data_5H60 # _entry.id 5H60 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.299 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5H60 WWPDB D_1300002098 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5H5Y PDB . unspecified 5H61 PDB . unspecified 5H62 PDB . unspecified 5H63 PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5H60 _pdbx_database_status.recvd_initial_deposition_date 2016-11-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Park, J.B.' 1 'Yoo, Y.' 2 'Kim, J.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 4283 _citation.page_last 4283 _citation.title 'Structural basis for arginine glycosylation of host substrates by bacterial effector proteins.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-018-06680-6 _citation.pdbx_database_id_PubMed 30327479 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Park, J.B.' 1 ? primary 'Kim, Y.H.' 2 ? primary 'Yoo, Y.' 3 ? primary 'Kim, J.' 4 ? primary 'Jun, S.H.' 5 ? primary 'Cho, J.W.' 6 ? primary 'El Qaidi, S.' 7 ? primary 'Walpole, S.' 8 ? primary 'Monaco, S.' 9 ? primary 'Garcia-Garcia, A.A.' 10 ? primary 'Wu, M.' 11 ? primary 'Hays, M.P.' 12 ? primary 'Hurtado-Guerrero, R.' 13 0000-0002-3122-9401 primary 'Angulo, J.' 14 0000-0001-7250-5639 primary 'Hardwidge, P.R.' 15 ? primary 'Shin, J.S.' 16 ? primary 'Cho, H.S.' 17 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5H60 _cell.details ? _cell.formula_units_Z ? _cell.length_a 115.940 _cell.length_a_esd ? _cell.length_b 115.940 _cell.length_b_esd ? _cell.length_c 100.080 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5H60 _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Transferase 38882.051 1 ? ? ? ? 2 non-polymer syn "URIDINE-5'-DIPHOSPHATE" 404.161 1 ? ? ? ? 3 non-polymer syn 'MANGANESE (II) ION' 54.938 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MIPPLNRYVPALSKNELVKTVTNRDIQFTSFNGKDYPLCFLDEKTPLLFQWFERNPARFGKNDIPIINTEKNPYLNNIIK AATIEKERLIGIFVDGDFFPGQKDAFSKLEYDYENIKVIYRNDIDFSMYDKKLSEIYMENISKQESMPEEKRDCHLLQLL KKELSDIQEGNDSLIKSYLLDKGHGWFDFYRNMAMLKAGQLFLEADKVGCYDLSTNSGCIYLDADMIITEKLGGIYIPDG IAVHVERIDGRASMENGIIAVDRNNHPALLAGLEIMHTKFDADPYSDGVCNGIRKHFNYSLNEDYNSFCDFIEFKHDNII MNTSQFTQSSWARHVQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MIPPLNRYVPALSKNELVKTVTNRDIQFTSFNGKDYPLCFLDEKTPLLFQWFERNPARFGKNDIPIINTEKNPYLNNIIK AATIEKERLIGIFVDGDFFPGQKDAFSKLEYDYENIKVIYRNDIDFSMYDKKLSEIYMENISKQESMPEEKRDCHLLQLL KKELSDIQEGNDSLIKSYLLDKGHGWFDFYRNMAMLKAGQLFLEADKVGCYDLSTNSGCIYLDADMIITEKLGGIYIPDG IAVHVERIDGRASMENGIIAVDRNNHPALLAGLEIMHTKFDADPYSDGVCNGIRKHFNYSLNEDYNSFCDFIEFKHDNII MNTSQFTQSSWARHVQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 PRO n 1 4 PRO n 1 5 LEU n 1 6 ASN n 1 7 ARG n 1 8 TYR n 1 9 VAL n 1 10 PRO n 1 11 ALA n 1 12 LEU n 1 13 SER n 1 14 LYS n 1 15 ASN n 1 16 GLU n 1 17 LEU n 1 18 VAL n 1 19 LYS n 1 20 THR n 1 21 VAL n 1 22 THR n 1 23 ASN n 1 24 ARG n 1 25 ASP n 1 26 ILE n 1 27 GLN n 1 28 PHE n 1 29 THR n 1 30 SER n 1 31 PHE n 1 32 ASN n 1 33 GLY n 1 34 LYS n 1 35 ASP n 1 36 TYR n 1 37 PRO n 1 38 LEU n 1 39 CYS n 1 40 PHE n 1 41 LEU n 1 42 ASP n 1 43 GLU n 1 44 LYS n 1 45 THR n 1 46 PRO n 1 47 LEU n 1 48 LEU n 1 49 PHE n 1 50 GLN n 1 51 TRP n 1 52 PHE n 1 53 GLU n 1 54 ARG n 1 55 ASN n 1 56 PRO n 1 57 ALA n 1 58 ARG n 1 59 PHE n 1 60 GLY n 1 61 LYS n 1 62 ASN n 1 63 ASP n 1 64 ILE n 1 65 PRO n 1 66 ILE n 1 67 ILE n 1 68 ASN n 1 69 THR n 1 70 GLU n 1 71 LYS n 1 72 ASN n 1 73 PRO n 1 74 TYR n 1 75 LEU n 1 76 ASN n 1 77 ASN n 1 78 ILE n 1 79 ILE n 1 80 LYS n 1 81 ALA n 1 82 ALA n 1 83 THR n 1 84 ILE n 1 85 GLU n 1 86 LYS n 1 87 GLU n 1 88 ARG n 1 89 LEU n 1 90 ILE n 1 91 GLY n 1 92 ILE n 1 93 PHE n 1 94 VAL n 1 95 ASP n 1 96 GLY n 1 97 ASP n 1 98 PHE n 1 99 PHE n 1 100 PRO n 1 101 GLY n 1 102 GLN n 1 103 LYS n 1 104 ASP n 1 105 ALA n 1 106 PHE n 1 107 SER n 1 108 LYS n 1 109 LEU n 1 110 GLU n 1 111 TYR n 1 112 ASP n 1 113 TYR n 1 114 GLU n 1 115 ASN n 1 116 ILE n 1 117 LYS n 1 118 VAL n 1 119 ILE n 1 120 TYR n 1 121 ARG n 1 122 ASN n 1 123 ASP n 1 124 ILE n 1 125 ASP n 1 126 PHE n 1 127 SER n 1 128 MET n 1 129 TYR n 1 130 ASP n 1 131 LYS n 1 132 LYS n 1 133 LEU n 1 134 SER n 1 135 GLU n 1 136 ILE n 1 137 TYR n 1 138 MET n 1 139 GLU n 1 140 ASN n 1 141 ILE n 1 142 SER n 1 143 LYS n 1 144 GLN n 1 145 GLU n 1 146 SER n 1 147 MET n 1 148 PRO n 1 149 GLU n 1 150 GLU n 1 151 LYS n 1 152 ARG n 1 153 ASP n 1 154 CYS n 1 155 HIS n 1 156 LEU n 1 157 LEU n 1 158 GLN n 1 159 LEU n 1 160 LEU n 1 161 LYS n 1 162 LYS n 1 163 GLU n 1 164 LEU n 1 165 SER n 1 166 ASP n 1 167 ILE n 1 168 GLN n 1 169 GLU n 1 170 GLY n 1 171 ASN n 1 172 ASP n 1 173 SER n 1 174 LEU n 1 175 ILE n 1 176 LYS n 1 177 SER n 1 178 TYR n 1 179 LEU n 1 180 LEU n 1 181 ASP n 1 182 LYS n 1 183 GLY n 1 184 HIS n 1 185 GLY n 1 186 TRP n 1 187 PHE n 1 188 ASP n 1 189 PHE n 1 190 TYR n 1 191 ARG n 1 192 ASN n 1 193 MET n 1 194 ALA n 1 195 MET n 1 196 LEU n 1 197 LYS n 1 198 ALA n 1 199 GLY n 1 200 GLN n 1 201 LEU n 1 202 PHE n 1 203 LEU n 1 204 GLU n 1 205 ALA n 1 206 ASP n 1 207 LYS n 1 208 VAL n 1 209 GLY n 1 210 CYS n 1 211 TYR n 1 212 ASP n 1 213 LEU n 1 214 SER n 1 215 THR n 1 216 ASN n 1 217 SER n 1 218 GLY n 1 219 CYS n 1 220 ILE n 1 221 TYR n 1 222 LEU n 1 223 ASP n 1 224 ALA n 1 225 ASP n 1 226 MET n 1 227 ILE n 1 228 ILE n 1 229 THR n 1 230 GLU n 1 231 LYS n 1 232 LEU n 1 233 GLY n 1 234 GLY n 1 235 ILE n 1 236 TYR n 1 237 ILE n 1 238 PRO n 1 239 ASP n 1 240 GLY n 1 241 ILE n 1 242 ALA n 1 243 VAL n 1 244 HIS n 1 245 VAL n 1 246 GLU n 1 247 ARG n 1 248 ILE n 1 249 ASP n 1 250 GLY n 1 251 ARG n 1 252 ALA n 1 253 SER n 1 254 MET n 1 255 GLU n 1 256 ASN n 1 257 GLY n 1 258 ILE n 1 259 ILE n 1 260 ALA n 1 261 VAL n 1 262 ASP n 1 263 ARG n 1 264 ASN n 1 265 ASN n 1 266 HIS n 1 267 PRO n 1 268 ALA n 1 269 LEU n 1 270 LEU n 1 271 ALA n 1 272 GLY n 1 273 LEU n 1 274 GLU n 1 275 ILE n 1 276 MET n 1 277 HIS n 1 278 THR n 1 279 LYS n 1 280 PHE n 1 281 ASP n 1 282 ALA n 1 283 ASP n 1 284 PRO n 1 285 TYR n 1 286 SER n 1 287 ASP n 1 288 GLY n 1 289 VAL n 1 290 CYS n 1 291 ASN n 1 292 GLY n 1 293 ILE n 1 294 ARG n 1 295 LYS n 1 296 HIS n 1 297 PHE n 1 298 ASN n 1 299 TYR n 1 300 SER n 1 301 LEU n 1 302 ASN n 1 303 GLU n 1 304 ASP n 1 305 TYR n 1 306 ASN n 1 307 SER n 1 308 PHE n 1 309 CYS n 1 310 ASP n 1 311 PHE n 1 312 ILE n 1 313 GLU n 1 314 PHE n 1 315 LYS n 1 316 HIS n 1 317 ASP n 1 318 ASN n 1 319 ILE n 1 320 ILE n 1 321 MET n 1 322 ASN n 1 323 THR n 1 324 SER n 1 325 GLN n 1 326 PHE n 1 327 THR n 1 328 GLN n 1 329 SER n 1 330 SER n 1 331 TRP n 1 332 ALA n 1 333 ARG n 1 334 HIS n 1 335 VAL n 1 336 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 336 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5H60 _struct_ref.pdbx_db_accession 5H60 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5H60 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 336 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5H60 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 336 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 336 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UDP 'RNA linking' . "URIDINE-5'-DIPHOSPHATE" ? 'C9 H14 N2 O12 P2' 404.161 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5H60 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.50 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.74 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'EVAPORATION, RECRYSTALLIZATION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Bis-Tris propane-HCl (pH 7.0), 1.0M ammonium citrate tribasic' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-03-03 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-1A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-1A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5H60 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.6 _reflns.d_resolution_low 70 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4558 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.02 _refine.aniso_B[1][2] 0.01 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.02 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -0.07 _refine.B_iso_max ? _refine.B_iso_mean 96.618 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.901 _refine.correlation_coeff_Fo_to_Fc_free 0.886 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5H60 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.64 _refine.ls_d_res_low 44.87 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4558 _refine.ls_number_reflns_R_free 244 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.88 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.25513 _refine.ls_R_factor_R_free 0.28485 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.25352 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.781 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 45.995 _refine.overall_SU_ML 0.649 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2472 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2498 _refine_hist.d_res_high 3.64 _refine_hist.d_res_low 44.87 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.019 2554 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 2359 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.320 1.966 3447 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.110 3.000 5449 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.576 5.000 303 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 38.476 25.075 134 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 21.185 15.000 453 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 20.898 15.000 11 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.080 0.200 359 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 2896 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 601 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 6.000 9.494 1215 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 6.001 9.485 1214 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 9.913 14.222 1517 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 9.910 14.234 1518 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.060 9.913 1337 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.060 9.913 1336 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 8.648 14.711 1930 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 15.655 ? 10511 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 15.654 ? 10512 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.640 _refine_ls_shell.d_res_low 3.734 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 14 _refine_ls_shell.number_reflns_R_work 344 _refine_ls_shell.percent_reflns_obs 99.72 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.217 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.315 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5H60 _struct.title 'Structure of Transferase mutant-C23S,C199S' _struct.pdbx_descriptor Transferase _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5H60 _struct_keywords.text Transferase _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 55 ? PHE A 59 ? ASN A 55 PHE A 59 5 ? 5 HELX_P HELX_P2 AA2 PRO A 73 ? GLU A 85 ? PRO A 73 GLU A 85 1 ? 13 HELX_P HELX_P3 AA3 PHE A 99 ? TYR A 113 ? PHE A 99 TYR A 113 1 ? 15 HELX_P HELX_P4 AA4 ASN A 122 ? ILE A 124 ? ASN A 122 ILE A 124 5 ? 3 HELX_P HELX_P5 AA5 PHE A 126 ? ASP A 130 ? PHE A 126 ASP A 130 5 ? 5 HELX_P HELX_P6 AA6 LYS A 132 ? MET A 147 ? LYS A 132 MET A 147 1 ? 16 HELX_P HELX_P7 AA7 ASP A 153 ? GLN A 168 ? ASP A 153 GLN A 168 1 ? 16 HELX_P HELX_P8 AA8 GLY A 183 ? ALA A 198 ? GLY A 183 ALA A 198 1 ? 16 HELX_P HELX_P9 AA9 ALA A 198 ? ASP A 206 ? ALA A 198 ASP A 206 1 ? 9 HELX_P HELX_P10 AB1 HIS A 266 ? LYS A 279 ? HIS A 266 LYS A 279 1 ? 14 HELX_P HELX_P11 AB2 VAL A 289 ? ASN A 298 ? VAL A 289 ASN A 298 1 ? 10 HELX_P HELX_P12 AB3 ASP A 304 ? GLU A 313 ? ASP A 304 GLU A 313 1 ? 10 HELX_P HELX_P13 AB4 THR A 323 ? GLN A 328 ? THR A 323 GLN A 328 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A ASP 225 OD2 ? ? ? 1_555 C MN . MN ? ? A ASP 225 A MN 402 1_555 ? ? ? ? ? ? ? 1.796 ? metalc2 metalc ? ? A ASN 322 OD1 ? ? ? 1_555 C MN . MN ? ? A ASN 322 A MN 402 1_555 ? ? ? ? ? ? ? 2.444 ? metalc3 metalc ? ? A SER 324 OG ? ? ? 1_555 C MN . MN ? ? A SER 324 A MN 402 1_555 ? ? ? ? ? ? ? 2.284 ? covale1 covale one ? A GLN 328 NE2 ? ? ? 1_555 A ARG 333 C ? ? A GLN 328 A ARG 333 1_555 ? ? ? ? ? ? ? 1.478 ? covale2 covale none ? A GLN 328 NE2 ? ? ? 1_555 A ARG 333 O ? ? A GLN 328 A ARG 333 1_555 ? ? ? ? ? ? ? 1.365 ? metalc4 metalc ? ? B UDP . O1A ? ? ? 1_555 C MN . MN ? ? A UDP 401 A MN 402 1_555 ? ? ? ? ? ? ? 2.004 ? metalc5 metalc ? ? B UDP . O3B ? ? ? 1_555 C MN . MN ? ? A UDP 401 A MN 402 1_555 ? ? ? ? ? ? ? 2.548 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? covale ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASN 32 A . ? ASN 32 A GLY 33 A ? GLY 33 A 1 0.41 2 ILE 248 A . ? ILE 248 A ASP 249 A ? ASP 249 A 1 3.22 3 SER 300 A . ? SER 300 A LEU 301 A ? LEU 301 A 1 -13.56 4 ASN 302 A . ? ASN 302 A GLU 303 A ? GLU 303 A 1 -14.38 5 MET 321 A . ? MET 321 A ASN 322 A ? ASN 322 A 1 -17.64 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 6 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 39 ? PHE A 40 ? CYS A 39 PHE A 40 AA1 2 TYR A 236 ? ILE A 237 ? TYR A 236 ILE A 237 AA2 1 ILE A 116 ? TYR A 120 ? ILE A 116 TYR A 120 AA2 2 ILE A 90 ? ASP A 95 ? ILE A 90 ASP A 95 AA2 3 LEU A 47 ? PHE A 52 ? LEU A 47 PHE A 52 AA2 4 CYS A 219 ? LEU A 222 ? CYS A 219 LEU A 222 AA2 5 ALA A 252 ? VAL A 261 ? ALA A 252 VAL A 261 AA2 6 ILE A 241 ? ARG A 247 ? ILE A 241 ARG A 247 AA3 1 ILE A 227 ? ILE A 228 ? ILE A 227 ILE A 228 AA3 2 ILE A 319 ? ILE A 320 ? ILE A 319 ILE A 320 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N CYS A 39 ? N CYS A 39 O ILE A 237 ? O ILE A 237 AA2 1 2 O ILE A 119 ? O ILE A 119 N ILE A 92 ? N ILE A 92 AA2 2 3 O GLY A 91 ? O GLY A 91 N LEU A 47 ? N LEU A 47 AA2 3 4 N LEU A 48 ? N LEU A 48 O ILE A 220 ? O ILE A 220 AA2 4 5 N TYR A 221 ? N TYR A 221 O ILE A 259 ? O ILE A 259 AA2 5 6 O GLU A 255 ? O GLU A 255 N HIS A 244 ? N HIS A 244 AA3 1 2 N ILE A 227 ? N ILE A 227 O ILE A 320 ? O ILE A 320 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A UDP 401 ? 14 'binding site for residue UDP A 401' AC2 Software A MN 402 ? 4 'binding site for residue MN A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 GLN A 50 ? GLN A 50 . ? 1_555 ? 2 AC1 14 TRP A 51 ? TRP A 51 . ? 1_555 ? 3 AC1 14 PHE A 52 ? PHE A 52 . ? 1_555 ? 4 AC1 14 TYR A 74 ? TYR A 74 . ? 1_555 ? 5 AC1 14 TYR A 221 ? TYR A 221 . ? 1_555 ? 6 AC1 14 ASP A 223 ? ASP A 223 . ? 1_555 ? 7 AC1 14 ALA A 224 ? ALA A 224 . ? 1_555 ? 8 AC1 14 ASP A 225 ? ASP A 225 . ? 1_555 ? 9 AC1 14 ASN A 322 ? ASN A 322 . ? 1_555 ? 10 AC1 14 SER A 324 ? SER A 324 . ? 1_555 ? 11 AC1 14 SER A 329 ? SER A 329 . ? 1_555 ? 12 AC1 14 SER A 330 ? SER A 330 . ? 1_555 ? 13 AC1 14 TRP A 331 ? TRP A 331 . ? 1_555 ? 14 AC1 14 MN C . ? MN A 402 . ? 1_555 ? 15 AC2 4 ASP A 225 ? ASP A 225 . ? 1_555 ? 16 AC2 4 ASN A 322 ? ASN A 322 . ? 1_555 ? 17 AC2 4 SER A 324 ? SER A 324 . ? 1_555 ? 18 AC2 4 UDP B . ? UDP A 401 . ? 1_555 ? # _atom_sites.entry_id 5H60 _atom_sites.fract_transf_matrix[1][1] 0.008625 _atom_sites.fract_transf_matrix[1][2] 0.004980 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009959 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009992 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MN N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ILE 2 2 ? ? ? A . n A 1 3 PRO 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 LEU 5 5 ? ? ? A . n A 1 6 ASN 6 6 ? ? ? A . n A 1 7 ARG 7 7 ? ? ? A . n A 1 8 TYR 8 8 ? ? ? A . n A 1 9 VAL 9 9 ? ? ? A . n A 1 10 PRO 10 10 ? ? ? A . n A 1 11 ALA 11 11 ? ? ? A . n A 1 12 LEU 12 12 ? ? ? A . n A 1 13 SER 13 13 ? ? ? A . n A 1 14 LYS 14 14 ? ? ? A . n A 1 15 ASN 15 15 ? ? ? A . n A 1 16 GLU 16 16 ? ? ? A . n A 1 17 LEU 17 17 ? ? ? A . n A 1 18 VAL 18 18 ? ? ? A . n A 1 19 LYS 19 19 ? ? ? A . n A 1 20 THR 20 20 ? ? ? A . n A 1 21 VAL 21 21 ? ? ? A . n A 1 22 THR 22 22 ? ? ? A . n A 1 23 ASN 23 23 ? ? ? A . n A 1 24 ARG 24 24 ? ? ? A . n A 1 25 ASP 25 25 ? ? ? A . n A 1 26 ILE 26 26 ? ? ? A . n A 1 27 GLN 27 27 ? ? ? A . n A 1 28 PHE 28 28 ? ? ? A . n A 1 29 THR 29 29 ? ? ? A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 TYR 120 120 120 TYR TYR A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 MET 128 128 128 MET MET A . n A 1 129 TYR 129 129 129 TYR TYR A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 MET 138 138 138 MET MET A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 GLN 144 144 144 GLN GLN A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 MET 147 147 147 MET MET A . n A 1 148 PRO 148 148 148 PRO PRO A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 CYS 154 154 154 CYS CYS A . n A 1 155 HIS 155 155 155 HIS HIS A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 GLN 158 158 158 GLN GLN A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 GLN 168 168 168 GLN GLN A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 SER 173 173 173 SER SER A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 TYR 178 178 178 TYR TYR A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 HIS 184 184 184 HIS HIS A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 TRP 186 186 186 TRP TRP A . n A 1 187 PHE 187 187 187 PHE PHE A . n A 1 188 ASP 188 188 188 ASP ASP A . n A 1 189 PHE 189 189 189 PHE PHE A . n A 1 190 TYR 190 190 190 TYR TYR A . n A 1 191 ARG 191 191 191 ARG ARG A . n A 1 192 ASN 192 192 192 ASN ASN A . n A 1 193 MET 193 193 193 MET MET A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 MET 195 195 195 MET MET A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 GLY 199 199 199 GLY GLY A . n A 1 200 GLN 200 200 200 GLN GLN A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 PHE 202 202 202 PHE PHE A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 ALA 205 205 205 ALA ALA A . n A 1 206 ASP 206 206 206 ASP ASP A . n A 1 207 LYS 207 207 207 LYS LYS A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 CYS 210 210 210 CYS CYS A . n A 1 211 TYR 211 211 211 TYR TYR A . n A 1 212 ASP 212 212 212 ASP ASP A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 SER 214 214 214 SER SER A . n A 1 215 THR 215 215 215 THR THR A . n A 1 216 ASN 216 216 216 ASN ASN A . n A 1 217 SER 217 217 217 SER SER A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 CYS 219 219 219 CYS CYS A . n A 1 220 ILE 220 220 220 ILE ILE A . n A 1 221 TYR 221 221 221 TYR TYR A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 ASP 223 223 223 ASP ASP A . n A 1 224 ALA 224 224 224 ALA ALA A . n A 1 225 ASP 225 225 225 ASP ASP A . n A 1 226 MET 226 226 226 MET MET A . n A 1 227 ILE 227 227 227 ILE ILE A . n A 1 228 ILE 228 228 228 ILE ILE A . n A 1 229 THR 229 229 229 THR THR A . n A 1 230 GLU 230 230 230 GLU GLU A . n A 1 231 LYS 231 231 231 LYS LYS A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 GLY 233 233 233 GLY GLY A . n A 1 234 GLY 234 234 234 GLY GLY A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 TYR 236 236 236 TYR TYR A . n A 1 237 ILE 237 237 237 ILE ILE A . n A 1 238 PRO 238 238 238 PRO PRO A . n A 1 239 ASP 239 239 239 ASP ASP A . n A 1 240 GLY 240 240 240 GLY GLY A . n A 1 241 ILE 241 241 241 ILE ILE A . n A 1 242 ALA 242 242 242 ALA ALA A . n A 1 243 VAL 243 243 243 VAL VAL A . n A 1 244 HIS 244 244 244 HIS HIS A . n A 1 245 VAL 245 245 245 VAL VAL A . n A 1 246 GLU 246 246 246 GLU GLU A . n A 1 247 ARG 247 247 247 ARG ARG A . n A 1 248 ILE 248 248 248 ILE ILE A . n A 1 249 ASP 249 249 249 ASP ASP A . n A 1 250 GLY 250 250 250 GLY GLY A . n A 1 251 ARG 251 251 251 ARG ARG A . n A 1 252 ALA 252 252 252 ALA ALA A . n A 1 253 SER 253 253 253 SER SER A . n A 1 254 MET 254 254 254 MET MET A . n A 1 255 GLU 255 255 255 GLU GLU A . n A 1 256 ASN 256 256 256 ASN ASN A . n A 1 257 GLY 257 257 257 GLY GLY A . n A 1 258 ILE 258 258 258 ILE ILE A . n A 1 259 ILE 259 259 259 ILE ILE A . n A 1 260 ALA 260 260 260 ALA ALA A . n A 1 261 VAL 261 261 261 VAL VAL A . n A 1 262 ASP 262 262 262 ASP ASP A . n A 1 263 ARG 263 263 263 ARG ARG A . n A 1 264 ASN 264 264 264 ASN ASN A . n A 1 265 ASN 265 265 265 ASN ASN A . n A 1 266 HIS 266 266 266 HIS HIS A . n A 1 267 PRO 267 267 267 PRO PRO A . n A 1 268 ALA 268 268 268 ALA ALA A . n A 1 269 LEU 269 269 269 LEU LEU A . n A 1 270 LEU 270 270 270 LEU LEU A . n A 1 271 ALA 271 271 271 ALA ALA A . n A 1 272 GLY 272 272 272 GLY GLY A . n A 1 273 LEU 273 273 273 LEU LEU A . n A 1 274 GLU 274 274 274 GLU GLU A . n A 1 275 ILE 275 275 275 ILE ILE A . n A 1 276 MET 276 276 276 MET MET A . n A 1 277 HIS 277 277 277 HIS HIS A . n A 1 278 THR 278 278 278 THR THR A . n A 1 279 LYS 279 279 279 LYS LYS A . n A 1 280 PHE 280 280 280 PHE PHE A . n A 1 281 ASP 281 281 281 ASP ASP A . n A 1 282 ALA 282 282 282 ALA ALA A . n A 1 283 ASP 283 283 283 ASP ASP A . n A 1 284 PRO 284 284 284 PRO PRO A . n A 1 285 TYR 285 285 285 TYR TYR A . n A 1 286 SER 286 286 286 SER SER A . n A 1 287 ASP 287 287 287 ASP ASP A . n A 1 288 GLY 288 288 288 GLY GLY A . n A 1 289 VAL 289 289 289 VAL VAL A . n A 1 290 CYS 290 290 290 CYS CYS A . n A 1 291 ASN 291 291 291 ASN ASN A . n A 1 292 GLY 292 292 292 GLY GLY A . n A 1 293 ILE 293 293 293 ILE ILE A . n A 1 294 ARG 294 294 294 ARG ARG A . n A 1 295 LYS 295 295 295 LYS LYS A . n A 1 296 HIS 296 296 296 HIS HIS A . n A 1 297 PHE 297 297 297 PHE PHE A . n A 1 298 ASN 298 298 298 ASN ASN A . n A 1 299 TYR 299 299 299 TYR TYR A . n A 1 300 SER 300 300 300 SER SER A . n A 1 301 LEU 301 301 301 LEU LEU A . n A 1 302 ASN 302 302 302 ASN ASN A . n A 1 303 GLU 303 303 303 GLU GLU A . n A 1 304 ASP 304 304 304 ASP ASP A . n A 1 305 TYR 305 305 305 TYR TYR A . n A 1 306 ASN 306 306 306 ASN ASN A . n A 1 307 SER 307 307 307 SER SER A . n A 1 308 PHE 308 308 308 PHE PHE A . n A 1 309 CYS 309 309 309 CYS CYS A . n A 1 310 ASP 310 310 310 ASP ASP A . n A 1 311 PHE 311 311 311 PHE PHE A . n A 1 312 ILE 312 312 312 ILE ILE A . n A 1 313 GLU 313 313 313 GLU GLU A . n A 1 314 PHE 314 314 314 PHE PHE A . n A 1 315 LYS 315 315 315 LYS LYS A . n A 1 316 HIS 316 316 316 HIS HIS A . n A 1 317 ASP 317 317 317 ASP ASP A . n A 1 318 ASN 318 318 318 ASN ASN A . n A 1 319 ILE 319 319 319 ILE ILE A . n A 1 320 ILE 320 320 320 ILE ILE A . n A 1 321 MET 321 321 321 MET MET A . n A 1 322 ASN 322 322 322 ASN ASN A . n A 1 323 THR 323 323 323 THR THR A . n A 1 324 SER 324 324 324 SER SER A . n A 1 325 GLN 325 325 325 GLN GLN A . n A 1 326 PHE 326 326 326 PHE PHE A . n A 1 327 THR 327 327 327 THR THR A . n A 1 328 GLN 328 328 328 GLN GLN A . n A 1 329 SER 329 329 329 SER SER A . n A 1 330 SER 330 330 330 SER SER A . n A 1 331 TRP 331 331 331 TRP TRP A . n A 1 332 ALA 332 332 332 ALA ALA A . n A 1 333 ARG 333 333 333 ARG ARG A . n A 1 334 HIS 334 334 ? ? ? A . n A 1 335 VAL 335 335 ? ? ? A . n A 1 336 GLN 336 336 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 UDP 1 401 1 UDP UDP A . C 3 MN 1 402 1 MN MN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 225 ? A ASP 225 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 OD1 ? A ASN 322 ? A ASN 322 ? 1_555 95.1 ? 2 OD2 ? A ASP 225 ? A ASP 225 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 OG ? A SER 324 ? A SER 324 ? 1_555 85.8 ? 3 OD1 ? A ASN 322 ? A ASN 322 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 OG ? A SER 324 ? A SER 324 ? 1_555 141.8 ? 4 OD2 ? A ASP 225 ? A ASP 225 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O1A ? B UDP . ? A UDP 401 ? 1_555 77.0 ? 5 OD1 ? A ASN 322 ? A ASN 322 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O1A ? B UDP . ? A UDP 401 ? 1_555 119.8 ? 6 OG ? A SER 324 ? A SER 324 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O1A ? B UDP . ? A UDP 401 ? 1_555 97.7 ? 7 OD2 ? A ASP 225 ? A ASP 225 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O3B ? B UDP . ? A UDP 401 ? 1_555 151.7 ? 8 OD1 ? A ASN 322 ? A ASN 322 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O3B ? B UDP . ? A UDP 401 ? 1_555 94.7 ? 9 OG ? A SER 324 ? A SER 324 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O3B ? B UDP . ? A UDP 401 ? 1_555 102.4 ? 10 O1A ? B UDP . ? A UDP 401 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O3B ? B UDP . ? A UDP 401 ? 1_555 75.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-12-20 2 'Structure model' 1 1 2018-09-19 3 'Structure model' 1 2 2018-10-24 4 'Structure model' 1 3 2018-10-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' citation 5 4 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation.year' 7 3 'Structure model' '_citation.journal_volume' 8 3 'Structure model' '_citation.pdbx_database_id_DOI' 9 4 'Structure model' '_citation.page_first' 10 4 'Structure model' '_citation.page_last' 11 4 'Structure model' '_citation.pdbx_database_id_PubMed' 12 4 'Structure model' '_citation.title' 13 4 'Structure model' '_citation_author.identifier_ORCID' 14 4 'Structure model' '_citation_author.name' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0155 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 CD A GLN 328 ? ? O A ARG 333 ? ? 1.61 2 1 OE1 A GLN 328 ? ? O A ARG 333 ? ? 1.84 3 1 O A GLN 50 ? ? "O2'" A UDP 401 ? ? 2.13 4 1 OG A SER 329 ? ? O2B A UDP 401 ? ? 2.18 5 1 OG A SER 330 ? ? O2A A UDP 401 ? ? 2.18 6 1 OE2 A GLU 255 ? ? OH A TYR 285 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 SG A CYS 154 ? ? 1_555 SG A CYS 154 ? ? 12_555 1.34 2 1 OD1 A ASN 216 ? ? 1_555 OD2 A ASP 262 ? ? 11_555 1.65 3 1 OD1 A ASN 216 ? ? 1_555 CG A ASP 262 ? ? 11_555 1.81 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 N A THR 327 ? ? CA A THR 327 ? ? C A THR 327 ? ? 139.17 111.00 28.17 2.70 N 2 1 C A THR 327 ? ? N A GLN 328 ? ? CA A GLN 328 ? ? 137.16 121.70 15.46 2.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 42 ? ? -47.64 162.85 2 1 LYS A 44 ? ? -66.70 14.23 3 1 PRO A 65 ? ? -78.61 24.79 4 1 ALA A 198 ? ? 52.87 -125.44 5 1 CYS A 210 ? ? -119.83 77.27 6 1 THR A 327 ? ? -98.29 -60.72 7 1 GLN A 328 ? ? -171.71 134.03 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ASP _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 262 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ARG _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 263 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -143.89 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id THR _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 327 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle 12.55 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ILE 2 ? A ILE 2 3 1 Y 1 A PRO 3 ? A PRO 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A LEU 5 ? A LEU 5 6 1 Y 1 A ASN 6 ? A ASN 6 7 1 Y 1 A ARG 7 ? A ARG 7 8 1 Y 1 A TYR 8 ? A TYR 8 9 1 Y 1 A VAL 9 ? A VAL 9 10 1 Y 1 A PRO 10 ? A PRO 10 11 1 Y 1 A ALA 11 ? A ALA 11 12 1 Y 1 A LEU 12 ? A LEU 12 13 1 Y 1 A SER 13 ? A SER 13 14 1 Y 1 A LYS 14 ? A LYS 14 15 1 Y 1 A ASN 15 ? A ASN 15 16 1 Y 1 A GLU 16 ? A GLU 16 17 1 Y 1 A LEU 17 ? A LEU 17 18 1 Y 1 A VAL 18 ? A VAL 18 19 1 Y 1 A LYS 19 ? A LYS 19 20 1 Y 1 A THR 20 ? A THR 20 21 1 Y 1 A VAL 21 ? A VAL 21 22 1 Y 1 A THR 22 ? A THR 22 23 1 Y 1 A ASN 23 ? A ASN 23 24 1 Y 1 A ARG 24 ? A ARG 24 25 1 Y 1 A ASP 25 ? A ASP 25 26 1 Y 1 A ILE 26 ? A ILE 26 27 1 Y 1 A GLN 27 ? A GLN 27 28 1 Y 1 A PHE 28 ? A PHE 28 29 1 Y 1 A THR 29 ? A THR 29 30 1 Y 1 A HIS 334 ? A HIS 334 31 1 Y 1 A VAL 335 ? A VAL 335 32 1 Y 1 A GLN 336 ? A GLN 336 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "URIDINE-5'-DIPHOSPHATE" UDP 3 'MANGANESE (II) ION' MN #