CG2 HG23 sing N N 391 VAL OXT HXT sing N N 392 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' CA154274 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM58888 2 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' CA107331 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 "2,2'-[heptane-1,7-diylbis(oxybenzene-4,1-diyl)]bis(1H-imidazole)" B7I 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1MHO _pdbx_initial_refinement_model.details ? #