data_5HY3 # _entry.id 5HY3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5HY3 pdb_00005hy3 10.2210/pdb5hy3/pdb WWPDB D_1000217919 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-06-22 2 'Structure model' 1 1 2016-09-07 3 'Structure model' 1 2 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' citation 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model 6 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5HY3 _pdbx_database_status.recvd_initial_deposition_date 2016-02-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wan, H.' 1 'Gao, Z.Q.' 2 'Dong, Y.H.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Mol.Microbiol. _citation.journal_id_ASTM MOMIEE _citation.journal_id_CSD 2007 _citation.journal_id_ISSN 1365-2958 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 101 _citation.language ? _citation.page_first 757 _citation.page_last 769 _citation.title 'Structural insights into the inhibition mechanism of bacterial toxin LsoA by bacteriophage antitoxin Dmd' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/mmi.13420 _citation.pdbx_database_id_PubMed 27169810 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wan, H.' 1 ? primary 'Otsuka, Y.' 2 ? primary 'Gao, Z.Q.' 3 ? primary 'Wei, Y.' 4 ? primary 'Chen, Z.' 5 ? primary 'Masuda, M.' 6 ? primary 'Yonesaki, T.' 7 ? primary 'Zhang, H.' 8 ? primary 'Dong, Y.H.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'mRNA endoribonuclease LsoA' 39622.914 1 3.1.-.- ? ? ? 2 polymer man 'Antitoxin Dmd' 7036.255 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Toxin LsoA' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MAQNPFKALNINIDKIESALTQNGVTNYSSNVKNERETHISGTYKGIDFLIKLMPSGGNTTIGRASGQNNTYFDEIALII KENCLYSDTKNFEYTIPKFSDDDRANLFEFLSEEGITITEDNNNDPNCKHQYIMTTSNGDRVRAKIYKRGSIQFQGKYLQ IASLINDFMCSILNMKEIVEQKNKEFNVDIKKETIESELHSKLPKSIDKIHEDIKKQLSCSLIMKKIDVEMEDYSTYCFS ALRAIEGFIYQILNDVCNPSSSKNLGEYFTENKPKYIIREIHQETINGEIAEVLCECYTYWHENRHGLFHMKPGIADTKT INKLESIAIIDTVCQLIDGGVARLKL ; ;MAQNPFKALNINIDKIESALTQNGVTNYSSNVKNERETHISGTYKGIDFLIKLMPSGGNTTIGRASGQNNTYFDEIALII KENCLYSDTKNFEYTIPKFSDDDRANLFEFLSEEGITITEDNNNDPNCKHQYIMTTSNGDRVRAKIYKRGSIQFQGKYLQ IASLINDFMCSILNMKEIVEQKNKEFNVDIKKETIESELHSKLPKSIDKIHEDIKKQLSCSLIMKKIDVEMEDYSTYCFS ALRAIEGFIYQILNDVCNPSSSKNLGEYFTENKPKYIIREIHQETINGEIAEVLCECYTYWHENRHGLFHMKPGIADTKT INKLESIAIIDTVCQLIDGGVARLKL ; A ? 2 'polypeptide(L)' no no MELVKVVFMGWFKNESMFTKEITMMKDDVQWATTQYAEVNKALVKAFIDDKKVCEVDCRG MELVKVVFMGWFKNESMFTKEITMMKDDVQWATTQYAEVNKALVKAFIDDKKVCEVDCRG B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLN n 1 4 ASN n 1 5 PRO n 1 6 PHE n 1 7 LYS n 1 8 ALA n 1 9 LEU n 1 10 ASN n 1 11 ILE n 1 12 ASN n 1 13 ILE n 1 14 ASP n 1 15 LYS n 1 16 ILE n 1 17 GLU n 1 18 SER n 1 19 ALA n 1 20 LEU n 1 21 THR n 1 22 GLN n 1 23 ASN n 1 24 GLY n 1 25 VAL n 1 26 THR n 1 27 ASN n 1 28 TYR n 1 29 SER n 1 30 SER n 1 31 ASN n 1 32 VAL n 1 33 LYS n 1 34 ASN n 1 35 GLU n 1 36 ARG n 1 37 GLU n 1 38 THR n 1 39 HIS n 1 40 ILE n 1 41 SER n 1 42 GLY n 1 43 THR n 1 44 TYR n 1 45 LYS n 1 46 GLY n 1 47 ILE n 1 48 ASP n 1 49 PHE n 1 50 LEU n 1 51 ILE n 1 52 LYS n 1 53 LEU n 1 54 MET n 1 55 PRO n 1 56 SER n 1 57 GLY n 1 58 GLY n 1 59 ASN n 1 60 THR n 1 61 THR n 1 62 ILE n 1 63 GLY n 1 64 ARG n 1 65 ALA n 1 66 SER n 1 67 GLY n 1 68 GLN n 1 69 ASN n 1 70 ASN n 1 71 THR n 1 72 TYR n 1 73 PHE n 1 74 ASP n 1 75 GLU n 1 76 ILE n 1 77 ALA n 1 78 LEU n 1 79 ILE n 1 80 ILE n 1 81 LYS n 1 82 GLU n 1 83 ASN n 1 84 CYS n 1 85 LEU n 1 86 TYR n 1 87 SER n 1 88 ASP n 1 89 THR n 1 90 LYS n 1 91 ASN n 1 92 PHE n 1 93 GLU n 1 94 TYR n 1 95 THR n 1 96 ILE n 1 97 PRO n 1 98 LYS n 1 99 PHE n 1 100 SER n 1 101 ASP n 1 102 ASP n 1 103 ASP n 1 104 ARG n 1 105 ALA n 1 106 ASN n 1 107 LEU n 1 108 PHE n 1 109 GLU n 1 110 PHE n 1 111 LEU n 1 112 SER n 1 113 GLU n 1 114 GLU n 1 115 GLY n 1 116 ILE n 1 117 THR n 1 118 ILE n 1 119 THR n 1 120 GLU n 1 121 ASP n 1 122 ASN n 1 123 ASN n 1 124 ASN n 1 125 ASP n 1 126 PRO n 1 127 ASN n 1 128 CYS n 1 129 LYS n 1 130 HIS n 1 131 GLN n 1 132 TYR n 1 133 ILE n 1 134 MET n 1 135 THR n 1 136 THR n 1 137 SER n 1 138 ASN n 1 139 GLY n 1 140 ASP n 1 141 ARG n 1 142 VAL n 1 143 ARG n 1 144 ALA n 1 145 LYS n 1 146 ILE n 1 147 TYR n 1 148 LYS n 1 149 ARG n 1 150 GLY n 1 151 SER n 1 152 ILE n 1 153 GLN n 1 154 PHE n 1 155 GLN n 1 156 GLY n 1 157 LYS n 1 158 TYR n 1 159 LEU n 1 160 GLN n 1 161 ILE n 1 162 ALA n 1 163 SER n 1 164 LEU n 1 165 ILE n 1 166 ASN n 1 167 ASP n 1 168 PHE n 1 169 MET n 1 170 CYS n 1 171 SER n 1 172 ILE n 1 173 LEU n 1 174 ASN n 1 175 MET n 1 176 LYS n 1 177 GLU n 1 178 ILE n 1 179 VAL n 1 180 GLU n 1 181 GLN n 1 182 LYS n 1 183 ASN n 1 184 LYS n 1 185 GLU n 1 186 PHE n 1 187 ASN n 1 188 VAL n 1 189 ASP n 1 190 ILE n 1 191 LYS n 1 192 LYS n 1 193 GLU n 1 194 THR n 1 195 ILE n 1 196 GLU n 1 197 SER n 1 198 GLU n 1 199 LEU n 1 200 HIS n 1 201 SER n 1 202 LYS n 1 203 LEU n 1 204 PRO n 1 205 LYS n 1 206 SER n 1 207 ILE n 1 208 ASP n 1 209 LYS n 1 210 ILE n 1 211 HIS n 1 212 GLU n 1 213 ASP n 1 214 ILE n 1 215 LYS n 1 216 LYS n 1 217 GLN n 1 218 LEU n 1 219 SER n 1 220 CYS n 1 221 SER n 1 222 LEU n 1 223 ILE n 1 224 MET n 1 225 LYS n 1 226 LYS n 1 227 ILE n 1 228 ASP n 1 229 VAL n 1 230 GLU n 1 231 MET n 1 232 GLU n 1 233 ASP n 1 234 TYR n 1 235 SER n 1 236 THR n 1 237 TYR n 1 238 CYS n 1 239 PHE n 1 240 SER n 1 241 ALA n 1 242 LEU n 1 243 ARG n 1 244 ALA n 1 245 ILE n 1 246 GLU n 1 247 GLY n 1 248 PHE n 1 249 ILE n 1 250 TYR n 1 251 GLN n 1 252 ILE n 1 253 LEU n 1 254 ASN n 1 255 ASP n 1 256 VAL n 1 257 CYS n 1 258 ASN n 1 259 PRO n 1 260 SER n 1 261 SER n 1 262 SER n 1 263 LYS n 1 264 ASN n 1 265 LEU n 1 266 GLY n 1 267 GLU n 1 268 TYR n 1 269 PHE n 1 270 THR n 1 271 GLU n 1 272 ASN n 1 273 LYS n 1 274 PRO n 1 275 LYS n 1 276 TYR n 1 277 ILE n 1 278 ILE n 1 279 ARG n 1 280 GLU n 1 281 ILE n 1 282 HIS n 1 283 GLN n 1 284 GLU n 1 285 THR n 1 286 ILE n 1 287 ASN n 1 288 GLY n 1 289 GLU n 1 290 ILE n 1 291 ALA n 1 292 GLU n 1 293 VAL n 1 294 LEU n 1 295 CYS n 1 296 GLU n 1 297 CYS n 1 298 TYR n 1 299 THR n 1 300 TYR n 1 301 TRP n 1 302 HIS n 1 303 GLU n 1 304 ASN n 1 305 ARG n 1 306 HIS n 1 307 GLY n 1 308 LEU n 1 309 PHE n 1 310 HIS n 1 311 MET n 1 312 LYS n 1 313 PRO n 1 314 GLY n 1 315 ILE n 1 316 ALA n 1 317 ASP n 1 318 THR n 1 319 LYS n 1 320 THR n 1 321 ILE n 1 322 ASN n 1 323 LYS n 1 324 LEU n 1 325 GLU n 1 326 SER n 1 327 ILE n 1 328 ALA n 1 329 ILE n 1 330 ILE n 1 331 ASP n 1 332 THR n 1 333 VAL n 1 334 CYS n 1 335 GLN n 1 336 LEU n 1 337 ILE n 1 338 ASP n 1 339 GLY n 1 340 GLY n 1 341 VAL n 1 342 ALA n 1 343 ARG n 1 344 LEU n 1 345 LYS n 1 346 LEU n 2 1 MET n 2 2 GLU n 2 3 LEU n 2 4 VAL n 2 5 LYS n 2 6 VAL n 2 7 VAL n 2 8 PHE n 2 9 MET n 2 10 GLY n 2 11 TRP n 2 12 PHE n 2 13 LYS n 2 14 ASN n 2 15 GLU n 2 16 SER n 2 17 MET n 2 18 PHE n 2 19 THR n 2 20 LYS n 2 21 GLU n 2 22 ILE n 2 23 THR n 2 24 MET n 2 25 MET n 2 26 LYS n 2 27 ASP n 2 28 ASP n 2 29 VAL n 2 30 GLN n 2 31 TRP n 2 32 ALA n 2 33 THR n 2 34 THR n 2 35 GLN n 2 36 TYR n 2 37 ALA n 2 38 GLU n 2 39 VAL n 2 40 ASN n 2 41 LYS n 2 42 ALA n 2 43 LEU n 2 44 VAL n 2 45 LYS n 2 46 ALA n 2 47 PHE n 2 48 ILE n 2 49 ASP n 2 50 ASP n 2 51 LYS n 2 52 LYS n 2 53 VAL n 2 54 CYS n 2 55 GLU n 2 56 VAL n 2 57 ASP n 2 58 CYS n 2 59 ARG n 2 60 GLY n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 346 ? ? lsoA ? ? ? ? ? ? 'Escherichia coli O157:H7' 83334 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 60 ? ? 'dmd, 61.5, y02B' ? ? ? ? ? ? 'Enterobacteria phage T4' 10665 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 ASN 4 4 ? ? ? A . n A 1 5 PRO 5 5 ? ? ? A . n A 1 6 PHE 6 6 ? ? ? A . n A 1 7 LYS 7 7 ? ? ? A . n A 1 8 ALA 8 8 ? ? ? A . n A 1 9 LEU 9 9 ? ? ? A . n A 1 10 ASN 10 10 ? ? ? A . n A 1 11 ILE 11 11 ? ? ? A . n A 1 12 ASN 12 12 ? ? ? A . n A 1 13 ILE 13 13 ? ? ? A . n A 1 14 ASP 14 14 ? ? ? A . n A 1 15 LYS 15 15 ? ? ? A . n A 1 16 ILE 16 16 ? ? ? A . n A 1 17 GLU 17 17 ? ? ? A . n A 1 18 SER 18 18 ? ? ? A . n A 1 19 ALA 19 19 ? ? ? A . n A 1 20 LEU 20 20 ? ? ? A . n A 1 21 THR 21 21 ? ? ? A . n A 1 22 GLN 22 22 ? ? ? A . n A 1 23 ASN 23 23 ? ? ? A . n A 1 24 GLY 24 24 ? ? ? A . n A 1 25 VAL 25 25 ? ? ? A . n A 1 26 THR 26 26 ? ? ? A . n A 1 27 ASN 27 27 ? ? ? A . n A 1 28 TYR 28 28 ? ? ? A . n A 1 29 SER 29 29 ? ? ? A . n A 1 30 SER 30 30 ? ? ? A . n A 1 31 ASN 31 31 ? ? ? A . n A 1 32 VAL 32 32 ? ? ? A . n A 1 33 LYS 33 33 ? ? ? A . n A 1 34 ASN 34 34 ? ? ? A . n A 1 35 GLU 35 35 ? ? ? A . n A 1 36 ARG 36 36 ? ? ? A . n A 1 37 GLU 37 37 ? ? ? A . n A 1 38 THR 38 38 ? ? ? A . n A 1 39 HIS 39 39 ? ? ? A . n A 1 40 ILE 40 40 ? ? ? A . n A 1 41 SER 41 41 ? ? ? A . n A 1 42 GLY 42 42 ? ? ? A . n A 1 43 THR 43 43 ? ? ? A . n A 1 44 TYR 44 44 ? ? ? A . n A 1 45 LYS 45 45 ? ? ? A . n A 1 46 GLY 46 46 ? ? ? A . n A 1 47 ILE 47 47 ? ? ? A . n A 1 48 ASP 48 48 ? ? ? A . n A 1 49 PHE 49 49 ? ? ? A . n A 1 50 LEU 50 50 ? ? ? A . n A 1 51 ILE 51 51 ? ? ? A . n A 1 52 LYS 52 52 ? ? ? A . n A 1 53 LEU 53 53 ? ? ? A . n A 1 54 MET 54 54 ? ? ? A . n A 1 55 PRO 55 55 ? ? ? A . n A 1 56 SER 56 56 ? ? ? A . n A 1 57 GLY 57 57 ? ? ? A . n A 1 58 GLY 58 58 ? ? ? A . n A 1 59 ASN 59 59 ? ? ? A . n A 1 60 THR 60 60 ? ? ? A . n A 1 61 THR 61 61 ? ? ? A . n A 1 62 ILE 62 62 ? ? ? A . n A 1 63 GLY 63 63 ? ? ? A . n A 1 64 ARG 64 64 ? ? ? A . n A 1 65 ALA 65 65 ? ? ? A . n A 1 66 SER 66 66 ? ? ? A . n A 1 67 GLY 67 67 ? ? ? A . n A 1 68 GLN 68 68 ? ? ? A . n A 1 69 ASN 69 69 ? ? ? A . n A 1 70 ASN 70 70 ? ? ? A . n A 1 71 THR 71 71 ? ? ? A . n A 1 72 TYR 72 72 ? ? ? A . n A 1 73 PHE 73 73 ? ? ? A . n A 1 74 ASP 74 74 ? ? ? A . n A 1 75 GLU 75 75 ? ? ? A . n A 1 76 ILE 76 76 ? ? ? A . n A 1 77 ALA 77 77 ? ? ? A . n A 1 78 LEU 78 78 ? ? ? A . n A 1 79 ILE 79 79 ? ? ? A . n A 1 80 ILE 80 80 ? ? ? A . n A 1 81 LYS 81 81 ? ? ? A . n A 1 82 GLU 82 82 ? ? ? A . n A 1 83 ASN 83 83 ? ? ? A . n A 1 84 CYS 84 84 ? ? ? A . n A 1 85 LEU 85 85 ? ? ? A . n A 1 86 TYR 86 86 ? ? ? A . n A 1 87 SER 87 87 ? ? ? A . n A 1 88 ASP 88 88 ? ? ? A . n A 1 89 THR 89 89 ? ? ? A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 CYS 128 128 128 CYS CYS A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 HIS 130 130 130 HIS HIS A . n A 1 131 GLN 131 131 131 GLN GLN A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 MET 134 134 134 MET MET A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 TYR 147 147 ? ? ? A . n A 1 148 LYS 148 148 ? ? ? A . n A 1 149 ARG 149 149 ? ? ? A . n A 1 150 GLY 150 150 ? ? ? A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 TYR 158 158 158 TYR TYR A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 GLN 160 160 160 GLN GLN A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 ILE 165 165 165 ILE ILE A . n A 1 166 ASN 166 166 166 ASN ASN A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 PHE 168 168 168 PHE PHE A . n A 1 169 MET 169 169 169 MET MET A . n A 1 170 CYS 170 170 170 CYS CYS A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 ASN 174 174 174 ASN ASN A . n A 1 175 MET 175 175 175 MET MET A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 ILE 178 178 178 ILE ILE A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 GLN 181 181 181 GLN GLN A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 ASN 183 183 183 ASN ASN A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 PHE 186 186 186 PHE PHE A . n A 1 187 ASN 187 187 187 ASN ASN A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 ASP 189 189 189 ASP ASP A . n A 1 190 ILE 190 190 190 ILE ILE A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 LYS 192 192 192 LYS LYS A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 THR 194 194 194 THR THR A . n A 1 195 ILE 195 195 195 ILE ILE A . n A 1 196 GLU 196 196 196 GLU GLU A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 GLU 198 198 198 GLU GLU A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 HIS 200 200 200 HIS HIS A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 LYS 202 202 202 LYS LYS A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 PRO 204 204 204 PRO PRO A . n A 1 205 LYS 205 205 205 LYS LYS A . n A 1 206 SER 206 206 206 SER SER A . n A 1 207 ILE 207 207 207 ILE ILE A . n A 1 208 ASP 208 208 208 ASP ASP A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 ILE 210 210 210 ILE ILE A . n A 1 211 HIS 211 211 211 HIS HIS A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 ASP 213 213 213 ASP ASP A . n A 1 214 ILE 214 214 214 ILE ILE A . n A 1 215 LYS 215 215 215 LYS LYS A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 GLN 217 217 217 GLN GLN A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 SER 219 219 219 SER SER A . n A 1 220 CYS 220 220 220 CYS CYS A . n A 1 221 SER 221 221 221 SER SER A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 ILE 223 223 223 ILE ILE A . n A 1 224 MET 224 224 224 MET MET A . n A 1 225 LYS 225 225 225 LYS LYS A . n A 1 226 LYS 226 226 226 LYS LYS A . n A 1 227 ILE 227 227 227 ILE ILE A . n A 1 228 ASP 228 228 228 ASP ASP A . n A 1 229 VAL 229 229 229 VAL VAL A . n A 1 230 GLU 230 230 230 GLU GLU A . n A 1 231 MET 231 231 231 MET MET A . n A 1 232 GLU 232 232 232 GLU GLU A . n A 1 233 ASP 233 233 233 ASP ASP A . n A 1 234 TYR 234 234 234 TYR TYR A . n A 1 235 SER 235 235 235 SER SER A . n A 1 236 THR 236 236 236 THR THR A . n A 1 237 TYR 237 237 237 TYR TYR A . n A 1 238 CYS 238 238 238 CYS CYS A . n A 1 239 PHE 239 239 239 PHE PHE A . n A 1 240 SER 240 240 240 SER SER A . n A 1 241 ALA 241 241 241 ALA ALA A . n A 1 242 LEU 242 242 242 LEU LEU A . n A 1 243 ARG 243 243 243 ARG ARG A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 ILE 245 245 245 ILE ILE A . n A 1 246 GLU 246 246 246 GLU GLU A . n A 1 247 GLY 247 247 247 GLY GLY A . n A 1 248 PHE 248 248 248 PHE PHE A . n A 1 249 ILE 249 249 249 ILE ILE A . n A 1 250 TYR 250 250 250 TYR TYR A . n A 1 251 GLN 251 251 251 GLN GLN A . n A 1 252 ILE 252 252 252 ILE ILE A . n A 1 253 LEU 253 253 253 LEU LEU A . n A 1 254 ASN 254 254 254 ASN ASN A . n A 1 255 ASP 255 255 255 ASP ASP A . n A 1 256 VAL 256 256 256 VAL VAL A . n A 1 257 CYS 257 257 257 CYS CYS A . n A 1 258 ASN 258 258 258 ASN ASN A . n A 1 259 PRO 259 259 259 PRO PRO A . n A 1 260 SER 260 260 260 SER SER A . n A 1 261 SER 261 261 261 SER SER A . n A 1 262 SER 262 262 262 SER SER A . n A 1 263 LYS 263 263 263 LYS LYS A . n A 1 264 ASN 264 264 264 ASN ASN A . n A 1 265 LEU 265 265 265 LEU LEU A . n A 1 266 GLY 266 266 266 GLY GLY A . n A 1 267 GLU 267 267 267 GLU GLU A . n A 1 268 TYR 268 268 268 TYR TYR A . n A 1 269 PHE 269 269 269 PHE PHE A . n A 1 270 THR 270 270 270 THR THR A . n A 1 271 GLU 271 271 271 GLU GLU A . n A 1 272 ASN 272 272 272 ASN ASN A . n A 1 273 LYS 273 273 273 LYS LYS A . n A 1 274 PRO 274 274 274 PRO PRO A . n A 1 275 LYS 275 275 275 LYS LYS A . n A 1 276 TYR 276 276 276 TYR TYR A . n A 1 277 ILE 277 277 277 ILE ILE A . n A 1 278 ILE 278 278 278 ILE ILE A . n A 1 279 ARG 279 279 279 ARG ARG A . n A 1 280 GLU 280 280 280 GLU GLU A . n A 1 281 ILE 281 281 281 ILE ILE A . n A 1 282 HIS 282 282 282 HIS HIS A . n A 1 283 GLN 283 283 283 GLN GLN A . n A 1 284 GLU 284 284 284 GLU GLU A . n A 1 285 THR 285 285 285 THR THR A . n A 1 286 ILE 286 286 286 ILE ILE A . n A 1 287 ASN 287 287 287 ASN ASN A . n A 1 288 GLY 288 288 288 GLY GLY A . n A 1 289 GLU 289 289 289 GLU GLU A . n A 1 290 ILE 290 290 290 ILE ILE A . n A 1 291 ALA 291 291 291 ALA ALA A . n A 1 292 GLU 292 292 292 GLU GLU A . n A 1 293 VAL 293 293 293 VAL VAL A . n A 1 294 LEU 294 294 294 LEU LEU A . n A 1 295 CYS 295 295 295 CYS CYS A . n A 1 296 GLU 296 296 296 GLU GLU A . n A 1 297 CYS 297 297 297 CYS CYS A . n A 1 298 TYR 298 298 298 TYR TYR A . n A 1 299 THR 299 299 299 THR THR A . n A 1 300 TYR 300 300 300 TYR TYR A . n A 1 301 TRP 301 301 301 TRP TRP A . n A 1 302 HIS 302 302 302 HIS HIS A . n A 1 303 GLU 303 303 303 GLU GLU A . n A 1 304 ASN 304 304 304 ASN ASN A . n A 1 305 ARG 305 305 305 ARG ARG A . n A 1 306 HIS 306 306 306 HIS HIS A . n A 1 307 GLY 307 307 307 GLY GLY A . n A 1 308 LEU 308 308 308 LEU LEU A . n A 1 309 PHE 309 309 309 PHE PHE A . n A 1 310 HIS 310 310 310 HIS HIS A . n A 1 311 MET 311 311 311 MET MET A . n A 1 312 LYS 312 312 312 LYS LYS A . n A 1 313 PRO 313 313 313 PRO PRO A . n A 1 314 GLY 314 314 314 GLY GLY A . n A 1 315 ILE 315 315 315 ILE ILE A . n A 1 316 ALA 316 316 316 ALA ALA A . n A 1 317 ASP 317 317 317 ASP ASP A . n A 1 318 THR 318 318 318 THR THR A . n A 1 319 LYS 319 319 319 LYS LYS A . n A 1 320 THR 320 320 320 THR THR A . n A 1 321 ILE 321 321 321 ILE ILE A . n A 1 322 ASN 322 322 322 ASN ASN A . n A 1 323 LYS 323 323 323 LYS LYS A . n A 1 324 LEU 324 324 324 LEU LEU A . n A 1 325 GLU 325 325 325 GLU GLU A . n A 1 326 SER 326 326 326 SER SER A . n A 1 327 ILE 327 327 327 ILE ILE A . n A 1 328 ALA 328 328 328 ALA ALA A . n A 1 329 ILE 329 329 329 ILE ILE A . n A 1 330 ILE 330 330 330 ILE ILE A . n A 1 331 ASP 331 331 331 ASP ASP A . n A 1 332 THR 332 332 332 THR THR A . n A 1 333 VAL 333 333 333 VAL VAL A . n A 1 334 CYS 334 334 334 CYS CYS A . n A 1 335 GLN 335 335 335 GLN GLN A . n A 1 336 LEU 336 336 336 LEU LEU A . n A 1 337 ILE 337 337 337 ILE ILE A . n A 1 338 ASP 338 338 338 ASP ASP A . n A 1 339 GLY 339 339 339 GLY GLY A . n A 1 340 GLY 340 340 340 GLY GLY A . n A 1 341 VAL 341 341 341 VAL VAL A . n A 1 342 ALA 342 342 342 ALA ALA A . n A 1 343 ARG 343 343 343 ARG ARG A . n A 1 344 LEU 344 344 344 LEU LEU A . n A 1 345 LYS 345 345 345 LYS LYS A . n A 1 346 LEU 346 346 ? ? ? A . n B 2 1 MET 1 1 ? ? ? B . n B 2 2 GLU 2 2 ? ? ? B . n B 2 3 LEU 3 3 3 LEU LEU B . n B 2 4 VAL 4 4 4 VAL VAL B . n B 2 5 LYS 5 5 5 LYS LYS B . n B 2 6 VAL 6 6 6 VAL VAL B . n B 2 7 VAL 7 7 7 VAL VAL B . n B 2 8 PHE 8 8 8 PHE PHE B . n B 2 9 MET 9 9 9 MET MET B . n B 2 10 GLY 10 10 10 GLY GLY B . n B 2 11 TRP 11 11 11 TRP TRP B . n B 2 12 PHE 12 12 12 PHE PHE B . n B 2 13 LYS 13 13 13 LYS LYS B . n B 2 14 ASN 14 14 14 ASN ASN B . n B 2 15 GLU 15 15 15 GLU GLU B . n B 2 16 SER 16 16 16 SER SER B . n B 2 17 MET 17 17 17 MET MET B . n B 2 18 PHE 18 18 18 PHE PHE B . n B 2 19 THR 19 19 19 THR THR B . n B 2 20 LYS 20 20 20 LYS LYS B . n B 2 21 GLU 21 21 21 GLU GLU B . n B 2 22 ILE 22 22 22 ILE ILE B . n B 2 23 THR 23 23 23 THR THR B . n B 2 24 MET 24 24 24 MET MET B . n B 2 25 MET 25 25 25 MET MET B . n B 2 26 LYS 26 26 26 LYS LYS B . n B 2 27 ASP 27 27 27 ASP ASP B . n B 2 28 ASP 28 28 28 ASP ASP B . n B 2 29 VAL 29 29 29 VAL VAL B . n B 2 30 GLN 30 30 30 GLN GLN B . n B 2 31 TRP 31 31 31 TRP TRP B . n B 2 32 ALA 32 32 32 ALA ALA B . n B 2 33 THR 33 33 33 THR THR B . n B 2 34 THR 34 34 34 THR THR B . n B 2 35 GLN 35 35 35 GLN GLN B . n B 2 36 TYR 36 36 36 TYR TYR B . n B 2 37 ALA 37 37 37 ALA ALA B . n B 2 38 GLU 38 38 38 GLU GLU B . n B 2 39 VAL 39 39 39 VAL VAL B . n B 2 40 ASN 40 40 40 ASN ASN B . n B 2 41 LYS 41 41 41 LYS LYS B . n B 2 42 ALA 42 42 42 ALA ALA B . n B 2 43 LEU 43 43 43 LEU LEU B . n B 2 44 VAL 44 44 44 VAL VAL B . n B 2 45 LYS 45 45 45 LYS LYS B . n B 2 46 ALA 46 46 46 ALA ALA B . n B 2 47 PHE 47 47 47 PHE PHE B . n B 2 48 ILE 48 48 48 ILE ILE B . n B 2 49 ASP 49 49 49 ASP ASP B . n B 2 50 ASP 50 50 50 ASP ASP B . n B 2 51 LYS 51 51 51 LYS LYS B . n B 2 52 LYS 52 52 52 LYS LYS B . n B 2 53 VAL 53 53 53 VAL VAL B . n B 2 54 CYS 54 54 54 CYS CYS B . n B 2 55 GLU 55 55 55 GLU GLU B . n B 2 56 VAL 56 56 56 VAL VAL B . n B 2 57 ASP 57 57 57 ASP ASP B . n B 2 58 CYS 58 58 58 CYS CYS B . n B 2 59 ARG 59 59 59 ARG ARG B . n B 2 60 GLY 60 60 ? ? ? B . n # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? 7.04 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? 7.04 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.6 4 # _cell.entry_id 5HY3 _cell.length_a 112.431 _cell.length_b 112.431 _cell.length_c 95.083 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5HY3 _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5HY3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.23 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.95 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.65M ammonium citrate tribase' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR CCD 165 mm' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-07-15 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BSRF BEAMLINE 3W1A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 3W1A _diffrn_source.pdbx_synchrotron_site BSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5HY3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.10 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11548 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 15.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 61.93 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.10 _reflns_shell.d_res_low 3.15 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 8.39 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.557 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 16.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5HY3 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 11286 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 39.750 _refine.ls_d_res_high 3.100 _refine.ls_percent_reflns_obs 97.70 _refine.ls_R_factor_obs 0.2615 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2594 _refine.ls_R_factor_R_free 0.3017 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.76 _refine.ls_number_reflns_R_free 537 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model 'the Se-Met derivative of this complex' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details 'random selection' _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.46 _refine.pdbx_overall_phase_error 34.69 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2510 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2510 _refine_hist.d_res_high 3.100 _refine_hist.d_res_low 39.750 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.011 ? ? 2551 'X-RAY DIFFRACTION' ? f_angle_d 1.460 ? ? 3429 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 17.719 ? ? 968 'X-RAY DIFFRACTION' ? f_chiral_restr 0.058 ? ? 383 'X-RAY DIFFRACTION' ? f_plane_restr 0.008 ? ? 436 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 3.0999 3.4117 2681 0.2947 100.00 0.4044 . . 133 . . . . 'X-RAY DIFFRACTION' . 3.4117 3.9050 2541 0.2965 95.00 0.3284 . . 136 . . . . 'X-RAY DIFFRACTION' . 3.9050 4.9184 2678 0.2385 98.00 0.2976 . . 147 . . . . 'X-RAY DIFFRACTION' . 4.9184 39.7536 2849 0.2507 98.00 0.2678 . . 121 . . . . # _struct.entry_id 5HY3 _struct.title 'Crystal structure of Escherichia coli toxin LsoA in complex with T4 phage antitoxin Dmd' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5HY3 _struct_keywords.text 'toxin-antitoxin, TOXIN-ANTITOXIN complex' _struct_keywords.pdbx_keywords TOXIN/ANTITOXIN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP LSOA_ECO57 O82881 ? 1 ;MAQNPFKALNINIDKIESALTQNGVTNYSSNVKNERETHISGTYKGIDFLIKLMPSGGNTTIGRASGQNNTYFDEIALII KENCLYSDTKNFEYTIPKFSDDDRANLFEFLSEEGITITEDNNNDPNCKHQYIMTTSNGDRVRAKIYKRGSIQFQGKYLQ IASLINDFMCSILNMKEIVEQKNKEFNVDIKKETIESELHSKLPKSIDKIHEDIKKQLSCSLIMKKIDVEMEDYSTYCFS ALRAIEGFIYQILNDVCNPSSSKNLGEYFTENKPKYIIREIHQETINGEIAEVLCECYTYWHENRHGLFHMKPGIADTKT INKLESIAIIDTVCQLIDGGVARLKL ; 1 2 UNP DMD_BPT4 P39232 ? 2 MELVKVVFMGWFKNESMFTKEITMMKDDVQWATTQYAEVNKALVKAFIDDKKVCEVDCRG 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5HY3 A 1 ? 346 ? O82881 1 ? 346 ? 1 346 2 2 5HY3 B 1 ? 60 ? P39232 1 ? 60 ? 1 60 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2870 ? 1 MORE -13 ? 1 'SSA (A^2)' 16840 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 102 ? GLU A 114 ? ASP A 102 GLU A 114 1 ? 13 HELX_P HELX_P2 AA2 LEU A 159 ? LEU A 173 ? LEU A 159 LEU A 173 1 ? 15 HELX_P HELX_P3 AA3 ASN A 174 ? PHE A 186 ? ASN A 174 PHE A 186 1 ? 13 HELX_P HELX_P4 AA4 LYS A 191 ? LEU A 203 ? LYS A 191 LEU A 203 1 ? 13 HELX_P HELX_P5 AA5 HIS A 211 ? LEU A 222 ? HIS A 211 LEU A 222 1 ? 12 HELX_P HELX_P6 AA6 LEU A 222 ? ILE A 227 ? LEU A 222 ILE A 227 1 ? 6 HELX_P HELX_P7 AA7 TYR A 234 ? CYS A 257 ? TYR A 234 CYS A 257 1 ? 24 HELX_P HELX_P8 AA8 ASN A 264 ? TYR A 268 ? ASN A 264 TYR A 268 1 ? 5 HELX_P HELX_P9 AA9 GLU A 280 ? GLN A 283 ? GLU A 280 GLN A 283 5 ? 4 HELX_P HELX_P10 AB1 GLU A 289 ? HIS A 310 ? GLU A 289 HIS A 310 1 ? 22 HELX_P HELX_P11 AB2 ASN A 322 ? LEU A 344 ? ASN A 322 LEU A 344 1 ? 23 HELX_P HELX_P12 AB3 MET B 25 ? ASP B 27 ? MET B 25 ASP B 27 5 ? 3 HELX_P HELX_P13 AB4 ASP B 28 ? LYS B 41 ? ASP B 28 LYS B 41 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A ILE 161 O ? ? ? 1_555 A ILE 165 CD1 ? ? A ILE 161 A ILE 165 1_555 ? ? ? ? ? ? ? 1.498 ? ? covale2 covale none ? A VAL 179 CG1 ? ? ? 1_555 A LYS 192 CD ? ? A VAL 179 A LYS 192 1_555 ? ? ? ? ? ? ? 1.282 ? ? covale3 covale none ? A VAL 179 CG1 ? ? ? 1_555 A LYS 192 CE ? ? A VAL 179 A LYS 192 1_555 ? ? ? ? ? ? ? 1.279 ? ? covale4 covale none ? A VAL 179 CG1 ? ? ? 1_555 A LYS 192 NZ ? ? A VAL 179 A LYS 192 1_555 ? ? ? ? ? ? ? 1.417 ? ? covale5 covale none ? A GLU 284 O ? ? ? 1_555 A ASN 287 ND2 ? ? A GLU 284 A ASN 287 1_555 ? ? ? ? ? ? ? 1.428 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 114 A . ? GLU 114 A GLY 115 A ? GLY 115 A 1 -16.83 2 ALA 144 A . ? ALA 144 A LYS 145 A ? LYS 145 A 1 2.83 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 152 ? GLY A 156 ? ILE A 152 GLY A 156 AA1 2 PHE A 92 ? ILE A 96 ? PHE A 92 ILE A 96 AA1 3 LYS B 51 ? ASP B 57 ? LYS B 51 ASP B 57 AA1 4 LEU B 43 ? ILE B 48 ? LEU B 43 ILE B 48 AA1 5 VAL B 4 ? TRP B 11 ? VAL B 4 TRP B 11 AA1 6 MET B 17 ? MET B 24 ? MET B 17 MET B 24 AA1 7 ALA A 316 ? ASP A 317 ? ALA A 316 ASP A 317 AA2 1 THR A 117 ? ASP A 121 ? THR A 117 ASP A 121 AA2 2 GLN A 131 ? THR A 135 ? GLN A 131 THR A 135 AA3 1 PHE A 269 ? THR A 270 ? PHE A 269 THR A 270 AA3 2 ILE A 277 ? ILE A 278 ? ILE A 277 ILE A 278 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 152 ? O ILE A 152 N ILE A 96 ? N ILE A 96 AA1 2 3 N GLU A 93 ? N GLU A 93 O GLU B 55 ? O GLU B 55 AA1 3 4 O LYS B 51 ? O LYS B 51 N ILE B 48 ? N ILE B 48 AA1 4 5 O PHE B 47 ? O PHE B 47 N VAL B 7 ? N VAL B 7 AA1 5 6 N VAL B 6 ? N VAL B 6 O ILE B 22 ? O ILE B 22 AA1 6 7 O THR B 19 ? O THR B 19 N ASP A 317 ? N ASP A 317 AA2 1 2 N THR A 117 ? N THR A 117 O THR A 135 ? O THR A 135 AA3 1 2 N THR A 270 ? N THR A 270 O ILE A 277 ? O ILE A 277 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 CA A VAL 179 ? ? NZ A LYS 192 ? ? 1.64 2 1 O A ASN 183 ? ? O A PHE 186 ? ? 1.68 3 1 O A GLU 180 ? ? OD1 A ASN 183 ? ? 1.74 4 1 CB A VAL 179 ? ? NZ A LYS 192 ? ? 1.74 5 1 O B TRP 31 ? ? OG1 B THR 34 ? ? 1.74 6 1 N A VAL 179 ? ? NZ A LYS 192 ? ? 1.82 7 1 O A THR 194 ? ? OG A SER 197 ? ? 1.83 8 1 O A GLU 267 ? ? CD A ARG 279 ? ? 1.86 9 1 O A LYS 90 ? ? O A LYS 157 ? ? 1.86 10 1 NZ B LYS 52 ? ? OE1 B GLU 55 ? ? 1.87 11 1 CD A PRO 204 ? ? OD2 A ASP 338 ? ? 1.88 12 1 NZ A LYS 202 ? ? OD1 A ASP 331 ? ? 1.89 13 1 O A LYS 182 ? ? N A PHE 186 ? ? 1.92 14 1 O A ILE 96 ? ? N A SER 151 ? ? 1.94 15 1 O A LYS 191 ? ? OG1 A THR 194 ? ? 1.99 16 1 O A PHE 110 ? ? CB A GLU 113 ? ? 1.99 17 1 O A GLU 198 ? ? OG A SER 201 ? ? 2.00 18 1 O A GLU 232 ? ? OG1 A THR 320 ? ? 2.02 19 1 O A LYS 176 ? ? CG2 A VAL 179 ? ? 2.04 20 1 NE2 A GLN 160 ? ? O A SER 262 ? ? 2.07 21 1 C A GLU 284 ? ? ND2 A ASN 287 ? ? 2.15 22 1 O A CYS 170 ? ? CB A LEU 173 ? ? 2.16 23 1 O A ALA 328 ? ? OG1 A THR 332 ? ? 2.16 24 1 O A GLU 196 ? ? N A HIS 200 ? ? 2.17 25 1 O A PHE 110 ? ? N A GLU 113 ? ? 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ASP _pdbx_validate_symm_contact.auth_seq_id_1 255 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OE1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 GLU _pdbx_validate_symm_contact.auth_seq_id_2 325 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_454 _pdbx_validate_symm_contact.dist 2.13 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A LEU 203 ? ? N A PRO 204 ? ? CD A PRO 204 ? ? 115.79 128.40 -12.61 2.10 Y 2 1 C A LYS 273 ? ? N A PRO 274 ? ? CD A PRO 274 ? ? 91.67 128.40 -36.73 2.10 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 98 ? ? 63.48 -147.38 2 1 PHE A 99 ? ? 99.43 129.01 3 1 SER A 100 ? ? 71.57 -61.48 4 1 ASP A 102 ? ? 91.45 -49.31 5 1 ASN A 124 ? ? -94.51 -112.70 6 1 LYS A 145 ? ? -165.50 -73.40 7 1 LYS A 263 ? ? -88.98 -149.19 8 1 PRO A 274 ? ? -99.57 -132.40 9 1 ILE A 286 ? ? -85.81 -76.18 10 1 LEU A 344 ? ? -113.68 70.80 11 1 GLU B 15 ? ? 88.71 9.15 12 1 ASP B 50 ? ? 81.61 11.78 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ASP A 125 ? ? PRO A 126 ? ? -149.78 2 1 GLY A 288 ? ? GLU A 289 ? ? 139.51 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A ASN 4 ? A ASN 4 5 1 Y 1 A PRO 5 ? A PRO 5 6 1 Y 1 A PHE 6 ? A PHE 6 7 1 Y 1 A LYS 7 ? A LYS 7 8 1 Y 1 A ALA 8 ? A ALA 8 9 1 Y 1 A LEU 9 ? A LEU 9 10 1 Y 1 A ASN 10 ? A ASN 10 11 1 Y 1 A ILE 11 ? A ILE 11 12 1 Y 1 A ASN 12 ? A ASN 12 13 1 Y 1 A ILE 13 ? A ILE 13 14 1 Y 1 A ASP 14 ? A ASP 14 15 1 Y 1 A LYS 15 ? A LYS 15 16 1 Y 1 A ILE 16 ? A ILE 16 17 1 Y 1 A GLU 17 ? A GLU 17 18 1 Y 1 A SER 18 ? A SER 18 19 1 Y 1 A ALA 19 ? A ALA 19 20 1 Y 1 A LEU 20 ? A LEU 20 21 1 Y 1 A THR 21 ? A THR 21 22 1 Y 1 A GLN 22 ? A GLN 22 23 1 Y 1 A ASN 23 ? A ASN 23 24 1 Y 1 A GLY 24 ? A GLY 24 25 1 Y 1 A VAL 25 ? A VAL 25 26 1 Y 1 A THR 26 ? A THR 26 27 1 Y 1 A ASN 27 ? A ASN 27 28 1 Y 1 A TYR 28 ? A TYR 28 29 1 Y 1 A SER 29 ? A SER 29 30 1 Y 1 A SER 30 ? A SER 30 31 1 Y 1 A ASN 31 ? A ASN 31 32 1 Y 1 A VAL 32 ? A VAL 32 33 1 Y 1 A LYS 33 ? A LYS 33 34 1 Y 1 A ASN 34 ? A ASN 34 35 1 Y 1 A GLU 35 ? A GLU 35 36 1 Y 1 A ARG 36 ? A ARG 36 37 1 Y 1 A GLU 37 ? A GLU 37 38 1 Y 1 A THR 38 ? A THR 38 39 1 Y 1 A HIS 39 ? A HIS 39 40 1 Y 1 A ILE 40 ? A ILE 40 41 1 Y 1 A SER 41 ? A SER 41 42 1 Y 1 A GLY 42 ? A GLY 42 43 1 Y 1 A THR 43 ? A THR 43 44 1 Y 1 A TYR 44 ? A TYR 44 45 1 Y 1 A LYS 45 ? A LYS 45 46 1 Y 1 A GLY 46 ? A GLY 46 47 1 Y 1 A ILE 47 ? A ILE 47 48 1 Y 1 A ASP 48 ? A ASP 48 49 1 Y 1 A PHE 49 ? A PHE 49 50 1 Y 1 A LEU 50 ? A LEU 50 51 1 Y 1 A ILE 51 ? A ILE 51 52 1 Y 1 A LYS 52 ? A LYS 52 53 1 Y 1 A LEU 53 ? A LEU 53 54 1 Y 1 A MET 54 ? A MET 54 55 1 Y 1 A PRO 55 ? A PRO 55 56 1 Y 1 A SER 56 ? A SER 56 57 1 Y 1 A GLY 57 ? A GLY 57 58 1 Y 1 A GLY 58 ? A GLY 58 59 1 Y 1 A ASN 59 ? A ASN 59 60 1 Y 1 A THR 60 ? A THR 60 61 1 Y 1 A THR 61 ? A THR 61 62 1 Y 1 A ILE 62 ? A ILE 62 63 1 Y 1 A GLY 63 ? A GLY 63 64 1 Y 1 A ARG 64 ? A ARG 64 65 1 Y 1 A ALA 65 ? A ALA 65 66 1 Y 1 A SER 66 ? A SER 66 67 1 Y 1 A GLY 67 ? A GLY 67 68 1 Y 1 A GLN 68 ? A GLN 68 69 1 Y 1 A ASN 69 ? A ASN 69 70 1 Y 1 A ASN 70 ? A ASN 70 71 1 Y 1 A THR 71 ? A THR 71 72 1 Y 1 A TYR 72 ? A TYR 72 73 1 Y 1 A PHE 73 ? A PHE 73 74 1 Y 1 A ASP 74 ? A ASP 74 75 1 Y 1 A GLU 75 ? A GLU 75 76 1 Y 1 A ILE 76 ? A ILE 76 77 1 Y 1 A ALA 77 ? A ALA 77 78 1 Y 1 A LEU 78 ? A LEU 78 79 1 Y 1 A ILE 79 ? A ILE 79 80 1 Y 1 A ILE 80 ? A ILE 80 81 1 Y 1 A LYS 81 ? A LYS 81 82 1 Y 1 A GLU 82 ? A GLU 82 83 1 Y 1 A ASN 83 ? A ASN 83 84 1 Y 1 A CYS 84 ? A CYS 84 85 1 Y 1 A LEU 85 ? A LEU 85 86 1 Y 1 A TYR 86 ? A TYR 86 87 1 Y 1 A SER 87 ? A SER 87 88 1 Y 1 A ASP 88 ? A ASP 88 89 1 Y 1 A THR 89 ? A THR 89 90 1 Y 1 A TYR 147 ? A TYR 147 91 1 Y 1 A LYS 148 ? A LYS 148 92 1 Y 1 A ARG 149 ? A ARG 149 93 1 Y 1 A GLY 150 ? A GLY 150 94 1 Y 1 A LEU 346 ? A LEU 346 95 1 Y 1 B MET 1 ? B MET 1 96 1 Y 1 B GLU 2 ? B GLU 2 97 1 Y 1 B GLY 60 ? B GLY 60 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details 'the Se-Met derivative of this complex' # _atom_sites.entry_id 5HY3 _atom_sites.fract_transf_matrix[1][1] 0.008894 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008894 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010517 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_