data_5H8C # _entry.id 5H8C # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5H8C pdb_00005h8c 10.2210/pdb5h8c/pdb WWPDB D_1000216642 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-01-13 2 'Structure model' 1 1 2016-03-02 3 'Structure model' 1 2 2016-04-20 4 'Structure model' 1 3 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5H8C _pdbx_database_status.recvd_initial_deposition_date 2015-12-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Naismith, J.H.' 1 'Constantinescu, D.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_id_ASTM NARHAD _citation.journal_id_CSD 0389 _citation.journal_id_ISSN 1362-4962 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 44 _citation.language ? _citation.page_first 2806 _citation.page_last 2815 _citation.title 'Mechanism of DNA loading by the DNA repair helicase XPD.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/nar/gkw102 _citation.pdbx_database_id_PubMed 26896802 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Constantinescu-Aruxandei, D.' 1 ? primary 'Petrovic-Stojanovska, B.' 2 ? primary 'Penedo, J.C.' 3 ? primary 'White, M.F.' 4 ? primary 'Naismith, J.H.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'XPD/Rad3 related DNA helicase' 64086.383 1 ? ? ? 'The protein degraded (domain clipped off) during crystallisation' 2 non-polymer syn 'IRON/SULFUR CLUSTER' 351.640 1 ? ? ? ? 3 water nat water 18.015 7 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'XPD helicase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVKLRDWQEKLKDKVIEGLRNNFLVALNAPTGSGKTLFSLLVSLEVKPKVLFVVRTHNEFYPIYRDLTKIREKRNITFSF LVGKPSSCLYAEKGAESEDIPCKYCELKGSIVEVKTDDSPLSLVKKLKKDGLQDKFCPYYSLLNSLYKADVIALTYPYFF IDRYREFIDIDLREYMIVIDEAHNLDKVNELEERSLSEITIQMAIKQSKSEESRRILSKLLNQLREVVLPDEKYIKVENV PKLSKEELEILADDYEDIRKDSLKQGKVNKIHIGSILRFFSLLSIGSFIPFSYSKRLVIKNPEISYYLNLLNDNELSIIL MSGTLPPREYMEKVWGIKRNMLYLDVEREIQKRVSGSYECYIGVDVTSKYDMRSDNMWKRYADYLLKIYFQAKANVLVVF PSYEIMDRVMSRISLPKYVESEDSSVEDLYSAISANNKVLIGSVGKGKLAEGIELRNNDRSLISDVVIVGIPYPPPDDYL KILAQRVSLKMNRENEEFLFKIPALVTIKQAIGRAIRDVNDKCNVWLLDKRFESLYWKKNLKCLNANKMKL ; _entity_poly.pdbx_seq_one_letter_code_can ;MVKLRDWQEKLKDKVIEGLRNNFLVALNAPTGSGKTLFSLLVSLEVKPKVLFVVRTHNEFYPIYRDLTKIREKRNITFSF LVGKPSSCLYAEKGAESEDIPCKYCELKGSIVEVKTDDSPLSLVKKLKKDGLQDKFCPYYSLLNSLYKADVIALTYPYFF IDRYREFIDIDLREYMIVIDEAHNLDKVNELEERSLSEITIQMAIKQSKSEESRRILSKLLNQLREVVLPDEKYIKVENV PKLSKEELEILADDYEDIRKDSLKQGKVNKIHIGSILRFFSLLSIGSFIPFSYSKRLVIKNPEISYYLNLLNDNELSIIL MSGTLPPREYMEKVWGIKRNMLYLDVEREIQKRVSGSYECYIGVDVTSKYDMRSDNMWKRYADYLLKIYFQAKANVLVVF PSYEIMDRVMSRISLPKYVESEDSSVEDLYSAISANNKVLIGSVGKGKLAEGIELRNNDRSLISDVVIVGIPYPPPDDYL KILAQRVSLKMNRENEEFLFKIPALVTIKQAIGRAIRDVNDKCNVWLLDKRFESLYWKKNLKCLNANKMKL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'IRON/SULFUR CLUSTER' SF4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 LYS n 1 4 LEU n 1 5 ARG n 1 6 ASP n 1 7 TRP n 1 8 GLN n 1 9 GLU n 1 10 LYS n 1 11 LEU n 1 12 LYS n 1 13 ASP n 1 14 LYS n 1 15 VAL n 1 16 ILE n 1 17 GLU n 1 18 GLY n 1 19 LEU n 1 20 ARG n 1 21 ASN n 1 22 ASN n 1 23 PHE n 1 24 LEU n 1 25 VAL n 1 26 ALA n 1 27 LEU n 1 28 ASN n 1 29 ALA n 1 30 PRO n 1 31 THR n 1 32 GLY n 1 33 SER n 1 34 GLY n 1 35 LYS n 1 36 THR n 1 37 LEU n 1 38 PHE n 1 39 SER n 1 40 LEU n 1 41 LEU n 1 42 VAL n 1 43 SER n 1 44 LEU n 1 45 GLU n 1 46 VAL n 1 47 LYS n 1 48 PRO n 1 49 LYS n 1 50 VAL n 1 51 LEU n 1 52 PHE n 1 53 VAL n 1 54 VAL n 1 55 ARG n 1 56 THR n 1 57 HIS n 1 58 ASN n 1 59 GLU n 1 60 PHE n 1 61 TYR n 1 62 PRO n 1 63 ILE n 1 64 TYR n 1 65 ARG n 1 66 ASP n 1 67 LEU n 1 68 THR n 1 69 LYS n 1 70 ILE n 1 71 ARG n 1 72 GLU n 1 73 LYS n 1 74 ARG n 1 75 ASN n 1 76 ILE n 1 77 THR n 1 78 PHE n 1 79 SER n 1 80 PHE n 1 81 LEU n 1 82 VAL n 1 83 GLY n 1 84 LYS n 1 85 PRO n 1 86 SER n 1 87 SER n 1 88 CYS n 1 89 LEU n 1 90 TYR n 1 91 ALA n 1 92 GLU n 1 93 LYS n 1 94 GLY n 1 95 ALA n 1 96 GLU n 1 97 SER n 1 98 GLU n 1 99 ASP n 1 100 ILE n 1 101 PRO n 1 102 CYS n 1 103 LYS n 1 104 TYR n 1 105 CYS n 1 106 GLU n 1 107 LEU n 1 108 LYS n 1 109 GLY n 1 110 SER n 1 111 ILE n 1 112 VAL n 1 113 GLU n 1 114 VAL n 1 115 LYS n 1 116 THR n 1 117 ASP n 1 118 ASP n 1 119 SER n 1 120 PRO n 1 121 LEU n 1 122 SER n 1 123 LEU n 1 124 VAL n 1 125 LYS n 1 126 LYS n 1 127 LEU n 1 128 LYS n 1 129 LYS n 1 130 ASP n 1 131 GLY n 1 132 LEU n 1 133 GLN n 1 134 ASP n 1 135 LYS n 1 136 PHE n 1 137 CYS n 1 138 PRO n 1 139 TYR n 1 140 TYR n 1 141 SER n 1 142 LEU n 1 143 LEU n 1 144 ASN n 1 145 SER n 1 146 LEU n 1 147 TYR n 1 148 LYS n 1 149 ALA n 1 150 ASP n 1 151 VAL n 1 152 ILE n 1 153 ALA n 1 154 LEU n 1 155 THR n 1 156 TYR n 1 157 PRO n 1 158 TYR n 1 159 PHE n 1 160 PHE n 1 161 ILE n 1 162 ASP n 1 163 ARG n 1 164 TYR n 1 165 ARG n 1 166 GLU n 1 167 PHE n 1 168 ILE n 1 169 ASP n 1 170 ILE n 1 171 ASP n 1 172 LEU n 1 173 ARG n 1 174 GLU n 1 175 TYR n 1 176 MET n 1 177 ILE n 1 178 VAL n 1 179 ILE n 1 180 ASP n 1 181 GLU n 1 182 ALA n 1 183 HIS n 1 184 ASN n 1 185 LEU n 1 186 ASP n 1 187 LYS n 1 188 VAL n 1 189 ASN n 1 190 GLU n 1 191 LEU n 1 192 GLU n 1 193 GLU n 1 194 ARG n 1 195 SER n 1 196 LEU n 1 197 SER n 1 198 GLU n 1 199 ILE n 1 200 THR n 1 201 ILE n 1 202 GLN n 1 203 MET n 1 204 ALA n 1 205 ILE n 1 206 LYS n 1 207 GLN n 1 208 SER n 1 209 LYS n 1 210 SER n 1 211 GLU n 1 212 GLU n 1 213 SER n 1 214 ARG n 1 215 ARG n 1 216 ILE n 1 217 LEU n 1 218 SER n 1 219 LYS n 1 220 LEU n 1 221 LEU n 1 222 ASN n 1 223 GLN n 1 224 LEU n 1 225 ARG n 1 226 GLU n 1 227 VAL n 1 228 VAL n 1 229 LEU n 1 230 PRO n 1 231 ASP n 1 232 GLU n 1 233 LYS n 1 234 TYR n 1 235 ILE n 1 236 LYS n 1 237 VAL n 1 238 GLU n 1 239 ASN n 1 240 VAL n 1 241 PRO n 1 242 LYS n 1 243 LEU n 1 244 SER n 1 245 LYS n 1 246 GLU n 1 247 GLU n 1 248 LEU n 1 249 GLU n 1 250 ILE n 1 251 LEU n 1 252 ALA n 1 253 ASP n 1 254 ASP n 1 255 TYR n 1 256 GLU n 1 257 ASP n 1 258 ILE n 1 259 ARG n 1 260 LYS n 1 261 ASP n 1 262 SER n 1 263 LEU n 1 264 LYS n 1 265 GLN n 1 266 GLY n 1 267 LYS n 1 268 VAL n 1 269 ASN n 1 270 LYS n 1 271 ILE n 1 272 HIS n 1 273 ILE n 1 274 GLY n 1 275 SER n 1 276 ILE n 1 277 LEU n 1 278 ARG n 1 279 PHE n 1 280 PHE n 1 281 SER n 1 282 LEU n 1 283 LEU n 1 284 SER n 1 285 ILE n 1 286 GLY n 1 287 SER n 1 288 PHE n 1 289 ILE n 1 290 PRO n 1 291 PHE n 1 292 SER n 1 293 TYR n 1 294 SER n 1 295 LYS n 1 296 ARG n 1 297 LEU n 1 298 VAL n 1 299 ILE n 1 300 LYS n 1 301 ASN n 1 302 PRO n 1 303 GLU n 1 304 ILE n 1 305 SER n 1 306 TYR n 1 307 TYR n 1 308 LEU n 1 309 ASN n 1 310 LEU n 1 311 LEU n 1 312 ASN n 1 313 ASP n 1 314 ASN n 1 315 GLU n 1 316 LEU n 1 317 SER n 1 318 ILE n 1 319 ILE n 1 320 LEU n 1 321 MET n 1 322 SER n 1 323 GLY n 1 324 THR n 1 325 LEU n 1 326 PRO n 1 327 PRO n 1 328 ARG n 1 329 GLU n 1 330 TYR n 1 331 MET n 1 332 GLU n 1 333 LYS n 1 334 VAL n 1 335 TRP n 1 336 GLY n 1 337 ILE n 1 338 LYS n 1 339 ARG n 1 340 ASN n 1 341 MET n 1 342 LEU n 1 343 TYR n 1 344 LEU n 1 345 ASP n 1 346 VAL n 1 347 GLU n 1 348 ARG n 1 349 GLU n 1 350 ILE n 1 351 GLN n 1 352 LYS n 1 353 ARG n 1 354 VAL n 1 355 SER n 1 356 GLY n 1 357 SER n 1 358 TYR n 1 359 GLU n 1 360 CYS n 1 361 TYR n 1 362 ILE n 1 363 GLY n 1 364 VAL n 1 365 ASP n 1 366 VAL n 1 367 THR n 1 368 SER n 1 369 LYS n 1 370 TYR n 1 371 ASP n 1 372 MET n 1 373 ARG n 1 374 SER n 1 375 ASP n 1 376 ASN n 1 377 MET n 1 378 TRP n 1 379 LYS n 1 380 ARG n 1 381 TYR n 1 382 ALA n 1 383 ASP n 1 384 TYR n 1 385 LEU n 1 386 LEU n 1 387 LYS n 1 388 ILE n 1 389 TYR n 1 390 PHE n 1 391 GLN n 1 392 ALA n 1 393 LYS n 1 394 ALA n 1 395 ASN n 1 396 VAL n 1 397 LEU n 1 398 VAL n 1 399 VAL n 1 400 PHE n 1 401 PRO n 1 402 SER n 1 403 TYR n 1 404 GLU n 1 405 ILE n 1 406 MET n 1 407 ASP n 1 408 ARG n 1 409 VAL n 1 410 MET n 1 411 SER n 1 412 ARG n 1 413 ILE n 1 414 SER n 1 415 LEU n 1 416 PRO n 1 417 LYS n 1 418 TYR n 1 419 VAL n 1 420 GLU n 1 421 SER n 1 422 GLU n 1 423 ASP n 1 424 SER n 1 425 SER n 1 426 VAL n 1 427 GLU n 1 428 ASP n 1 429 LEU n 1 430 TYR n 1 431 SER n 1 432 ALA n 1 433 ILE n 1 434 SER n 1 435 ALA n 1 436 ASN n 1 437 ASN n 1 438 LYS n 1 439 VAL n 1 440 LEU n 1 441 ILE n 1 442 GLY n 1 443 SER n 1 444 VAL n 1 445 GLY n 1 446 LYS n 1 447 GLY n 1 448 LYS n 1 449 LEU n 1 450 ALA n 1 451 GLU n 1 452 GLY n 1 453 ILE n 1 454 GLU n 1 455 LEU n 1 456 ARG n 1 457 ASN n 1 458 ASN n 1 459 ASP n 1 460 ARG n 1 461 SER n 1 462 LEU n 1 463 ILE n 1 464 SER n 1 465 ASP n 1 466 VAL n 1 467 VAL n 1 468 ILE n 1 469 VAL n 1 470 GLY n 1 471 ILE n 1 472 PRO n 1 473 TYR n 1 474 PRO n 1 475 PRO n 1 476 PRO n 1 477 ASP n 1 478 ASP n 1 479 TYR n 1 480 LEU n 1 481 LYS n 1 482 ILE n 1 483 LEU n 1 484 ALA n 1 485 GLN n 1 486 ARG n 1 487 VAL n 1 488 SER n 1 489 LEU n 1 490 LYS n 1 491 MET n 1 492 ASN n 1 493 ARG n 1 494 GLU n 1 495 ASN n 1 496 GLU n 1 497 GLU n 1 498 PHE n 1 499 LEU n 1 500 PHE n 1 501 LYS n 1 502 ILE n 1 503 PRO n 1 504 ALA n 1 505 LEU n 1 506 VAL n 1 507 THR n 1 508 ILE n 1 509 LYS n 1 510 GLN n 1 511 ALA n 1 512 ILE n 1 513 GLY n 1 514 ARG n 1 515 ALA n 1 516 ILE n 1 517 ARG n 1 518 ASP n 1 519 VAL n 1 520 ASN n 1 521 ASP n 1 522 LYS n 1 523 CYS n 1 524 ASN n 1 525 VAL n 1 526 TRP n 1 527 LEU n 1 528 LEU n 1 529 ASP n 1 530 LYS n 1 531 ARG n 1 532 PHE n 1 533 GLU n 1 534 SER n 1 535 LEU n 1 536 TYR n 1 537 TRP n 1 538 LYS n 1 539 LYS n 1 540 ASN n 1 541 LEU n 1 542 LYS n 1 543 CYS n 1 544 LEU n 1 545 ASN n 1 546 ALA n 1 547 ASN n 1 548 LYS n 1 549 MET n 1 550 LYS n 1 551 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 551 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SacN8_00920 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sulfolobus acidocaldarius' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2285 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SF4 non-polymer . 'IRON/SULFUR CLUSTER' ? 'Fe4 S4' 351.640 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 VAL 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 LEU 4 4 ? ? ? A . n A 1 5 ARG 5 5 ? ? ? A . n A 1 6 ASP 6 6 ? ? ? A . n A 1 7 TRP 7 7 ? ? ? A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 CYS 102 102 102 CYS CYS A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 CYS 105 105 105 CYS CYS A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 CYS 137 137 137 CYS CYS A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 TYR 147 147 147 TYR TYR A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 TYR 156 156 156 TYR TYR A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 TYR 158 158 158 TYR TYR A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 PHE 160 160 160 PHE PHE A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 ARG 163 163 163 ARG ARG A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 ARG 165 165 165 ARG ARG A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 TYR 175 175 175 TYR TYR A . n A 1 176 MET 176 176 176 MET MET A . n A 1 177 ILE 177 177 177 ILE ILE A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 HIS 183 183 183 HIS HIS A . n A 1 184 ASN 184 184 184 ASN ASN A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 LYS 187 187 187 LYS LYS A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 ASN 189 189 189 ASN ASN A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 ARG 194 194 194 ARG ARG A . n A 1 195 SER 195 195 195 SER SER A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 GLU 198 198 198 GLU GLU A . n A 1 199 ILE 199 199 199 ILE ILE A . n A 1 200 THR 200 200 200 THR THR A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 GLN 202 202 202 GLN GLN A . n A 1 203 MET 203 203 203 MET MET A . n A 1 204 ALA 204 204 204 ALA ALA A . n A 1 205 ILE 205 205 205 ILE ILE A . n A 1 206 LYS 206 206 206 LYS LYS A . n A 1 207 GLN 207 207 207 GLN GLN A . n A 1 208 SER 208 208 208 SER SER A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 SER 210 210 210 SER SER A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 SER 213 213 213 SER SER A . n A 1 214 ARG 214 214 214 ARG ARG A . n A 1 215 ARG 215 215 215 ARG ARG A . n A 1 216 ILE 216 216 216 ILE ILE A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 SER 218 218 218 SER SER A . n A 1 219 LYS 219 219 219 LYS LYS A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 ASN 222 222 222 ASN ASN A . n A 1 223 GLN 223 223 223 GLN GLN A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 ARG 225 225 225 ARG ARG A . n A 1 226 GLU 226 226 226 GLU GLU A . n A 1 227 VAL 227 227 227 VAL VAL A . n A 1 228 VAL 228 228 228 VAL VAL A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 PRO 230 230 230 PRO PRO A . n A 1 231 ASP 231 231 231 ASP ASP A . n A 1 232 GLU 232 232 232 GLU GLU A . n A 1 233 LYS 233 233 233 LYS LYS A . n A 1 234 TYR 234 234 234 TYR TYR A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 LYS 236 236 236 LYS LYS A . n A 1 237 VAL 237 237 237 VAL VAL A . n A 1 238 GLU 238 238 238 GLU GLU A . n A 1 239 ASN 239 239 239 ASN ASN A . n A 1 240 VAL 240 240 240 VAL VAL A . n A 1 241 PRO 241 241 241 PRO PRO A . n A 1 242 LYS 242 242 242 LYS LYS A . n A 1 243 LEU 243 243 243 LEU LEU A . n A 1 244 SER 244 244 244 SER SER A . n A 1 245 LYS 245 245 245 LYS LYS A . n A 1 246 GLU 246 246 246 GLU GLU A . n A 1 247 GLU 247 247 247 GLU GLU A . n A 1 248 LEU 248 248 248 LEU LEU A . n A 1 249 GLU 249 249 249 GLU GLU A . n A 1 250 ILE 250 250 250 ILE ILE A . n A 1 251 LEU 251 251 251 LEU LEU A . n A 1 252 ALA 252 252 252 ALA ALA A . n A 1 253 ASP 253 253 253 ASP ASP A . n A 1 254 ASP 254 254 254 ASP ASP A . n A 1 255 TYR 255 255 255 TYR TYR A . n A 1 256 GLU 256 256 256 GLU GLU A . n A 1 257 ASP 257 257 257 ASP ASP A . n A 1 258 ILE 258 258 258 ILE ILE A . n A 1 259 ARG 259 259 259 ARG ARG A . n A 1 260 LYS 260 260 260 LYS LYS A . n A 1 261 ASP 261 261 261 ASP ASP A . n A 1 262 SER 262 262 262 SER SER A . n A 1 263 LEU 263 263 263 LEU LEU A . n A 1 264 LYS 264 264 264 LYS LYS A . n A 1 265 GLN 265 265 265 GLN GLN A . n A 1 266 GLY 266 266 266 GLY GLY A . n A 1 267 LYS 267 267 267 LYS LYS A . n A 1 268 VAL 268 268 268 VAL VAL A . n A 1 269 ASN 269 269 269 ASN ASN A . n A 1 270 LYS 270 270 270 LYS LYS A . n A 1 271 ILE 271 271 271 ILE ILE A . n A 1 272 HIS 272 272 272 HIS HIS A . n A 1 273 ILE 273 273 273 ILE ILE A . n A 1 274 GLY 274 274 274 GLY GLY A . n A 1 275 SER 275 275 275 SER SER A . n A 1 276 ILE 276 276 276 ILE ILE A . n A 1 277 LEU 277 277 277 LEU LEU A . n A 1 278 ARG 278 278 278 ARG ARG A . n A 1 279 PHE 279 279 279 PHE PHE A . n A 1 280 PHE 280 280 280 PHE PHE A . n A 1 281 SER 281 281 281 SER SER A . n A 1 282 LEU 282 282 282 LEU LEU A . n A 1 283 LEU 283 283 283 LEU LEU A . n A 1 284 SER 284 284 ? ? ? A . n A 1 285 ILE 285 285 ? ? ? A . n A 1 286 GLY 286 286 ? ? ? A . n A 1 287 SER 287 287 ? ? ? A . n A 1 288 PHE 288 288 288 PHE PHE A . n A 1 289 ILE 289 289 289 ILE ILE A . n A 1 290 PRO 290 290 290 PRO PRO A . n A 1 291 PHE 291 291 291 PHE PHE A . n A 1 292 SER 292 292 292 SER SER A . n A 1 293 TYR 293 293 293 TYR TYR A . n A 1 294 SER 294 294 294 SER SER A . n A 1 295 LYS 295 295 295 LYS LYS A . n A 1 296 ARG 296 296 296 ARG ARG A . n A 1 297 LEU 297 297 297 LEU LEU A . n A 1 298 VAL 298 298 298 VAL VAL A . n A 1 299 ILE 299 299 299 ILE ILE A . n A 1 300 LYS 300 300 300 LYS LYS A . n A 1 301 ASN 301 301 301 ASN ASN A . n A 1 302 PRO 302 302 302 PRO PRO A . n A 1 303 GLU 303 303 303 GLU GLU A . n A 1 304 ILE 304 304 304 ILE ILE A . n A 1 305 SER 305 305 305 SER SER A . n A 1 306 TYR 306 306 306 TYR TYR A . n A 1 307 TYR 307 307 307 TYR TYR A . n A 1 308 LEU 308 308 308 LEU LEU A . n A 1 309 ASN 309 309 309 ASN ASN A . n A 1 310 LEU 310 310 310 LEU LEU A . n A 1 311 LEU 311 311 311 LEU LEU A . n A 1 312 ASN 312 312 312 ASN ASN A . n A 1 313 ASP 313 313 313 ASP ASP A . n A 1 314 ASN 314 314 314 ASN ASN A . n A 1 315 GLU 315 315 315 GLU GLU A . n A 1 316 LEU 316 316 316 LEU LEU A . n A 1 317 SER 317 317 317 SER SER A . n A 1 318 ILE 318 318 318 ILE ILE A . n A 1 319 ILE 319 319 319 ILE ILE A . n A 1 320 LEU 320 320 320 LEU LEU A . n A 1 321 MET 321 321 321 MET MET A . n A 1 322 SER 322 322 322 SER SER A . n A 1 323 GLY 323 323 323 GLY GLY A . n A 1 324 THR 324 324 324 THR THR A . n A 1 325 LEU 325 325 325 LEU LEU A . n A 1 326 PRO 326 326 326 PRO PRO A . n A 1 327 PRO 327 327 327 PRO PRO A . n A 1 328 ARG 328 328 328 ARG ARG A . n A 1 329 GLU 329 329 329 GLU GLU A . n A 1 330 TYR 330 330 330 TYR TYR A . n A 1 331 MET 331 331 331 MET MET A . n A 1 332 GLU 332 332 332 GLU GLU A . n A 1 333 LYS 333 333 333 LYS LYS A . n A 1 334 VAL 334 334 334 VAL VAL A . n A 1 335 TRP 335 335 335 TRP TRP A . n A 1 336 GLY 336 336 336 GLY GLY A . n A 1 337 ILE 337 337 337 ILE ILE A . n A 1 338 LYS 338 338 338 LYS LYS A . n A 1 339 ARG 339 339 339 ARG ARG A . n A 1 340 ASN 340 340 340 ASN ASN A . n A 1 341 MET 341 341 341 MET MET A . n A 1 342 LEU 342 342 342 LEU LEU A . n A 1 343 TYR 343 343 343 TYR TYR A . n A 1 344 LEU 344 344 344 LEU LEU A . n A 1 345 ASP 345 345 345 ASP ASP A . n A 1 346 VAL 346 346 346 VAL VAL A . n A 1 347 GLU 347 347 ? ? ? A . n A 1 348 ARG 348 348 ? ? ? A . n A 1 349 GLU 349 349 ? ? ? A . n A 1 350 ILE 350 350 ? ? ? A . n A 1 351 GLN 351 351 ? ? ? A . n A 1 352 LYS 352 352 ? ? ? A . n A 1 353 ARG 353 353 ? ? ? A . n A 1 354 VAL 354 354 ? ? ? A . n A 1 355 SER 355 355 ? ? ? A . n A 1 356 GLY 356 356 ? ? ? A . n A 1 357 SER 357 357 ? ? ? A . n A 1 358 TYR 358 358 ? ? ? A . n A 1 359 GLU 359 359 ? ? ? A . n A 1 360 CYS 360 360 ? ? ? A . n A 1 361 TYR 361 361 ? ? ? A . n A 1 362 ILE 362 362 ? ? ? A . n A 1 363 GLY 363 363 ? ? ? A . n A 1 364 VAL 364 364 ? ? ? A . n A 1 365 ASP 365 365 ? ? ? A . n A 1 366 VAL 366 366 ? ? ? A . n A 1 367 THR 367 367 ? ? ? A . n A 1 368 SER 368 368 ? ? ? A . n A 1 369 LYS 369 369 ? ? ? A . n A 1 370 TYR 370 370 ? ? ? A . n A 1 371 ASP 371 371 ? ? ? A . n A 1 372 MET 372 372 ? ? ? A . n A 1 373 ARG 373 373 ? ? ? A . n A 1 374 SER 374 374 ? ? ? A . n A 1 375 ASP 375 375 ? ? ? A . n A 1 376 ASN 376 376 ? ? ? A . n A 1 377 MET 377 377 ? ? ? A . n A 1 378 TRP 378 378 ? ? ? A . n A 1 379 LYS 379 379 ? ? ? A . n A 1 380 ARG 380 380 ? ? ? A . n A 1 381 TYR 381 381 ? ? ? A . n A 1 382 ALA 382 382 ? ? ? A . n A 1 383 ASP 383 383 ? ? ? A . n A 1 384 TYR 384 384 ? ? ? A . n A 1 385 LEU 385 385 ? ? ? A . n A 1 386 LEU 386 386 ? ? ? A . n A 1 387 LYS 387 387 ? ? ? A . n A 1 388 ILE 388 388 ? ? ? A . n A 1 389 TYR 389 389 ? ? ? A . n A 1 390 PHE 390 390 ? ? ? A . n A 1 391 GLN 391 391 ? ? ? A . n A 1 392 ALA 392 392 ? ? ? A . n A 1 393 LYS 393 393 ? ? ? A . n A 1 394 ALA 394 394 ? ? ? A . n A 1 395 ASN 395 395 ? ? ? A . n A 1 396 VAL 396 396 ? ? ? A . n A 1 397 LEU 397 397 ? ? ? A . n A 1 398 VAL 398 398 ? ? ? A . n A 1 399 VAL 399 399 ? ? ? A . n A 1 400 PHE 400 400 ? ? ? A . n A 1 401 PRO 401 401 ? ? ? A . n A 1 402 SER 402 402 ? ? ? A . n A 1 403 TYR 403 403 ? ? ? A . n A 1 404 GLU 404 404 ? ? ? A . n A 1 405 ILE 405 405 ? ? ? A . n A 1 406 MET 406 406 ? ? ? A . n A 1 407 ASP 407 407 ? ? ? A . n A 1 408 ARG 408 408 ? ? ? A . n A 1 409 VAL 409 409 ? ? ? A . n A 1 410 MET 410 410 ? ? ? A . n A 1 411 SER 411 411 ? ? ? A . n A 1 412 ARG 412 412 ? ? ? A . n A 1 413 ILE 413 413 ? ? ? A . n A 1 414 SER 414 414 ? ? ? A . n A 1 415 LEU 415 415 ? ? ? A . n A 1 416 PRO 416 416 ? ? ? A . n A 1 417 LYS 417 417 ? ? ? A . n A 1 418 TYR 418 418 ? ? ? A . n A 1 419 VAL 419 419 ? ? ? A . n A 1 420 GLU 420 420 ? ? ? A . n A 1 421 SER 421 421 ? ? ? A . n A 1 422 GLU 422 422 ? ? ? A . n A 1 423 ASP 423 423 ? ? ? A . n A 1 424 SER 424 424 ? ? ? A . n A 1 425 SER 425 425 ? ? ? A . n A 1 426 VAL 426 426 ? ? ? A . n A 1 427 GLU 427 427 ? ? ? A . n A 1 428 ASP 428 428 ? ? ? A . n A 1 429 LEU 429 429 ? ? ? A . n A 1 430 TYR 430 430 ? ? ? A . n A 1 431 SER 431 431 ? ? ? A . n A 1 432 ALA 432 432 ? ? ? A . n A 1 433 ILE 433 433 ? ? ? A . n A 1 434 SER 434 434 ? ? ? A . n A 1 435 ALA 435 435 ? ? ? A . n A 1 436 ASN 436 436 ? ? ? A . n A 1 437 ASN 437 437 ? ? ? A . n A 1 438 LYS 438 438 ? ? ? A . n A 1 439 VAL 439 439 ? ? ? A . n A 1 440 LEU 440 440 ? ? ? A . n A 1 441 ILE 441 441 ? ? ? A . n A 1 442 GLY 442 442 ? ? ? A . n A 1 443 SER 443 443 ? ? ? A . n A 1 444 VAL 444 444 ? ? ? A . n A 1 445 GLY 445 445 ? ? ? A . n A 1 446 LYS 446 446 ? ? ? A . n A 1 447 GLY 447 447 ? ? ? A . n A 1 448 LYS 448 448 ? ? ? A . n A 1 449 LEU 449 449 ? ? ? A . n A 1 450 ALA 450 450 ? ? ? A . n A 1 451 GLU 451 451 ? ? ? A . n A 1 452 GLY 452 452 ? ? ? A . n A 1 453 ILE 453 453 ? ? ? A . n A 1 454 GLU 454 454 ? ? ? A . n A 1 455 LEU 455 455 ? ? ? A . n A 1 456 ARG 456 456 ? ? ? A . n A 1 457 ASN 457 457 ? ? ? A . n A 1 458 ASN 458 458 ? ? ? A . n A 1 459 ASP 459 459 ? ? ? A . n A 1 460 ARG 460 460 ? ? ? A . n A 1 461 SER 461 461 ? ? ? A . n A 1 462 LEU 462 462 ? ? ? A . n A 1 463 ILE 463 463 ? ? ? A . n A 1 464 SER 464 464 ? ? ? A . n A 1 465 ASP 465 465 ? ? ? A . n A 1 466 VAL 466 466 ? ? ? A . n A 1 467 VAL 467 467 ? ? ? A . n A 1 468 ILE 468 468 ? ? ? A . n A 1 469 VAL 469 469 ? ? ? A . n A 1 470 GLY 470 470 ? ? ? A . n A 1 471 ILE 471 471 ? ? ? A . n A 1 472 PRO 472 472 ? ? ? A . n A 1 473 TYR 473 473 ? ? ? A . n A 1 474 PRO 474 474 ? ? ? A . n A 1 475 PRO 475 475 ? ? ? A . n A 1 476 PRO 476 476 ? ? ? A . n A 1 477 ASP 477 477 ? ? ? A . n A 1 478 ASP 478 478 ? ? ? A . n A 1 479 TYR 479 479 ? ? ? A . n A 1 480 LEU 480 480 ? ? ? A . n A 1 481 LYS 481 481 ? ? ? A . n A 1 482 ILE 482 482 ? ? ? A . n A 1 483 LEU 483 483 ? ? ? A . n A 1 484 ALA 484 484 ? ? ? A . n A 1 485 GLN 485 485 ? ? ? A . n A 1 486 ARG 486 486 ? ? ? A . n A 1 487 VAL 487 487 ? ? ? A . n A 1 488 SER 488 488 ? ? ? A . n A 1 489 LEU 489 489 ? ? ? A . n A 1 490 LYS 490 490 ? ? ? A . n A 1 491 MET 491 491 ? ? ? A . n A 1 492 ASN 492 492 ? ? ? A . n A 1 493 ARG 493 493 ? ? ? A . n A 1 494 GLU 494 494 ? ? ? A . n A 1 495 ASN 495 495 ? ? ? A . n A 1 496 GLU 496 496 ? ? ? A . n A 1 497 GLU 497 497 ? ? ? A . n A 1 498 PHE 498 498 ? ? ? A . n A 1 499 LEU 499 499 ? ? ? A . n A 1 500 PHE 500 500 ? ? ? A . n A 1 501 LYS 501 501 ? ? ? A . n A 1 502 ILE 502 502 ? ? ? A . n A 1 503 PRO 503 503 ? ? ? A . n A 1 504 ALA 504 504 ? ? ? A . n A 1 505 LEU 505 505 ? ? ? A . n A 1 506 VAL 506 506 ? ? ? A . n A 1 507 THR 507 507 ? ? ? A . n A 1 508 ILE 508 508 ? ? ? A . n A 1 509 LYS 509 509 ? ? ? A . n A 1 510 GLN 510 510 ? ? ? A . n A 1 511 ALA 511 511 ? ? ? A . n A 1 512 ILE 512 512 ? ? ? A . n A 1 513 GLY 513 513 ? ? ? A . n A 1 514 ARG 514 514 ? ? ? A . n A 1 515 ALA 515 515 ? ? ? A . n A 1 516 ILE 516 516 ? ? ? A . n A 1 517 ARG 517 517 ? ? ? A . n A 1 518 ASP 518 518 ? ? ? A . n A 1 519 VAL 519 519 ? ? ? A . n A 1 520 ASN 520 520 ? ? ? A . n A 1 521 ASP 521 521 ? ? ? A . n A 1 522 LYS 522 522 ? ? ? A . n A 1 523 CYS 523 523 ? ? ? A . n A 1 524 ASN 524 524 ? ? ? A . n A 1 525 VAL 525 525 ? ? ? A . n A 1 526 TRP 526 526 ? ? ? A . n A 1 527 LEU 527 527 ? ? ? A . n A 1 528 LEU 528 528 ? ? ? A . n A 1 529 ASP 529 529 ? ? ? A . n A 1 530 LYS 530 530 ? ? ? A . n A 1 531 ARG 531 531 ? ? ? A . n A 1 532 PHE 532 532 ? ? ? A . n A 1 533 GLU 533 533 ? ? ? A . n A 1 534 SER 534 534 ? ? ? A . n A 1 535 LEU 535 535 ? ? ? A . n A 1 536 TYR 536 536 ? ? ? A . n A 1 537 TRP 537 537 ? ? ? A . n A 1 538 LYS 538 538 ? ? ? A . n A 1 539 LYS 539 539 ? ? ? A . n A 1 540 ASN 540 540 ? ? ? A . n A 1 541 LEU 541 541 ? ? ? A . n A 1 542 LYS 542 542 ? ? ? A . n A 1 543 CYS 543 543 ? ? ? A . n A 1 544 LEU 544 544 ? ? ? A . n A 1 545 ASN 545 545 ? ? ? A . n A 1 546 ALA 546 546 ? ? ? A . n A 1 547 ASN 547 547 ? ? ? A . n A 1 548 LYS 548 548 ? ? ? A . n A 1 549 MET 549 549 ? ? ? A . n A 1 550 LYS 550 550 ? ? ? A . n A 1 551 LEU 551 551 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SF4 1 601 450 SF4 FS4 A . C 3 HOH 1 701 3 HOH HOH A . C 3 HOH 2 702 7 HOH HOH A . C 3 HOH 3 703 2 HOH HOH A . C 3 HOH 4 704 4 HOH HOH A . C 3 HOH 5 705 1 HOH HOH A . C 3 HOH 6 706 5 HOH HOH A . C 3 HOH 7 707 6 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0135 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5H8C _cell.details ? _cell.formula_units_Z ? _cell.length_a 64.800 _cell.length_a_esd ? _cell.length_b 77.800 _cell.length_b_esd ? _cell.length_c 99.540 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5H8C _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5H8C _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.96 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 37.17 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details PEG _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-12-01 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.988 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.988 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5H8C _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.29 _reflns.d_resolution_low 29 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23154 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.8 _reflns.pdbx_Rmerge_I_obs 0.033 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.29 _reflns_shell.d_res_low 2.35 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.69 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.9 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -2.03 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.02 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 2.01 _refine.B_iso_max ? _refine.B_iso_mean 79.675 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.966 _refine.correlation_coeff_Fo_to_Fc_free 0.948 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5H8C _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.29 _refine.ls_d_res_low 29 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21920 _refine.ls_number_reflns_R_free 1186 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.43 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.20511 _refine.ls_R_factor_R_free 0.23912 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.20326 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.240 _refine.pdbx_overall_ESU_R_Free 0.198 _refine.pdbx_solvent_vdw_probe_radii 1.00 _refine.pdbx_solvent_ion_probe_radii 0.90 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 14.512 _refine.overall_SU_ML 0.169 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2750 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.number_atoms_solvent 7 _refine_hist.number_atoms_total 2765 _refine_hist.d_res_high 2.29 _refine_hist.d_res_low 29 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.019 2821 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 2805 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.676 2.022 3841 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.417 3.001 6485 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.853 5.000 333 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 37.483 24.400 125 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.210 15.000 560 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.384 15.000 17 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.076 0.200 433 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.021 3032 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 591 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.543 4.908 1338 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.542 4.907 1337 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.540 7.352 1669 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.539 7.353 1670 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 1.983 5.176 1483 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 1.982 5.176 1484 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.003 7.651 2111 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 4.881 37.568 2961 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 4.880 37.578 2962 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.292 _refine_ls_shell.d_res_low 2.351 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 89 _refine_ls_shell.number_reflns_R_work 1579 _refine_ls_shell.percent_reflns_obs 99.70 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.383 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.303 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5H8C _struct.title 'Truncated XPD' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5H8C _struct_keywords.text 'helicase, hydrolase' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code M1J2P5_9CREN _struct_ref.pdbx_db_accession M1J2P5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KLRDWQEKLKDKVIEGLRNNFLVALNAPTGSGKTLFSLLVSLEVKPKVLFVVRTHNEFYPIYRDLTKIREKRNITFSFLV GKPSSCLYAEKGAESEDIPCKYCELKGSIVEVKTDDSPLSLVKKLKKDGLQDKFCPYYSLLNSLYKADVIALTYPYFFID RYREFIDIDLREYMIVIDEAHNLDKVNELEERSLSEITIQMAIKQSKSEESRRILSKLLNQLREVVLPDEKYIKVENVPK LSKEELEILADDYEDIRKDSLKQGKVNKIHIGSILRFFSLLSIGSFIPFSYSKRLVIKNPEISYYLNLLNDNELSIILMS GTLPPREYMEKVWGIKRNMLYLDVEREIQKRVSGSYECYIGVDVTSKYDMRSDNMWKRYADYLLKIYFQAKANVLVVFPS YEIMDRVMSRISLPKYVESEDSSVEDLYSAISANNKVLIGSVGKGKLAEGIELRNNDRSLISDVVIVGIPYPPPDDYLKI LAQRVSLKMNRENEEFLFKIPALVTIKQAIGRAIRDVNDKCNVWLLDKRFESLYWKKNLKCLNANKMKL ; _struct_ref.pdbx_align_begin 3 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5H8C _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 551 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession M1J2P5 _struct_ref_seq.db_align_beg 3 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 551 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 551 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5H8C MET A 1 ? UNP M1J2P5 ? ? 'initiating methionine' 1 1 1 5H8C VAL A 2 ? UNP M1J2P5 ? ? 'expression tag' 2 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 360 ? 1 MORE -21 ? 1 'SSA (A^2)' 17740 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 12 ? ASN A 21 ? LYS A 12 ASN A 21 1 ? 10 HELX_P HELX_P2 AA2 GLY A 34 ? GLU A 45 ? GLY A 34 GLU A 45 1 ? 12 HELX_P HELX_P3 AA3 THR A 56 ? ASN A 58 ? THR A 56 ASN A 58 5 ? 3 HELX_P HELX_P4 AA4 GLU A 59 ? ARG A 74 ? GLU A 59 ARG A 74 1 ? 16 HELX_P HELX_P5 AA5 GLY A 83 ? CYS A 88 ? GLY A 83 CYS A 88 1 ? 6 HELX_P HELX_P6 AA6 GLU A 96 ? ILE A 100 ? GLU A 96 ILE A 100 5 ? 5 HELX_P HELX_P7 AA7 PRO A 101 ? CYS A 105 ? PRO A 101 CYS A 105 5 ? 5 HELX_P HELX_P8 AA8 SER A 119 ? LYS A 135 ? SER A 119 LYS A 135 1 ? 17 HELX_P HELX_P9 AA9 CYS A 137 ? ALA A 149 ? CYS A 137 ALA A 149 1 ? 13 HELX_P HELX_P10 AB1 TYR A 156 ? ILE A 161 ? TYR A 156 ILE A 161 1 ? 6 HELX_P HELX_P11 AB2 ILE A 161 ? GLU A 166 ? ILE A 161 GLU A 166 1 ? 6 HELX_P HELX_P12 AB3 ASP A 171 ? ARG A 173 ? ASP A 171 ARG A 173 5 ? 3 HELX_P HELX_P13 AB4 GLU A 181 ? LEU A 191 ? GLU A 181 LEU A 191 5 ? 11 HELX_P HELX_P14 AB5 SER A 197 ? SER A 208 ? SER A 197 SER A 208 1 ? 12 HELX_P HELX_P15 AB6 SER A 210 ? VAL A 228 ? SER A 210 VAL A 228 1 ? 19 HELX_P HELX_P16 AB7 SER A 244 ? GLN A 265 ? SER A 244 GLN A 265 1 ? 22 HELX_P HELX_P17 AB8 ILE A 271 ? LEU A 282 ? ILE A 271 LEU A 282 1 ? 12 HELX_P HELX_P18 AB9 GLU A 303 ? ASN A 309 ? GLU A 303 ASN A 309 1 ? 7 HELX_P HELX_P19 AC1 LEU A 310 ? ASP A 313 ? LEU A 310 ASP A 313 5 ? 4 HELX_P HELX_P20 AC2 PRO A 327 ? VAL A 334 ? PRO A 327 VAL A 334 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 88 SG ? ? ? 1_555 B SF4 . FE3 ? ? A CYS 88 A SF4 601 1_555 ? ? ? ? ? ? ? 2.280 ? ? metalc2 metalc ? ? A CYS 102 SG ? ? ? 1_555 B SF4 . FE2 ? ? A CYS 102 A SF4 601 1_555 ? ? ? ? ? ? ? 2.260 ? ? metalc3 metalc ? ? A CYS 105 SG ? ? ? 1_555 B SF4 . FE4 ? ? A CYS 105 A SF4 601 1_555 ? ? ? ? ? ? ? 2.380 ? ? metalc4 metalc ? ? A CYS 137 SG ? ? ? 1_555 B SF4 . FE1 ? ? A CYS 137 A SF4 601 1_555 ? ? ? ? ? ? ? 2.288 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 88 ? A CYS 88 ? 1_555 FE3 ? B SF4 . ? A SF4 601 ? 1_555 S1 ? B SF4 . ? A SF4 601 ? 1_555 114.0 ? 2 SG ? A CYS 88 ? A CYS 88 ? 1_555 FE3 ? B SF4 . ? A SF4 601 ? 1_555 S2 ? B SF4 . ? A SF4 601 ? 1_555 119.0 ? 3 S1 ? B SF4 . ? A SF4 601 ? 1_555 FE3 ? B SF4 . ? A SF4 601 ? 1_555 S2 ? B SF4 . ? A SF4 601 ? 1_555 102.7 ? 4 SG ? A CYS 88 ? A CYS 88 ? 1_555 FE3 ? B SF4 . ? A SF4 601 ? 1_555 S4 ? B SF4 . ? A SF4 601 ? 1_555 112.5 ? 5 S1 ? B SF4 . ? A SF4 601 ? 1_555 FE3 ? B SF4 . ? A SF4 601 ? 1_555 S4 ? B SF4 . ? A SF4 601 ? 1_555 101.4 ? 6 S2 ? B SF4 . ? A SF4 601 ? 1_555 FE3 ? B SF4 . ? A SF4 601 ? 1_555 S4 ? B SF4 . ? A SF4 601 ? 1_555 105.4 ? 7 SG ? A CYS 102 ? A CYS 102 ? 1_555 FE2 ? B SF4 . ? A SF4 601 ? 1_555 S1 ? B SF4 . ? A SF4 601 ? 1_555 117.5 ? 8 SG ? A CYS 102 ? A CYS 102 ? 1_555 FE2 ? B SF4 . ? A SF4 601 ? 1_555 S3 ? B SF4 . ? A SF4 601 ? 1_555 120.0 ? 9 S1 ? B SF4 . ? A SF4 601 ? 1_555 FE2 ? B SF4 . ? A SF4 601 ? 1_555 S3 ? B SF4 . ? A SF4 601 ? 1_555 104.5 ? 10 SG ? A CYS 102 ? A CYS 102 ? 1_555 FE2 ? B SF4 . ? A SF4 601 ? 1_555 S4 ? B SF4 . ? A SF4 601 ? 1_555 103.5 ? 11 S1 ? B SF4 . ? A SF4 601 ? 1_555 FE2 ? B SF4 . ? A SF4 601 ? 1_555 S4 ? B SF4 . ? A SF4 601 ? 1_555 102.9 ? 12 S3 ? B SF4 . ? A SF4 601 ? 1_555 FE2 ? B SF4 . ? A SF4 601 ? 1_555 S4 ? B SF4 . ? A SF4 601 ? 1_555 106.6 ? 13 SG ? A CYS 105 ? A CYS 105 ? 1_555 FE4 ? B SF4 . ? A SF4 601 ? 1_555 S1 ? B SF4 . ? A SF4 601 ? 1_555 114.9 ? 14 SG ? A CYS 105 ? A CYS 105 ? 1_555 FE4 ? B SF4 . ? A SF4 601 ? 1_555 S2 ? B SF4 . ? A SF4 601 ? 1_555 124.4 ? 15 S1 ? B SF4 . ? A SF4 601 ? 1_555 FE4 ? B SF4 . ? A SF4 601 ? 1_555 S2 ? B SF4 . ? A SF4 601 ? 1_555 102.5 ? 16 SG ? A CYS 105 ? A CYS 105 ? 1_555 FE4 ? B SF4 . ? A SF4 601 ? 1_555 S3 ? B SF4 . ? A SF4 601 ? 1_555 106.4 ? 17 S1 ? B SF4 . ? A SF4 601 ? 1_555 FE4 ? B SF4 . ? A SF4 601 ? 1_555 S3 ? B SF4 . ? A SF4 601 ? 1_555 104.4 ? 18 S2 ? B SF4 . ? A SF4 601 ? 1_555 FE4 ? B SF4 . ? A SF4 601 ? 1_555 S3 ? B SF4 . ? A SF4 601 ? 1_555 102.1 ? 19 SG ? A CYS 137 ? A CYS 137 ? 1_555 FE1 ? B SF4 . ? A SF4 601 ? 1_555 S2 ? B SF4 . ? A SF4 601 ? 1_555 125.4 ? 20 SG ? A CYS 137 ? A CYS 137 ? 1_555 FE1 ? B SF4 . ? A SF4 601 ? 1_555 S3 ? B SF4 . ? A SF4 601 ? 1_555 104.6 ? 21 S2 ? B SF4 . ? A SF4 601 ? 1_555 FE1 ? B SF4 . ? A SF4 601 ? 1_555 S3 ? B SF4 . ? A SF4 601 ? 1_555 102.1 ? 22 SG ? A CYS 137 ? A CYS 137 ? 1_555 FE1 ? B SF4 . ? A SF4 601 ? 1_555 S4 ? B SF4 . ? A SF4 601 ? 1_555 111.7 ? 23 S2 ? B SF4 . ? A SF4 601 ? 1_555 FE1 ? B SF4 . ? A SF4 601 ? 1_555 S4 ? B SF4 . ? A SF4 601 ? 1_555 105.2 ? 24 S3 ? B SF4 . ? A SF4 601 ? 1_555 FE1 ? B SF4 . ? A SF4 601 ? 1_555 S4 ? B SF4 . ? A SF4 601 ? 1_555 106.0 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 78 ? PHE A 80 ? PHE A 78 PHE A 80 AA1 2 VAL A 151 ? THR A 155 ? VAL A 151 THR A 155 AA1 3 LYS A 49 ? VAL A 54 ? LYS A 49 VAL A 54 AA1 4 TYR A 175 ? ILE A 179 ? TYR A 175 ILE A 179 AA1 5 SER A 317 ? SER A 322 ? SER A 317 SER A 322 AA1 6 LEU A 24 ? ASN A 28 ? LEU A 24 ASN A 28 AA1 7 MET A 341 ? ASP A 345 ? MET A 341 ASP A 345 AA2 1 SER A 195 ? LEU A 196 ? SER A 195 LEU A 196 AA2 2 ARG A 296 ? VAL A 298 ? ARG A 296 VAL A 298 AA2 3 PHE A 291 ? TYR A 293 ? PHE A 291 TYR A 293 AA2 4 ILE A 235 ? LYS A 236 ? ILE A 235 LYS A 236 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 79 ? N SER A 79 O VAL A 151 ? O VAL A 151 AA1 2 3 O ILE A 152 ? O ILE A 152 N PHE A 52 ? N PHE A 52 AA1 3 4 N LEU A 51 ? N LEU A 51 O VAL A 178 ? O VAL A 178 AA1 4 5 N ILE A 177 ? N ILE A 177 O SER A 317 ? O SER A 317 AA1 5 6 O LEU A 320 ? O LEU A 320 N LEU A 27 ? N LEU A 27 AA1 6 7 N ALA A 26 ? N ALA A 26 O LEU A 344 ? O LEU A 344 AA2 1 2 N LEU A 196 ? N LEU A 196 O LEU A 297 ? O LEU A 297 AA2 2 3 O VAL A 298 ? O VAL A 298 N PHE A 291 ? N PHE A 291 AA2 3 4 O SER A 292 ? O SER A 292 N ILE A 235 ? N ILE A 235 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id SF4 _struct_site.pdbx_auth_seq_id 601 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'binding site for residue SF4 A 601' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 88 ? CYS A 88 . ? 1_555 ? 2 AC1 5 ILE A 100 ? ILE A 100 . ? 1_555 ? 3 AC1 5 CYS A 102 ? CYS A 102 . ? 1_555 ? 4 AC1 5 CYS A 105 ? CYS A 105 . ? 1_555 ? 5 AC1 5 CYS A 137 ? CYS A 137 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 9 ? ? -164.52 -95.68 2 1 LYS A 12 ? ? 177.76 -54.00 3 1 PRO A 101 ? ? -90.74 54.61 4 1 LYS A 233 ? ? -173.32 130.80 5 1 ASN A 239 ? ? 54.43 72.39 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 LYS A 10 ? ? LEU A 11 ? ? 144.85 2 1 GLY A 266 ? ? LYS A 267 ? ? -141.41 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 0.2830 2.0690 5.6260 0.5349 ? 0.0129 ? 0.0443 ? 0.1933 ? 0.1316 ? 0.4461 ? 12.4963 ? 1.9322 ? -1.8206 ? 3.5409 ? 2.1893 ? 10.8347 ? -0.0117 ? -0.9677 ? -1.0213 ? 0.9804 ? -0.1985 ? 0.5761 ? 0.4637 ? -0.9062 ? 0.2102 ? 2 'X-RAY DIFFRACTION' ? refined -4.2950 18.1780 6.4870 0.2602 ? -0.0535 ? 0.0846 ? 0.1169 ? 0.0294 ? 0.2498 ? 8.3687 ? -2.7924 ? -0.6546 ? 3.5226 ? 0.3905 ? 2.0564 ? -0.0375 ? -0.9172 ? -0.5850 ? 0.6685 ? 0.1496 ? 0.3671 ? 0.0039 ? 0.0237 ? -0.1121 ? 3 'X-RAY DIFFRACTION' ? refined 1.9400 39.5080 -4.4070 0.2132 ? -0.1051 ? -0.0013 ? 0.0906 ? 0.0270 ? 0.3461 ? 5.5865 ? -1.4317 ? -3.1565 ? 3.6763 ? -0.5216 ? 9.1408 ? 0.1164 ? -0.2550 ? 0.4154 ? 0.2337 ? -0.2860 ? 0.0206 ? -0.3284 ? 0.6058 ? 0.1696 ? 4 'X-RAY DIFFRACTION' ? refined -3.0800 35.0740 3.3200 0.2599 ? -0.0424 ? 0.0379 ? 0.0710 ? -0.1040 ? 0.2328 ? 4.1565 ? -0.5837 ? -0.5543 ? 5.7367 ? -0.6404 ? 2.8739 ? -0.1539 ? -0.3456 ? 0.6969 ? 0.4750 ? 0.1731 ? 0.0137 ? -0.5674 ? 0.0230 ? -0.0193 ? 5 'X-RAY DIFFRACTION' ? refined 4.8480 18.8990 -7.0180 0.0848 ? 0.0311 ? 0.0284 ? 0.0342 ? 0.0001 ? 0.1572 ? 4.3230 ? 0.2465 ? 0.1443 ? 5.0058 ? -0.0969 ? 6.6855 ? 0.2363 ? 0.2359 ? 0.3413 ? -0.3689 ? -0.2328 ? -0.0414 ? -0.2937 ? 0.1724 ? -0.0035 ? 6 'X-RAY DIFFRACTION' ? refined 10.7730 35.1720 -31.8810 0.3013 ? 0.0851 ? -0.0340 ? 0.2855 ? 0.1529 ? 0.3234 ? 2.9219 ? 0.9225 ? -1.5498 ? 5.5356 ? 2.8092 ? 8.6711 ? -0.1693 ? 0.1572 ? -0.0376 ? -0.1559 ? 0.0477 ? -0.3601 ? 0.4976 ? 1.1123 ? 0.1216 ? 7 'X-RAY DIFFRACTION' ? refined 7.3090 32.8940 -23.4300 0.3981 ? 0.1152 ? -0.0326 ? 0.1448 ? 0.1466 ? 0.3463 ? 2.2318 ? 0.0009 ? -1.4267 ? 2.7281 ? 0.3597 ? 5.5967 ? -0.0381 ? -0.0731 ? 0.0690 ? -0.3102 ? -0.3089 ? -0.0421 ? 0.3944 ? 0.5756 ? 0.3470 ? 8 'X-RAY DIFFRACTION' ? refined 6.1320 4.9730 -7.2380 0.1969 ? -0.0121 ? -0.0385 ? 0.0389 ? -0.0369 ? 0.2439 ? 5.0436 ? -1.4349 ? 0.1835 ? 3.6309 ? 0.2943 ? 4.5695 ? 0.1925 ? 0.1573 ? -0.4011 ? -0.1194 ? -0.2919 ? 0.2457 ? 0.5239 ? -0.2772 ? 0.0994 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 8 ? ? A 35 ? ? 2 'X-RAY DIFFRACTION' 2 ? ? A 36 ? ? A 82 ? ? 3 'X-RAY DIFFRACTION' 3 ? ? A 83 ? ? A 116 ? ? 4 'X-RAY DIFFRACTION' 4 ? ? A 117 ? ? A 153 ? ? 5 'X-RAY DIFFRACTION' 5 ? ? A 154 ? ? A 193 ? ? 6 'X-RAY DIFFRACTION' 6 ? ? A 194 ? ? A 256 ? ? 7 'X-RAY DIFFRACTION' 7 ? ? A 257 ? ? A 303 ? ? 8 'X-RAY DIFFRACTION' 8 ? ? A 304 ? ? A 346 ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A VAL 2 ? A VAL 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A LEU 4 ? A LEU 4 5 1 Y 1 A ARG 5 ? A ARG 5 6 1 Y 1 A ASP 6 ? A ASP 6 7 1 Y 1 A TRP 7 ? A TRP 7 8 1 Y 1 A SER 284 ? A SER 284 9 1 Y 1 A ILE 285 ? A ILE 285 10 1 Y 1 A GLY 286 ? A GLY 286 11 1 Y 1 A SER 287 ? A SER 287 12 1 Y 1 A GLU 347 ? A GLU 347 13 1 Y 1 A ARG 348 ? A ARG 348 14 1 Y 1 A GLU 349 ? A GLU 349 15 1 Y 1 A ILE 350 ? A ILE 350 16 1 Y 1 A GLN 351 ? A GLN 351 17 1 Y 1 A LYS 352 ? A LYS 352 18 1 Y 1 A ARG 353 ? A ARG 353 19 1 Y 1 A VAL 354 ? A VAL 354 20 1 Y 1 A SER 355 ? A SER 355 21 1 Y 1 A GLY 356 ? A GLY 356 22 1 Y 1 A SER 357 ? A SER 357 23 1 Y 1 A TYR 358 ? A TYR 358 24 1 Y 1 A GLU 359 ? A GLU 359 25 1 Y 1 A CYS 360 ? A CYS 360 26 1 Y 1 A TYR 361 ? A TYR 361 27 1 Y 1 A ILE 362 ? A ILE 362 28 1 Y 1 A GLY 363 ? A GLY 363 29 1 Y 1 A VAL 364 ? A VAL 364 30 1 Y 1 A ASP 365 ? A ASP 365 31 1 Y 1 A VAL 366 ? A VAL 366 32 1 Y 1 A THR 367 ? A THR 367 33 1 Y 1 A SER 368 ? A SER 368 34 1 Y 1 A LYS 369 ? A LYS 369 35 1 Y 1 A TYR 370 ? A TYR 370 36 1 Y 1 A ASP 371 ? A ASP 371 37 1 Y 1 A MET 372 ? A MET 372 38 1 Y 1 A ARG 373 ? A ARG 373 39 1 Y 1 A SER 374 ? A SER 374 40 1 Y 1 A ASP 375 ? A ASP 375 41 1 Y 1 A ASN 376 ? A ASN 376 42 1 Y 1 A MET 377 ? A MET 377 43 1 Y 1 A TRP 378 ? A TRP 378 44 1 Y 1 A LYS 379 ? A LYS 379 45 1 Y 1 A ARG 380 ? A ARG 380 46 1 Y 1 A TYR 381 ? A TYR 381 47 1 Y 1 A ALA 382 ? A ALA 382 48 1 Y 1 A ASP 383 ? A ASP 383 49 1 Y 1 A TYR 384 ? A TYR 384 50 1 Y 1 A LEU 385 ? A LEU 385 51 1 Y 1 A LEU 386 ? A LEU 386 52 1 Y 1 A LYS 387 ? A LYS 387 53 1 Y 1 A ILE 388 ? A ILE 388 54 1 Y 1 A TYR 389 ? A TYR 389 55 1 Y 1 A PHE 390 ? A PHE 390 56 1 Y 1 A GLN 391 ? A GLN 391 57 1 Y 1 A ALA 392 ? A ALA 392 58 1 Y 1 A LYS 393 ? A LYS 393 59 1 Y 1 A ALA 394 ? A ALA 394 60 1 Y 1 A ASN 395 ? A ASN 395 61 1 Y 1 A VAL 396 ? A VAL 396 62 1 Y 1 A LEU 397 ? A LEU 397 63 1 Y 1 A VAL 398 ? A VAL 398 64 1 Y 1 A VAL 399 ? A VAL 399 65 1 Y 1 A PHE 400 ? A PHE 400 66 1 Y 1 A PRO 401 ? A PRO 401 67 1 Y 1 A SER 402 ? A SER 402 68 1 Y 1 A TYR 403 ? A TYR 403 69 1 Y 1 A GLU 404 ? A GLU 404 70 1 Y 1 A ILE 405 ? A ILE 405 71 1 Y 1 A MET 406 ? A MET 406 72 1 Y 1 A ASP 407 ? A ASP 407 73 1 Y 1 A ARG 408 ? A ARG 408 74 1 Y 1 A VAL 409 ? A VAL 409 75 1 Y 1 A MET 410 ? A MET 410 76 1 Y 1 A SER 411 ? A SER 411 77 1 Y 1 A ARG 412 ? A ARG 412 78 1 Y 1 A ILE 413 ? A ILE 413 79 1 Y 1 A SER 414 ? A SER 414 80 1 Y 1 A LEU 415 ? A LEU 415 81 1 Y 1 A PRO 416 ? A PRO 416 82 1 Y 1 A LYS 417 ? A LYS 417 83 1 Y 1 A TYR 418 ? A TYR 418 84 1 Y 1 A VAL 419 ? A VAL 419 85 1 Y 1 A GLU 420 ? A GLU 420 86 1 Y 1 A SER 421 ? A SER 421 87 1 Y 1 A GLU 422 ? A GLU 422 88 1 Y 1 A ASP 423 ? A ASP 423 89 1 Y 1 A SER 424 ? A SER 424 90 1 Y 1 A SER 425 ? A SER 425 91 1 Y 1 A VAL 426 ? A VAL 426 92 1 Y 1 A GLU 427 ? A GLU 427 93 1 Y 1 A ASP 428 ? A ASP 428 94 1 Y 1 A LEU 429 ? A LEU 429 95 1 Y 1 A TYR 430 ? A TYR 430 96 1 Y 1 A SER 431 ? A SER 431 97 1 Y 1 A ALA 432 ? A ALA 432 98 1 Y 1 A ILE 433 ? A ILE 433 99 1 Y 1 A SER 434 ? A SER 434 100 1 Y 1 A ALA 435 ? A ALA 435 101 1 Y 1 A ASN 436 ? A ASN 436 102 1 Y 1 A ASN 437 ? A ASN 437 103 1 Y 1 A LYS 438 ? A LYS 438 104 1 Y 1 A VAL 439 ? A VAL 439 105 1 Y 1 A LEU 440 ? A LEU 440 106 1 Y 1 A ILE 441 ? A ILE 441 107 1 Y 1 A GLY 442 ? A GLY 442 108 1 Y 1 A SER 443 ? A SER 443 109 1 Y 1 A VAL 444 ? A VAL 444 110 1 Y 1 A GLY 445 ? A GLY 445 111 1 Y 1 A LYS 446 ? A LYS 446 112 1 Y 1 A GLY 447 ? A GLY 447 113 1 Y 1 A LYS 448 ? A LYS 448 114 1 Y 1 A LEU 449 ? A LEU 449 115 1 Y 1 A ALA 450 ? A ALA 450 116 1 Y 1 A GLU 451 ? A GLU 451 117 1 Y 1 A GLY 452 ? A GLY 452 118 1 Y 1 A ILE 453 ? A ILE 453 119 1 Y 1 A GLU 454 ? A GLU 454 120 1 Y 1 A LEU 455 ? A LEU 455 121 1 Y 1 A ARG 456 ? A ARG 456 122 1 Y 1 A ASN 457 ? A ASN 457 123 1 Y 1 A ASN 458 ? A ASN 458 124 1 Y 1 A ASP 459 ? A ASP 459 125 1 Y 1 A ARG 460 ? A ARG 460 126 1 Y 1 A SER 461 ? A SER 461 127 1 Y 1 A LEU 462 ? A LEU 462 128 1 Y 1 A ILE 463 ? A ILE 463 129 1 Y 1 A SER 464 ? A SER 464 130 1 Y 1 A ASP 465 ? A ASP 465 131 1 Y 1 A VAL 466 ? A VAL 466 132 1 Y 1 A VAL 467 ? A VAL 467 133 1 Y 1 A ILE 468 ? A ILE 468 134 1 Y 1 A VAL 469 ? A VAL 469 135 1 Y 1 A GLY 470 ? A GLY 470 136 1 Y 1 A ILE 471 ? A ILE 471 137 1 Y 1 A PRO 472 ? A PRO 472 138 1 Y 1 A TYR 473 ? A TYR 473 139 1 Y 1 A PRO 474 ? A PRO 474 140 1 Y 1 A PRO 475 ? A PRO 475 141 1 Y 1 A PRO 476 ? A PRO 476 142 1 Y 1 A ASP 477 ? A ASP 477 143 1 Y 1 A ASP 478 ? A ASP 478 144 1 Y 1 A TYR 479 ? A TYR 479 145 1 Y 1 A LEU 480 ? A LEU 480 146 1 Y 1 A LYS 481 ? A LYS 481 147 1 Y 1 A ILE 482 ? A ILE 482 148 1 Y 1 A LEU 483 ? A LEU 483 149 1 Y 1 A ALA 484 ? A ALA 484 150 1 Y 1 A GLN 485 ? A GLN 485 151 1 Y 1 A ARG 486 ? A ARG 486 152 1 Y 1 A VAL 487 ? A VAL 487 153 1 Y 1 A SER 488 ? A SER 488 154 1 Y 1 A LEU 489 ? A LEU 489 155 1 Y 1 A LYS 490 ? A LYS 490 156 1 Y 1 A MET 491 ? A MET 491 157 1 Y 1 A ASN 492 ? A ASN 492 158 1 Y 1 A ARG 493 ? A ARG 493 159 1 Y 1 A GLU 494 ? A GLU 494 160 1 Y 1 A ASN 495 ? A ASN 495 161 1 Y 1 A GLU 496 ? A GLU 496 162 1 Y 1 A GLU 497 ? A GLU 497 163 1 Y 1 A PHE 498 ? A PHE 498 164 1 Y 1 A LEU 499 ? A LEU 499 165 1 Y 1 A PHE 500 ? A PHE 500 166 1 Y 1 A LYS 501 ? A LYS 501 167 1 Y 1 A ILE 502 ? A ILE 502 168 1 Y 1 A PRO 503 ? A PRO 503 169 1 Y 1 A ALA 504 ? A ALA 504 170 1 Y 1 A LEU 505 ? A LEU 505 171 1 Y 1 A VAL 506 ? A VAL 506 172 1 Y 1 A THR 507 ? A THR 507 173 1 Y 1 A ILE 508 ? A ILE 508 174 1 Y 1 A LYS 509 ? A LYS 509 175 1 Y 1 A GLN 510 ? A GLN 510 176 1 Y 1 A ALA 511 ? A ALA 511 177 1 Y 1 A ILE 512 ? A ILE 512 178 1 Y 1 A GLY 513 ? A GLY 513 179 1 Y 1 A ARG 514 ? A ARG 514 180 1 Y 1 A ALA 515 ? A ALA 515 181 1 Y 1 A ILE 516 ? A ILE 516 182 1 Y 1 A ARG 517 ? A ARG 517 183 1 Y 1 A ASP 518 ? A ASP 518 184 1 Y 1 A VAL 519 ? A VAL 519 185 1 Y 1 A ASN 520 ? A ASN 520 186 1 Y 1 A ASP 521 ? A ASP 521 187 1 Y 1 A LYS 522 ? A LYS 522 188 1 Y 1 A CYS 523 ? A CYS 523 189 1 Y 1 A ASN 524 ? A ASN 524 190 1 Y 1 A VAL 525 ? A VAL 525 191 1 Y 1 A TRP 526 ? A TRP 526 192 1 Y 1 A LEU 527 ? A LEU 527 193 1 Y 1 A LEU 528 ? A LEU 528 194 1 Y 1 A ASP 529 ? A ASP 529 195 1 Y 1 A LYS 530 ? A LYS 530 196 1 Y 1 A ARG 531 ? A ARG 531 197 1 Y 1 A PHE 532 ? A PHE 532 198 1 Y 1 A GLU 533 ? A GLU 533 199 1 Y 1 A SER 534 ? A SER 534 200 1 Y 1 A LEU 535 ? A LEU 535 201 1 Y 1 A TYR 536 ? A TYR 536 202 1 Y 1 A TRP 537 ? A TRP 537 203 1 Y 1 A LYS 538 ? A LYS 538 204 1 Y 1 A LYS 539 ? A LYS 539 205 1 Y 1 A ASN 540 ? A ASN 540 206 1 Y 1 A LEU 541 ? A LEU 541 207 1 Y 1 A LYS 542 ? A LYS 542 208 1 Y 1 A CYS 543 ? A CYS 543 209 1 Y 1 A LEU 544 ? A LEU 544 210 1 Y 1 A ASN 545 ? A ASN 545 211 1 Y 1 A ALA 546 ? A ALA 546 212 1 Y 1 A ASN 547 ? A ASN 547 213 1 Y 1 A LYS 548 ? A LYS 548 214 1 Y 1 A MET 549 ? A MET 549 215 1 Y 1 A LYS 550 ? A LYS 550 216 1 Y 1 A LEU 551 ? A LEU 551 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 SF4 FE1 FE N N 304 SF4 FE2 FE N N 305 SF4 FE3 FE N N 306 SF4 FE4 FE N N 307 SF4 S1 S N N 308 SF4 S2 S N N 309 SF4 S3 S N N 310 SF4 S4 S N N 311 THR N N N N 312 THR CA C N S 313 THR C C N N 314 THR O O N N 315 THR CB C N R 316 THR OG1 O N N 317 THR CG2 C N N 318 THR OXT O N N 319 THR H H N N 320 THR H2 H N N 321 THR HA H N N 322 THR HB H N N 323 THR HG1 H N N 324 THR HG21 H N N 325 THR HG22 H N N 326 THR HG23 H N N 327 THR HXT H N N 328 TRP N N N N 329 TRP CA C N S 330 TRP C C N N 331 TRP O O N N 332 TRP CB C N N 333 TRP CG C Y N 334 TRP CD1 C Y N 335 TRP CD2 C Y N 336 TRP NE1 N Y N 337 TRP CE2 C Y N 338 TRP CE3 C Y N 339 TRP CZ2 C Y N 340 TRP CZ3 C Y N 341 TRP CH2 C Y N 342 TRP OXT O N N 343 TRP H H N N 344 TRP H2 H N N 345 TRP HA H N N 346 TRP HB2 H N N 347 TRP HB3 H N N 348 TRP HD1 H N N 349 TRP HE1 H N N 350 TRP HE3 H N N 351 TRP HZ2 H N N 352 TRP HZ3 H N N 353 TRP HH2 H N N 354 TRP HXT H N N 355 TYR N N N N 356 TYR CA C N S 357 TYR C C N N 358 TYR O O N N 359 TYR CB C N N 360 TYR CG C Y N 361 TYR CD1 C Y N 362 TYR CD2 C Y N 363 TYR CE1 C Y N 364 TYR CE2 C Y N 365 TYR CZ C Y N 366 TYR OH O N N 367 TYR OXT O N N 368 TYR H H N N 369 TYR H2 H N N 370 TYR HA H N N 371 TYR HB2 H N N 372 TYR HB3 H N N 373 TYR HD1 H N N 374 TYR HD2 H N N 375 TYR HE1 H N N 376 TYR HE2 H N N 377 TYR HH H N N 378 TYR HXT H N N 379 VAL N N N N 380 VAL CA C N S 381 VAL C C N N 382 VAL O O N N 383 VAL CB C N N 384 VAL CG1 C N N 385 VAL CG2 C N N 386 VAL OXT O N N 387 VAL H H N N 388 VAL H2 H N N 389 VAL HA H N N 390 VAL HB H N N 391 VAL HG11 H N N 392 VAL HG12 H N N 393 VAL HG13 H N N 394 VAL HG21 H N N 395 VAL HG22 H N N 396 VAL HG23 H N N 397 VAL HXT H N N 398 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SF4 FE1 S2 sing N N 290 SF4 FE1 S3 sing N N 291 SF4 FE1 S4 sing N N 292 SF4 FE2 S1 sing N N 293 SF4 FE2 S3 sing N N 294 SF4 FE2 S4 sing N N 295 SF4 FE3 S1 sing N N 296 SF4 FE3 S2 sing N N 297 SF4 FE3 S4 sing N N 298 SF4 FE4 S1 sing N N 299 SF4 FE4 S2 sing N N 300 SF4 FE4 S3 sing N N 301 THR N CA sing N N 302 THR N H sing N N 303 THR N H2 sing N N 304 THR CA C sing N N 305 THR CA CB sing N N 306 THR CA HA sing N N 307 THR C O doub N N 308 THR C OXT sing N N 309 THR CB OG1 sing N N 310 THR CB CG2 sing N N 311 THR CB HB sing N N 312 THR OG1 HG1 sing N N 313 THR CG2 HG21 sing N N 314 THR CG2 HG22 sing N N 315 THR CG2 HG23 sing N N 316 THR OXT HXT sing N N 317 TRP N CA sing N N 318 TRP N H sing N N 319 TRP N H2 sing N N 320 TRP CA C sing N N 321 TRP CA CB sing N N 322 TRP CA HA sing N N 323 TRP C O doub N N 324 TRP C OXT sing N N 325 TRP CB CG sing N N 326 TRP CB HB2 sing N N 327 TRP CB HB3 sing N N 328 TRP CG CD1 doub Y N 329 TRP CG CD2 sing Y N 330 TRP CD1 NE1 sing Y N 331 TRP CD1 HD1 sing N N 332 TRP CD2 CE2 doub Y N 333 TRP CD2 CE3 sing Y N 334 TRP NE1 CE2 sing Y N 335 TRP NE1 HE1 sing N N 336 TRP CE2 CZ2 sing Y N 337 TRP CE3 CZ3 doub Y N 338 TRP CE3 HE3 sing N N 339 TRP CZ2 CH2 doub Y N 340 TRP CZ2 HZ2 sing N N 341 TRP CZ3 CH2 sing Y N 342 TRP CZ3 HZ3 sing N N 343 TRP CH2 HH2 sing N N 344 TRP OXT HXT sing N N 345 TYR N CA sing N N 346 TYR N H sing N N 347 TYR N H2 sing N N 348 TYR CA C sing N N 349 TYR CA CB sing N N 350 TYR CA HA sing N N 351 TYR C O doub N N 352 TYR C OXT sing N N 353 TYR CB CG sing N N 354 TYR CB HB2 sing N N 355 TYR CB HB3 sing N N 356 TYR CG CD1 doub Y N 357 TYR CG CD2 sing Y N 358 TYR CD1 CE1 sing Y N 359 TYR CD1 HD1 sing N N 360 TYR CD2 CE2 doub Y N 361 TYR CD2 HD2 sing N N 362 TYR CE1 CZ doub Y N 363 TYR CE1 HE1 sing N N 364 TYR CE2 CZ sing Y N 365 TYR CE2 HE2 sing N N 366 TYR CZ OH sing N N 367 TYR OH HH sing N N 368 TYR OXT HXT sing N N 369 VAL N CA sing N N 370 VAL N H sing N N 371 VAL N H2 sing N N 372 VAL CA C sing N N 373 VAL CA CB sing N N 374 VAL CA HA sing N N 375 VAL C O doub N N 376 VAL C OXT sing N N 377 VAL CB CG1 sing N N 378 VAL CB CG2 sing N N 379 VAL CB HB sing N N 380 VAL CG1 HG11 sing N N 381 VAL CG1 HG12 sing N N 382 VAL CG1 HG13 sing N N 383 VAL CG2 HG21 sing N N 384 VAL CG2 HG22 sing N N 385 VAL CG2 HG23 sing N N 386 VAL OXT HXT sing N N 387 # _atom_sites.entry_id 5H8C _atom_sites.fract_transf_matrix[1][1] 0.015432 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012853 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010046 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_