data_5FFS # _entry.id 5FFS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.320 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5FFS WWPDB D_1000216519 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5FFR PDB . unspecified 5FFT PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5FFS _pdbx_database_status.recvd_initial_deposition_date 2015-12-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Goh, B.C.' 1 'Wu, H.' 2 'Rynkiewicz, M.J.' 3 'Schulten, K.' 4 'Seaton, B.A.' 5 'McCormack, F.X.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 55 _citation.language ? _citation.page_first 3692 _citation.page_last 3701 _citation.title ;Elucidation of Lipid Binding Sites on Lung Surfactant Protein A Using X-ray Crystallography, Mutagenesis, and Molecular Dynamics Simulations. ; _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.6b00048 _citation.pdbx_database_id_PubMed 27324153 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Goh, B.C.' 1 ? primary 'Wu, H.' 2 ? primary 'Rynkiewicz, M.J.' 3 ? primary 'Schulten, K.' 4 ? primary 'Seaton, B.A.' 5 ? primary 'McCormack, F.X.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5FFS _cell.details ? _cell.formula_units_Z ? _cell.length_a 97.162 _cell.length_a_esd ? _cell.length_b 97.162 _cell.length_b_esd ? _cell.length_c 44.960 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5FFS _symmetry.cell_setting ? _symmetry.Int_Tables_number 173 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Pulmonary surfactant-associated protein A' 16628.484 1 ? N187S/Y164A 'neck and carbohydrate recognition domain' ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 water nat water 18.015 138 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name SP-A # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;AYLDEELQTELYEIKHQILQT(SME)GVLSLQGS(SME)LSVGDKVFSTNGQSVNFDTIKEMCTRAGGNIAVPRTPEENE AIASIAKKYNNAVYLG(SME)IEDQTPGDFHYLDGASVSYTNWYPGEPRGQGKEKCVEMYTDGTWNDRGCLQYRLAVCEF ; _entity_poly.pdbx_seq_one_letter_code_can ;AYLDEELQTELYEIKHQILQTMGVLSLQGSMLSVGDKVFSTNGQSVNFDTIKEMCTRAGGNIAVPRTPEENEAIASIAKK YNNAVYLGMIEDQTPGDFHYLDGASVSYTNWYPGEPRGQGKEKCVEMYTDGTWNDRGCLQYRLAVCEF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 TYR n 1 3 LEU n 1 4 ASP n 1 5 GLU n 1 6 GLU n 1 7 LEU n 1 8 GLN n 1 9 THR n 1 10 GLU n 1 11 LEU n 1 12 TYR n 1 13 GLU n 1 14 ILE n 1 15 LYS n 1 16 HIS n 1 17 GLN n 1 18 ILE n 1 19 LEU n 1 20 GLN n 1 21 THR n 1 22 SME n 1 23 GLY n 1 24 VAL n 1 25 LEU n 1 26 SER n 1 27 LEU n 1 28 GLN n 1 29 GLY n 1 30 SER n 1 31 SME n 1 32 LEU n 1 33 SER n 1 34 VAL n 1 35 GLY n 1 36 ASP n 1 37 LYS n 1 38 VAL n 1 39 PHE n 1 40 SER n 1 41 THR n 1 42 ASN n 1 43 GLY n 1 44 GLN n 1 45 SER n 1 46 VAL n 1 47 ASN n 1 48 PHE n 1 49 ASP n 1 50 THR n 1 51 ILE n 1 52 LYS n 1 53 GLU n 1 54 MET n 1 55 CYS n 1 56 THR n 1 57 ARG n 1 58 ALA n 1 59 GLY n 1 60 GLY n 1 61 ASN n 1 62 ILE n 1 63 ALA n 1 64 VAL n 1 65 PRO n 1 66 ARG n 1 67 THR n 1 68 PRO n 1 69 GLU n 1 70 GLU n 1 71 ASN n 1 72 GLU n 1 73 ALA n 1 74 ILE n 1 75 ALA n 1 76 SER n 1 77 ILE n 1 78 ALA n 1 79 LYS n 1 80 LYS n 1 81 TYR n 1 82 ASN n 1 83 ASN n 1 84 ALA n 1 85 VAL n 1 86 TYR n 1 87 LEU n 1 88 GLY n 1 89 SME n 1 90 ILE n 1 91 GLU n 1 92 ASP n 1 93 GLN n 1 94 THR n 1 95 PRO n 1 96 GLY n 1 97 ASP n 1 98 PHE n 1 99 HIS n 1 100 TYR n 1 101 LEU n 1 102 ASP n 1 103 GLY n 1 104 ALA n 1 105 SER n 1 106 VAL n 1 107 SER n 1 108 TYR n 1 109 THR n 1 110 ASN n 1 111 TRP n 1 112 TYR n 1 113 PRO n 1 114 GLY n 1 115 GLU n 1 116 PRO n 1 117 ARG n 1 118 GLY n 1 119 GLN n 1 120 GLY n 1 121 LYS n 1 122 GLU n 1 123 LYS n 1 124 CYS n 1 125 VAL n 1 126 GLU n 1 127 MET n 1 128 TYR n 1 129 THR n 1 130 ASP n 1 131 GLY n 1 132 THR n 1 133 TRP n 1 134 ASN n 1 135 ASP n 1 136 ARG n 1 137 GLY n 1 138 CYS n 1 139 LEU n 1 140 GLN n 1 141 TYR n 1 142 ARG n 1 143 LEU n 1 144 ALA n 1 145 VAL n 1 146 CYS n 1 147 GLU n 1 148 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 148 _entity_src_gen.gene_src_common_name Rat _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Sftpa1, Sftp-1, Sftp1, Sftpa' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Trichoplusia ni' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7111 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PVL 1392' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SFTPA_RAT _struct_ref.pdbx_db_accession P08427 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AYLDEELQTELYEIKHQILQTMGVLSLQGSMLSVGDKVFSTNGQSVNFDTIKEMCTRAGGNIAVPRTPEENEAIASIAKK YNNYVYLGMIEDQTPGDFHYLDGASVNYTNWYPGEPRGQGKEKCVEMYTDGTWNDRGCLQYRLAVCEF ; _struct_ref.pdbx_align_begin 101 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5FFS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 148 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P08427 _struct_ref_seq.db_align_beg 101 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 248 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 81 _struct_ref_seq.pdbx_auth_seq_align_end 228 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5FFS ALA A 84 ? UNP P08427 TYR 184 'engineered mutation' 164 1 1 5FFS SER A 107 ? UNP P08427 ASN 207 'engineered mutation' 187 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SME 'L-peptide linking' n 'METHIONINE SULFOXIDE' ? 'C5 H11 N O3 S' 165.211 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5FFS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.68 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 66.61 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Crystals were grown in hanging drops over reservoirs containing 10 mM sodium cacodylate (pH 6.0), 10 mM calcium acetate, and 10% (w/v) PEG 20,000 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-07-12 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU RU300' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 27.120 _reflns.entry_id 5FFS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.700 _reflns.d_resolution_low 90.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 26014 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.600 _reflns.pdbx_Rmerge_I_obs 0.027 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 40.621 _reflns.pdbx_netI_over_sigmaI 45.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.065 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 120336 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.700 1.760 ? ? ? ? ? 1963 ? 74.100 ? ? ? ? 0.228 ? ? ? ? ? ? ? ? 1.800 ? 1.463 ? ? ? ? 0 1 1 ? ? 1.760 1.830 ? ? ? ? ? 2586 ? 97.700 ? ? ? ? 0.181 ? ? ? ? ? ? ? ? 2.500 ? 1.481 ? ? ? ? 0 2 1 ? ? 1.830 1.910 ? ? ? ? ? 2692 ? 100.000 ? ? ? ? 0.141 ? ? ? ? ? ? ? ? 4.500 ? 1.210 ? ? ? ? 0 3 1 ? ? 1.910 2.020 ? ? ? ? ? 2670 ? 100.000 ? ? ? ? 0.100 ? ? ? ? ? ? ? ? 5.200 ? 1.109 ? ? ? ? 0 4 1 ? ? 2.020 2.140 ? ? ? ? ? 2693 ? 100.000 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 5.200 ? 1.152 ? ? ? ? 0 5 1 ? ? 2.140 2.310 ? ? ? ? ? 2661 ? 100.000 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 5.200 ? 1.145 ? ? ? ? 0 6 1 ? ? 2.310 2.540 ? ? ? ? ? 2693 ? 99.900 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? 5.300 ? 1.105 ? ? ? ? 0 7 1 ? ? 2.540 2.910 ? ? ? ? ? 2683 ? 99.900 ? ? ? ? 0.030 ? ? ? ? ? ? ? ? 5.300 ? 0.942 ? ? ? ? 0 8 1 ? ? 2.910 3.660 ? ? ? ? ? 2700 ? 99.500 ? ? ? ? 0.022 ? ? ? ? ? ? ? ? 5.300 ? 0.718 ? ? ? ? 0 9 1 ? ? 3.662 90.000 ? ? ? ? ? 2673 ? 95.800 ? ? ? ? 0.020 ? ? ? ? ? ? ? ? 5.100 ? 0.977 ? ? ? ? 0 10 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 168.110 _refine.B_iso_mean 30.7000 _refine.B_iso_min 12.590 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5FFS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.8000 _refine.ls_d_res_low 14.6450 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22321 _refine.ls_number_reflns_R_free 1707 _refine.ls_number_reflns_R_work 20614 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.7000 _refine.ls_percent_reflns_R_free 7.6500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1635 _refine.ls_R_factor_R_free 0.1795 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1620 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 17.1500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.8970 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.8000 _refine_hist.d_res_low 14.6450 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 138 _refine_hist.number_atoms_total 1270 _refine_hist.pdbx_number_residues_total 144 _refine_hist.pdbx_B_iso_mean_ligand 22.37 _refine_hist.pdbx_B_iso_mean_solvent 36.93 _refine_hist.pdbx_number_atoms_protein 1131 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1187 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.226 ? 1614 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.077 ? 173 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 213 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.192 ? 439 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8001 1.8530 1765 . 130 1635 95.0000 . . . 0.2398 . 0.2099 . . . . . . 12 . . . 'X-RAY DIFFRACTION' 1.8530 1.9126 1855 . 142 1713 98.0000 . . . 0.2302 . 0.1712 . . . . . . 12 . . . 'X-RAY DIFFRACTION' 1.9126 1.9808 1847 . 141 1706 99.0000 . . . 0.2155 . 0.1723 . . . . . . 12 . . . 'X-RAY DIFFRACTION' 1.9808 2.0599 1844 . 141 1703 99.0000 . . . 0.1872 . 0.1691 . . . . . . 12 . . . 'X-RAY DIFFRACTION' 2.0599 2.1534 1864 . 145 1719 99.0000 . . . 0.1786 . 0.1442 . . . . . . 12 . . . 'X-RAY DIFFRACTION' 2.1534 2.2666 1859 . 141 1718 100.0000 . . . 0.1805 . 0.1543 . . . . . . 12 . . . 'X-RAY DIFFRACTION' 2.2666 2.4080 1876 . 142 1734 100.0000 . . . 0.1737 . 0.1646 . . . . . . 12 . . . 'X-RAY DIFFRACTION' 2.4080 2.5930 1883 . 146 1737 100.0000 . . . 0.2279 . 0.1638 . . . . . . 12 . . . 'X-RAY DIFFRACTION' 2.5930 2.8522 1883 . 145 1738 100.0000 . . . 0.2011 . 0.1696 . . . . . . 12 . . . 'X-RAY DIFFRACTION' 2.8522 3.2609 1879 . 141 1738 100.0000 . . . 0.1735 . 0.1717 . . . . . . 12 . . . 'X-RAY DIFFRACTION' 3.2609 4.0935 1889 . 150 1739 99.0000 . . . 0.1950 . 0.1566 . . . . . . 12 . . . 'X-RAY DIFFRACTION' 4.0935 14.6458 1877 . 143 1734 97.0000 . . . 0.1359 . 0.1539 . . . . . . 12 . . . # _struct.entry_id 5FFS _struct.title 'Crystal Structure of Surfactant Protein-A Y164A Mutant' _struct.pdbx_descriptor 'Pulmonary surfactant-associated protein A' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5FFS _struct_keywords.text 'COLLECTIN, CARBOHYDRATE BINDING, LECTIN, LIPID BINDING, SUGAR BINDING PROTEIN' _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 5 ? GLN A 28 ? GLU A 85 GLN A 108 1 ? 24 HELX_P HELX_P2 AA2 ASN A 47 ? ALA A 58 ? ASN A 127 ALA A 138 1 ? 12 HELX_P HELX_P3 AA3 THR A 67 ? ASN A 82 ? THR A 147 ASN A 162 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 55 SG ? ? ? 1_555 A CYS 146 SG ? ? A CYS 135 A CYS 226 1_555 ? ? ? ? ? ? ? 2.030 ? disulf2 disulf ? ? A CYS 124 SG ? ? ? 1_555 A CYS 138 SG ? ? A CYS 204 A CYS 218 1_555 ? ? ? ? ? ? ? 2.035 ? covale1 covale both ? A THR 21 C ? ? ? 1_555 A SME 22 N ? ? A THR 101 A SME 102 1_555 ? ? ? ? ? ? ? 1.330 ? covale2 covale both ? A SME 22 C ? ? ? 1_555 A GLY 23 N ? ? A SME 102 A GLY 103 1_555 ? ? ? ? ? ? ? 1.332 ? covale3 covale both ? A SER 30 C ? ? ? 1_555 A SME 31 N ? ? A SER 110 A SME 111 1_555 ? ? ? ? ? ? ? 1.329 ? covale4 covale both ? A SME 31 C ? ? ? 1_555 A LEU 32 N ? ? A SME 111 A LEU 112 1_555 ? ? ? ? ? ? ? 1.332 ? covale5 covale both ? A GLY 88 C ? ? ? 1_555 A SME 89 N ? ? A GLY 168 A SME 169 1_555 ? ? ? ? ? ? ? 1.331 ? covale6 covale both ? A SME 89 C ? ? ? 1_555 A ILE 90 N ? ? A SME 169 A ILE 170 1_555 ? ? ? ? ? ? ? 1.331 ? metalc1 metalc ? ? A GLU 115 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 195 A CA 300 1_555 ? ? ? ? ? ? ? 2.512 ? metalc2 metalc ? ? A GLU 122 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 202 A CA 300 1_555 ? ? ? ? ? ? ? 2.427 ? metalc3 metalc ? ? A ASN 134 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 214 A CA 300 1_555 ? ? ? ? ? ? ? 2.354 ? metalc4 metalc ? ? A ASP 135 O ? ? ? 1_555 B CA . CA ? ? A ASP 215 A CA 300 1_555 ? ? ? ? ? ? ? 2.380 ? metalc5 metalc ? ? A ASP 135 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 215 A CA 300 1_555 ? ? ? ? ? ? ? 2.290 ? metalc6 metalc ? ? B CA . CA ? ? ? 1_555 C HOH . O ? ? A CA 300 A HOH 417 1_555 ? ? ? ? ? ? ? 2.495 ? metalc7 metalc ? ? B CA . CA ? ? ? 1_555 C HOH . O ? ? A CA 300 A HOH 438 1_555 ? ? ? ? ? ? ? 2.409 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 115 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 195 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 116 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 196 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.06 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 32 ? VAL A 34 ? LEU A 112 VAL A 114 AA1 2 LYS A 37 ? VAL A 46 ? LYS A 117 VAL A 126 AA1 3 ARG A 142 ? PHE A 148 ? ARG A 222 PHE A 228 AA1 4 ASN A 61 ? ILE A 62 ? ASN A 141 ILE A 142 AA2 1 PHE A 98 ? TYR A 100 ? PHE A 178 TYR A 180 AA2 2 VAL A 85 ? GLU A 91 ? VAL A 165 GLU A 171 AA2 3 CYS A 124 ? MET A 127 ? CYS A 204 MET A 207 AA2 4 TRP A 133 ? ARG A 136 ? TRP A 213 ARG A 216 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 32 ? N LEU A 112 O PHE A 39 ? O PHE A 119 AA1 2 3 N SER A 40 ? N SER A 120 O CYS A 146 ? O CYS A 226 AA1 3 4 O GLU A 147 ? O GLU A 227 N ASN A 61 ? N ASN A 141 AA2 1 2 O HIS A 99 ? O HIS A 179 N ILE A 90 ? N ILE A 170 AA2 2 3 N LEU A 87 ? N LEU A 167 O VAL A 125 ? O VAL A 205 AA2 3 4 N GLU A 126 ? N GLU A 206 O ASN A 134 ? O ASN A 214 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CA _struct_site.pdbx_auth_seq_id 300 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'binding site for residue CA A 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 115 ? GLU A 195 . ? 1_555 ? 2 AC1 6 GLU A 122 ? GLU A 202 . ? 1_555 ? 3 AC1 6 ASN A 134 ? ASN A 214 . ? 1_555 ? 4 AC1 6 ASP A 135 ? ASP A 215 . ? 1_555 ? 5 AC1 6 HOH C . ? HOH A 417 . ? 1_555 ? 6 AC1 6 HOH C . ? HOH A 438 . ? 1_555 ? # _atom_sites.entry_id 5FFS _atom_sites.fract_transf_matrix[1][1] 0.010292 _atom_sites.fract_transf_matrix[1][2] 0.005942 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011884 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022242 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 81 ? ? ? A . n A 1 2 TYR 2 82 ? ? ? A . n A 1 3 LEU 3 83 ? ? ? A . n A 1 4 ASP 4 84 ? ? ? A . n A 1 5 GLU 5 85 85 GLU GLU A . n A 1 6 GLU 6 86 86 GLU GLU A . n A 1 7 LEU 7 87 87 LEU LEU A . n A 1 8 GLN 8 88 88 GLN GLN A . n A 1 9 THR 9 89 89 THR THR A . n A 1 10 GLU 10 90 90 GLU GLU A . n A 1 11 LEU 11 91 91 LEU LEU A . n A 1 12 TYR 12 92 92 TYR TYR A . n A 1 13 GLU 13 93 93 GLU GLU A . n A 1 14 ILE 14 94 94 ILE ILE A . n A 1 15 LYS 15 95 95 LYS LYS A . n A 1 16 HIS 16 96 96 HIS HIS A . n A 1 17 GLN 17 97 97 GLN GLN A . n A 1 18 ILE 18 98 98 ILE ILE A . n A 1 19 LEU 19 99 99 LEU LEU A . n A 1 20 GLN 20 100 100 GLN GLN A . n A 1 21 THR 21 101 101 THR THR A . n A 1 22 SME 22 102 102 SME SME A . n A 1 23 GLY 23 103 103 GLY GLY A . n A 1 24 VAL 24 104 104 VAL VAL A . n A 1 25 LEU 25 105 105 LEU LEU A . n A 1 26 SER 26 106 106 SER SER A . n A 1 27 LEU 27 107 107 LEU LEU A . n A 1 28 GLN 28 108 108 GLN GLN A . n A 1 29 GLY 29 109 109 GLY GLY A . n A 1 30 SER 30 110 110 SER SER A . n A 1 31 SME 31 111 111 SME SME A . n A 1 32 LEU 32 112 112 LEU LEU A . n A 1 33 SER 33 113 113 SER SER A . n A 1 34 VAL 34 114 114 VAL VAL A . n A 1 35 GLY 35 115 115 GLY GLY A . n A 1 36 ASP 36 116 116 ASP ASP A . n A 1 37 LYS 37 117 117 LYS LYS A . n A 1 38 VAL 38 118 118 VAL VAL A . n A 1 39 PHE 39 119 119 PHE PHE A . n A 1 40 SER 40 120 120 SER SER A . n A 1 41 THR 41 121 121 THR THR A . n A 1 42 ASN 42 122 122 ASN ASN A . n A 1 43 GLY 43 123 123 GLY GLY A . n A 1 44 GLN 44 124 124 GLN GLN A . n A 1 45 SER 45 125 125 SER SER A . n A 1 46 VAL 46 126 126 VAL VAL A . n A 1 47 ASN 47 127 127 ASN ASN A . n A 1 48 PHE 48 128 128 PHE PHE A . n A 1 49 ASP 49 129 129 ASP ASP A . n A 1 50 THR 50 130 130 THR THR A . n A 1 51 ILE 51 131 131 ILE ILE A . n A 1 52 LYS 52 132 132 LYS LYS A . n A 1 53 GLU 53 133 133 GLU GLU A . n A 1 54 MET 54 134 134 MET MET A . n A 1 55 CYS 55 135 135 CYS CYS A . n A 1 56 THR 56 136 136 THR THR A . n A 1 57 ARG 57 137 137 ARG ARG A . n A 1 58 ALA 58 138 138 ALA ALA A . n A 1 59 GLY 59 139 139 GLY GLY A . n A 1 60 GLY 60 140 140 GLY GLY A . n A 1 61 ASN 61 141 141 ASN ASN A . n A 1 62 ILE 62 142 142 ILE ILE A . n A 1 63 ALA 63 143 143 ALA ALA A . n A 1 64 VAL 64 144 144 VAL VAL A . n A 1 65 PRO 65 145 145 PRO PRO A . n A 1 66 ARG 66 146 146 ARG ARG A . n A 1 67 THR 67 147 147 THR THR A . n A 1 68 PRO 68 148 148 PRO PRO A . n A 1 69 GLU 69 149 149 GLU GLU A . n A 1 70 GLU 70 150 150 GLU GLU A . n A 1 71 ASN 71 151 151 ASN ASN A . n A 1 72 GLU 72 152 152 GLU GLU A . n A 1 73 ALA 73 153 153 ALA ALA A . n A 1 74 ILE 74 154 154 ILE ILE A . n A 1 75 ALA 75 155 155 ALA ALA A . n A 1 76 SER 76 156 156 SER SER A . n A 1 77 ILE 77 157 157 ILE ILE A . n A 1 78 ALA 78 158 158 ALA ALA A . n A 1 79 LYS 79 159 159 LYS LYS A . n A 1 80 LYS 80 160 160 LYS LYS A . n A 1 81 TYR 81 161 161 TYR TYR A . n A 1 82 ASN 82 162 162 ASN ASN A . n A 1 83 ASN 83 163 163 ASN ASN A . n A 1 84 ALA 84 164 164 ALA ALA A . n A 1 85 VAL 85 165 165 VAL VAL A . n A 1 86 TYR 86 166 166 TYR TYR A . n A 1 87 LEU 87 167 167 LEU LEU A . n A 1 88 GLY 88 168 168 GLY GLY A . n A 1 89 SME 89 169 169 SME SME A . n A 1 90 ILE 90 170 170 ILE ILE A . n A 1 91 GLU 91 171 171 GLU GLU A . n A 1 92 ASP 92 172 172 ASP ASP A . n A 1 93 GLN 93 173 173 GLN GLN A . n A 1 94 THR 94 174 174 THR THR A . n A 1 95 PRO 95 175 175 PRO PRO A . n A 1 96 GLY 96 176 176 GLY GLY A . n A 1 97 ASP 97 177 177 ASP ASP A . n A 1 98 PHE 98 178 178 PHE PHE A . n A 1 99 HIS 99 179 179 HIS HIS A . n A 1 100 TYR 100 180 180 TYR TYR A . n A 1 101 LEU 101 181 181 LEU LEU A . n A 1 102 ASP 102 182 182 ASP ASP A . n A 1 103 GLY 103 183 183 GLY GLY A . n A 1 104 ALA 104 184 184 ALA ALA A . n A 1 105 SER 105 185 185 SER SER A . n A 1 106 VAL 106 186 186 VAL VAL A . n A 1 107 SER 107 187 187 SER SER A . n A 1 108 TYR 108 188 188 TYR TYR A . n A 1 109 THR 109 189 189 THR THR A . n A 1 110 ASN 110 190 190 ASN ASN A . n A 1 111 TRP 111 191 191 TRP TRP A . n A 1 112 TYR 112 192 192 TYR TYR A . n A 1 113 PRO 113 193 193 PRO PRO A . n A 1 114 GLY 114 194 194 GLY GLY A . n A 1 115 GLU 115 195 195 GLU GLU A . n A 1 116 PRO 116 196 196 PRO PRO A . n A 1 117 ARG 117 197 197 ARG ARG A . n A 1 118 GLY 118 198 198 GLY GLY A . n A 1 119 GLN 119 199 199 GLN GLN A . n A 1 120 GLY 120 200 200 GLY GLY A . n A 1 121 LYS 121 201 201 LYS LYS A . n A 1 122 GLU 122 202 202 GLU GLU A . n A 1 123 LYS 123 203 203 LYS LYS A . n A 1 124 CYS 124 204 204 CYS CYS A . n A 1 125 VAL 125 205 205 VAL VAL A . n A 1 126 GLU 126 206 206 GLU GLU A . n A 1 127 MET 127 207 207 MET MET A . n A 1 128 TYR 128 208 208 TYR TYR A . n A 1 129 THR 129 209 209 THR THR A . n A 1 130 ASP 130 210 210 ASP ASP A . n A 1 131 GLY 131 211 211 GLY GLY A . n A 1 132 THR 132 212 212 THR THR A . n A 1 133 TRP 133 213 213 TRP TRP A . n A 1 134 ASN 134 214 214 ASN ASN A . n A 1 135 ASP 135 215 215 ASP ASP A . n A 1 136 ARG 136 216 216 ARG ARG A . n A 1 137 GLY 137 217 217 GLY GLY A . n A 1 138 CYS 138 218 218 CYS CYS A . n A 1 139 LEU 139 219 219 LEU LEU A . n A 1 140 GLN 140 220 220 GLN GLN A . n A 1 141 TYR 141 221 221 TYR TYR A . n A 1 142 ARG 142 222 222 ARG ARG A . n A 1 143 LEU 143 223 223 LEU LEU A . n A 1 144 ALA 144 224 224 ALA ALA A . n A 1 145 VAL 145 225 225 VAL VAL A . n A 1 146 CYS 146 226 226 CYS CYS A . n A 1 147 GLU 147 227 227 GLU GLU A . n A 1 148 PHE 148 228 228 PHE PHE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 300 300 CA CA A . C 3 HOH 1 401 77 HOH HOH A . C 3 HOH 2 402 86 HOH HOH A . C 3 HOH 3 403 66 HOH HOH A . C 3 HOH 4 404 149 HOH HOH A . C 3 HOH 5 405 28 HOH HOH A . C 3 HOH 6 406 60 HOH HOH A . C 3 HOH 7 407 166 HOH HOH A . C 3 HOH 8 408 33 HOH HOH A . C 3 HOH 9 409 136 HOH HOH A . C 3 HOH 10 410 93 HOH HOH A . C 3 HOH 11 411 29 HOH HOH A . C 3 HOH 12 412 102 HOH HOH A . C 3 HOH 13 413 63 HOH HOH A . C 3 HOH 14 414 170 HOH HOH A . C 3 HOH 15 415 46 HOH HOH A . C 3 HOH 16 416 37 HOH HOH A . C 3 HOH 17 417 2 HOH HOH A . C 3 HOH 18 418 32 HOH HOH A . C 3 HOH 19 419 131 HOH HOH A . C 3 HOH 20 420 44 HOH HOH A . C 3 HOH 21 421 132 HOH HOH A . C 3 HOH 22 422 3 HOH HOH A . C 3 HOH 23 423 20 HOH HOH A . C 3 HOH 24 424 135 HOH HOH A . C 3 HOH 25 425 17 HOH HOH A . C 3 HOH 26 426 48 HOH HOH A . C 3 HOH 27 427 25 HOH HOH A . C 3 HOH 28 428 34 HOH HOH A . C 3 HOH 29 429 90 HOH HOH A . C 3 HOH 30 430 22 HOH HOH A . C 3 HOH 31 431 172 HOH HOH A . C 3 HOH 32 432 100 HOH HOH A . C 3 HOH 33 433 96 HOH HOH A . C 3 HOH 34 434 38 HOH HOH A . C 3 HOH 35 435 27 HOH HOH A . C 3 HOH 36 436 39 HOH HOH A . C 3 HOH 37 437 24 HOH HOH A . C 3 HOH 38 438 4 HOH HOH A . C 3 HOH 39 439 58 HOH HOH A . C 3 HOH 40 440 129 HOH HOH A . C 3 HOH 41 441 158 HOH HOH A . C 3 HOH 42 442 152 HOH HOH A . C 3 HOH 43 443 133 HOH HOH A . C 3 HOH 44 444 11 HOH HOH A . C 3 HOH 45 445 128 HOH HOH A . C 3 HOH 46 446 21 HOH HOH A . C 3 HOH 47 447 130 HOH HOH A . C 3 HOH 48 448 35 HOH HOH A . C 3 HOH 49 449 118 HOH HOH A . C 3 HOH 50 450 19 HOH HOH A . C 3 HOH 51 451 106 HOH HOH A . C 3 HOH 52 452 5 HOH HOH A . C 3 HOH 53 453 1 HOH HOH A . C 3 HOH 54 454 16 HOH HOH A . C 3 HOH 55 455 30 HOH HOH A . C 3 HOH 56 456 147 HOH HOH A . C 3 HOH 57 457 13 HOH HOH A . C 3 HOH 58 458 82 HOH HOH A . C 3 HOH 59 459 42 HOH HOH A . C 3 HOH 60 460 148 HOH HOH A . C 3 HOH 61 461 23 HOH HOH A . C 3 HOH 62 462 31 HOH HOH A . C 3 HOH 63 463 89 HOH HOH A . C 3 HOH 64 464 8 HOH HOH A . C 3 HOH 65 465 121 HOH HOH A . C 3 HOH 66 466 138 HOH HOH A . C 3 HOH 67 467 84 HOH HOH A . C 3 HOH 68 468 10 HOH HOH A . C 3 HOH 69 469 173 HOH HOH A . C 3 HOH 70 470 75 HOH HOH A . C 3 HOH 71 471 115 HOH HOH A . C 3 HOH 72 472 14 HOH HOH A . C 3 HOH 73 473 134 HOH HOH A . C 3 HOH 74 474 47 HOH HOH A . C 3 HOH 75 475 15 HOH HOH A . C 3 HOH 76 476 67 HOH HOH A . C 3 HOH 77 477 87 HOH HOH A . C 3 HOH 78 478 108 HOH HOH A . C 3 HOH 79 479 76 HOH HOH A . C 3 HOH 80 480 52 HOH HOH A . C 3 HOH 81 481 120 HOH HOH A . C 3 HOH 82 482 164 HOH HOH A . C 3 HOH 83 483 156 HOH HOH A . C 3 HOH 84 484 143 HOH HOH A . C 3 HOH 85 485 79 HOH HOH A . C 3 HOH 86 486 142 HOH HOH A . C 3 HOH 87 487 62 HOH HOH A . C 3 HOH 88 488 139 HOH HOH A . C 3 HOH 89 489 12 HOH HOH A . C 3 HOH 90 490 127 HOH HOH A . C 3 HOH 91 491 168 HOH HOH A . C 3 HOH 92 492 36 HOH HOH A . C 3 HOH 93 493 165 HOH HOH A . C 3 HOH 94 494 40 HOH HOH A . C 3 HOH 95 495 69 HOH HOH A . C 3 HOH 96 496 43 HOH HOH A . C 3 HOH 97 497 146 HOH HOH A . C 3 HOH 98 498 80 HOH HOH A . C 3 HOH 99 499 99 HOH HOH A . C 3 HOH 100 500 175 HOH HOH A . C 3 HOH 101 501 18 HOH HOH A . C 3 HOH 102 502 101 HOH HOH A . C 3 HOH 103 503 144 HOH HOH A . C 3 HOH 104 504 137 HOH HOH A . C 3 HOH 105 505 140 HOH HOH A . C 3 HOH 106 506 176 HOH HOH A . C 3 HOH 107 507 174 HOH HOH A . C 3 HOH 108 508 61 HOH HOH A . C 3 HOH 109 509 150 HOH HOH A . C 3 HOH 110 510 45 HOH HOH A . C 3 HOH 111 511 65 HOH HOH A . C 3 HOH 112 512 167 HOH HOH A . C 3 HOH 113 513 154 HOH HOH A . C 3 HOH 114 514 112 HOH HOH A . C 3 HOH 115 515 105 HOH HOH A . C 3 HOH 116 516 53 HOH HOH A . C 3 HOH 117 517 97 HOH HOH A . C 3 HOH 118 518 160 HOH HOH A . C 3 HOH 119 519 162 HOH HOH A . C 3 HOH 120 520 70 HOH HOH A . C 3 HOH 121 521 153 HOH HOH A . C 3 HOH 122 522 51 HOH HOH A . C 3 HOH 123 523 163 HOH HOH A . C 3 HOH 124 524 171 HOH HOH A . C 3 HOH 125 525 157 HOH HOH A . C 3 HOH 126 526 68 HOH HOH A . C 3 HOH 127 527 57 HOH HOH A . C 3 HOH 128 528 145 HOH HOH A . C 3 HOH 129 529 161 HOH HOH A . C 3 HOH 130 530 151 HOH HOH A . C 3 HOH 131 531 107 HOH HOH A . C 3 HOH 132 532 169 HOH HOH A . C 3 HOH 133 533 83 HOH HOH A . C 3 HOH 134 534 159 HOH HOH A . C 3 HOH 135 535 155 HOH HOH A . C 3 HOH 136 536 55 HOH HOH A . C 3 HOH 137 537 125 HOH HOH A . C 3 HOH 138 538 109 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A SME 22 A SME 102 ? MET 'modified residue' 2 A SME 31 A SME 111 ? MET 'modified residue' 3 A SME 89 A SME 169 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4910 ? 1 MORE -73 ? 1 'SSA (A^2)' 20900 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -y+1,x-y,z -0.5000000000 -0.8660254038 0.0000000000 97.1620000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038 0.0000000000 48.5810000000 -0.8660254038 -0.5000000000 0.0000000000 84.1447602825 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 526 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 115 ? A GLU 195 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 OE1 ? A GLU 122 ? A GLU 202 ? 1_555 141.7 ? 2 OE1 ? A GLU 115 ? A GLU 195 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 OD1 ? A ASN 134 ? A ASN 214 ? 1_555 68.4 ? 3 OE1 ? A GLU 122 ? A GLU 202 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 OD1 ? A ASN 134 ? A ASN 214 ? 1_555 149.5 ? 4 OE1 ? A GLU 115 ? A GLU 195 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 O ? A ASP 135 ? A ASP 215 ? 1_555 127.9 ? 5 OE1 ? A GLU 122 ? A GLU 202 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 O ? A ASP 135 ? A ASP 215 ? 1_555 72.5 ? 6 OD1 ? A ASN 134 ? A ASN 214 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 O ? A ASP 135 ? A ASP 215 ? 1_555 82.9 ? 7 OE1 ? A GLU 115 ? A GLU 195 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 OD1 ? A ASP 135 ? A ASP 215 ? 1_555 71.3 ? 8 OE1 ? A GLU 122 ? A GLU 202 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 OD1 ? A ASP 135 ? A ASP 215 ? 1_555 85.9 ? 9 OD1 ? A ASN 134 ? A ASN 214 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 OD1 ? A ASP 135 ? A ASP 215 ? 1_555 106.1 ? 10 O ? A ASP 135 ? A ASP 215 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 OD1 ? A ASP 135 ? A ASP 215 ? 1_555 76.7 ? 11 OE1 ? A GLU 115 ? A GLU 195 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 O ? C HOH . ? A HOH 417 ? 1_555 137.3 ? 12 OE1 ? A GLU 122 ? A GLU 202 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 O ? C HOH . ? A HOH 417 ? 1_555 73.1 ? 13 OD1 ? A ASN 134 ? A ASN 214 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 O ? C HOH . ? A HOH 417 ? 1_555 84.1 ? 14 O ? A ASP 135 ? A ASP 215 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 O ? C HOH . ? A HOH 417 ? 1_555 77.0 ? 15 OD1 ? A ASP 135 ? A ASP 215 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 O ? C HOH . ? A HOH 417 ? 1_555 150.3 ? 16 OE1 ? A GLU 115 ? A GLU 195 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 O ? C HOH . ? A HOH 438 ? 1_555 77.2 ? 17 OE1 ? A GLU 122 ? A GLU 202 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 O ? C HOH . ? A HOH 438 ? 1_555 96.8 ? 18 OD1 ? A ASN 134 ? A ASN 214 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 O ? C HOH . ? A HOH 438 ? 1_555 96.1 ? 19 O ? A ASP 135 ? A ASP 215 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 O ? C HOH . ? A HOH 438 ? 1_555 150.9 ? 20 OD1 ? A ASP 135 ? A ASP 215 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 O ? C HOH . ? A HOH 438 ? 1_555 130.5 ? 21 O ? C HOH . ? A HOH 417 ? 1_555 CA ? B CA . ? A CA 300 ? 1_555 O ? C HOH . ? A HOH 438 ? 1_555 74.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-07-06 2 'Structure model' 1 1 2016-07-13 3 'Structure model' 1 2 2017-09-20 4 'Structure model' 1 3 2019-12-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Author supporting evidence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' pdbx_audit_support 3 3 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_pdbx_audit_support.funding_organization' 3 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 4 4 'Structure model' '_pdbx_audit_support.funding_organization' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 45.595 33.425 25.693 0.2146 0.1357 0.1398 0.0364 0.0096 0.0104 0.3451 0.0672 0.2246 0.0829 -0.1643 0.0306 0.0012 -0.0698 0.0043 0.0471 0.1325 -0.0999 -0.3214 -0.3126 0.1885 'X-RAY DIFFRACTION' 2 ? refined 71.612 32.980 40.148 0.1091 0.2028 0.1569 0.0052 -0.0194 -0.0103 1.4477 0.8315 1.0770 1.0473 0.4069 0.3676 0.1347 0.0142 0.1785 -0.0144 -0.2345 -0.1277 0.1170 0.1215 0.1957 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 87 A 109 '( CHAIN A AND RESID 87:109 )' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 110 A 228 '( CHAIN A AND RESID 110:228 )' ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 493 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 513 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.17 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 418 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 491 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_764 _pdbx_validate_symm_contact.dist 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 172 ? ? -64.28 -178.78 2 1 SER A 187 ? ? -106.03 -78.92 3 1 ASN A 190 ? ? -145.44 53.06 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 81 ? A ALA 1 2 1 Y 1 A TYR 82 ? A TYR 2 3 1 Y 1 A LEU 83 ? A LEU 3 4 1 Y 1 A ASP 84 ? A ASP 4 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number PO1AI0833222 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH #