data_5IA9 # _entry.id 5IA9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.283 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5IA9 WWPDB D_1000218525 EMDB EMD-8084 # _pdbx_database_related.db_name EMDB _pdbx_database_related.details '519K contains the same protein with glutathione only' _pdbx_database_related.db_id EMD-8084 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5IA9 _pdbx_database_status.recvd_initial_deposition_date 2016-02-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kuang, Q.' 1 'Purhonen, P.' 2 'Jegerschold, C.' 3 'Morgenstern, R.' 4 'Hebert, H.' 5 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first 7897 _citation.page_last 7897 _citation.title ;Dead-end complex, lipid interactions and catalytic mechanism of microsomal glutathione transferase 1, an electron crystallography and mutagenesis investigation. ; _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-017-07912-3 _citation.pdbx_database_id_PubMed 28801553 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kuang, Q.' 1 primary 'Purhonen, P.' 2 primary 'Alander, J.' 3 primary 'Svensson, R.' 4 primary 'Hoogland, V.' 5 primary 'Winerdal, J.' 6 primary 'Spahiu, L.' 7 primary 'Ottosson-Wadlund, A.' 8 primary 'Jegerschold, C.' 9 primary 'Morgenstern, R.' 10 primary 'Hebert, H.' 11 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5IA9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 81.800 _cell.length_a_esd ? _cell.length_b 81.800 _cell.length_b_esd ? _cell.length_c 100.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5IA9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 168 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 6' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Microsomal glutathione S-transferase 1' 17492.488 1 2.5.1.18 ? ? ? 2 non-polymer syn '1-(S-GLUTATHIONYL)-2,4,6-TRINITROCYCLOHEXA-2,5-DIENE' 520.428 1 ? ? ? ? 3 non-polymer syn 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE 790.145 2 ? ? ? ? 4 non-polymer syn 'PALMITIC ACID' 256.424 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Microsomal GST-1,Microsomal GST-I' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MADLKQLMDNEVLMAFTSYATIILAKMMFLSSATAFQRLTNKVFANPEDCAGFGKGENAKKFLRTDEKVERVRRAHLNDL ENIVPFLGIGLLYSLSGPDLSTALIHFRIFVGARIYHTIAYLTPLPQPNRGLAFFVGYGVTLSMAYRLLRSRLYL ; _entity_poly.pdbx_seq_one_letter_code_can ;MADLKQLMDNEVLMAFTSYATIILAKMMFLSSATAFQRLTNKVFANPEDCAGFGKGENAKKFLRTDEKVERVRRAHLNDL ENIVPFLGIGLLYSLSGPDLSTALIHFRIFVGARIYHTIAYLTPLPQPNRGLAFFVGYGVTLSMAYRLLRSRLYL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ASP n 1 4 LEU n 1 5 LYS n 1 6 GLN n 1 7 LEU n 1 8 MET n 1 9 ASP n 1 10 ASN n 1 11 GLU n 1 12 VAL n 1 13 LEU n 1 14 MET n 1 15 ALA n 1 16 PHE n 1 17 THR n 1 18 SER n 1 19 TYR n 1 20 ALA n 1 21 THR n 1 22 ILE n 1 23 ILE n 1 24 LEU n 1 25 ALA n 1 26 LYS n 1 27 MET n 1 28 MET n 1 29 PHE n 1 30 LEU n 1 31 SER n 1 32 SER n 1 33 ALA n 1 34 THR n 1 35 ALA n 1 36 PHE n 1 37 GLN n 1 38 ARG n 1 39 LEU n 1 40 THR n 1 41 ASN n 1 42 LYS n 1 43 VAL n 1 44 PHE n 1 45 ALA n 1 46 ASN n 1 47 PRO n 1 48 GLU n 1 49 ASP n 1 50 CYS n 1 51 ALA n 1 52 GLY n 1 53 PHE n 1 54 GLY n 1 55 LYS n 1 56 GLY n 1 57 GLU n 1 58 ASN n 1 59 ALA n 1 60 LYS n 1 61 LYS n 1 62 PHE n 1 63 LEU n 1 64 ARG n 1 65 THR n 1 66 ASP n 1 67 GLU n 1 68 LYS n 1 69 VAL n 1 70 GLU n 1 71 ARG n 1 72 VAL n 1 73 ARG n 1 74 ARG n 1 75 ALA n 1 76 HIS n 1 77 LEU n 1 78 ASN n 1 79 ASP n 1 80 LEU n 1 81 GLU n 1 82 ASN n 1 83 ILE n 1 84 VAL n 1 85 PRO n 1 86 PHE n 1 87 LEU n 1 88 GLY n 1 89 ILE n 1 90 GLY n 1 91 LEU n 1 92 LEU n 1 93 TYR n 1 94 SER n 1 95 LEU n 1 96 SER n 1 97 GLY n 1 98 PRO n 1 99 ASP n 1 100 LEU n 1 101 SER n 1 102 THR n 1 103 ALA n 1 104 LEU n 1 105 ILE n 1 106 HIS n 1 107 PHE n 1 108 ARG n 1 109 ILE n 1 110 PHE n 1 111 VAL n 1 112 GLY n 1 113 ALA n 1 114 ARG n 1 115 ILE n 1 116 TYR n 1 117 HIS n 1 118 THR n 1 119 ILE n 1 120 ALA n 1 121 TYR n 1 122 LEU n 1 123 THR n 1 124 PRO n 1 125 LEU n 1 126 PRO n 1 127 GLN n 1 128 PRO n 1 129 ASN n 1 130 ARG n 1 131 GLY n 1 132 LEU n 1 133 ALA n 1 134 PHE n 1 135 PHE n 1 136 VAL n 1 137 GLY n 1 138 TYR n 1 139 GLY n 1 140 VAL n 1 141 THR n 1 142 LEU n 1 143 SER n 1 144 MET n 1 145 ALA n 1 146 TYR n 1 147 ARG n 1 148 LEU n 1 149 LEU n 1 150 ARG n 1 151 SER n 1 152 ARG n 1 153 LEU n 1 154 TYR n 1 155 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 155 _entity_src_gen.gene_src_common_name 'Norway Rat' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Mgst1, Gst12' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MGST1_RAT _struct_ref.pdbx_db_accession P08011 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MADLKQLMDNEVLMAFTSYATIILAKMMFLSSATAFQRLTNKVFANPEDCAGFGKGENAKKFLRTDEKVERVRRAHLNDL ENIVPFLGIGLLYSLSGPDLSTALIHFRIFVGARIYHTIAYLTPLPQPNRGLAFFVGYGVTLSMAYRLLRSRLYL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5IA9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 155 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P08011 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 155 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 155 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GTD non-polymer . '1-(S-GLUTATHIONYL)-2,4,6-TRINITROCYCLOHEXA-2,5-DIENE' '(S)-2-AMINO-5-((R)-1-(CARBOXYMETHYLAMINO)-1-OXO-3-(2,4,6-TRINITROCYCLOHEXA-2,5-DIENYLTHIO)PROPAN-2-YLAMINO)-5-OXOPENTANOIC ACID' 'C16 H20 N6 O12 S' 520.428 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PC1 non-polymer . 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE 3-SN-PHOSPHATIDYLCHOLINE 'C44 H88 N O8 P' 790.145 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PLM non-polymer . 'PALMITIC ACID' ? 'C16 H32 O2' 256.424 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5IA9 _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON CRYSTALLOGRAPHY' _exptl.method_details ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _refine.aniso_B[1][1] -34.57 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -34.57 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 69.13 _refine.B_iso_max ? _refine.B_iso_mean 19.369 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.710 _refine.correlation_coeff_Fo_to_Fc_free 0.398 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5IA9 _refine.pdbx_refine_id 'ELECTRON CRYSTALLOGRAPHY' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.50 _refine.ls_d_res_low 10.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5539 _refine.ls_number_reflns_R_free 175 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 72.4 _refine.ls_percent_reflns_R_free 5.4 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.28287 _refine.ls_R_factor_R_free 0.31055 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.28144 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.162 _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'ELECTRON CRYSTALLOGRAPHY' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein ? _refine_hist.pdbx_number_atoms_nucleic_acid ? _refine_hist.pdbx_number_atoms_ligand ? _refine_hist.number_atoms_solvent ? _refine_hist.number_atoms_total 1147 _refine_hist.d_res_high . _refine_hist.d_res_low . # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'ELECTRON CRYSTALLOGRAPHY' ? 0.025 0.022 1164 ? r_bond_refined_d ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_bond_other_d ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 3.084 2.102 1546 ? r_angle_refined_deg ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_angle_other_deg ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 10.793 5.000 121 ? r_dihedral_angle_1_deg ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 34.785 20.952 42 ? r_dihedral_angle_2_deg ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 22.525 15.000 171 ? r_dihedral_angle_3_deg ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 25.946 15.000 10 ? r_dihedral_angle_4_deg ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 0.250 0.200 167 ? r_chiral_restr ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 0.011 0.021 792 ? r_gen_planes_refined ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_gen_planes_other ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_nbd_refined ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_nbd_other ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_nbtor_refined ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_nbtor_other ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_metal_ion_refined ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_metal_ion_other ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_symmetry_vdw_other ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_symmetry_hbond_other ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 0.696 1.500 619 ? r_mcbond_it ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_mcbond_other ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 0.921 2.000 986 ? r_mcangle_it ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_mcangle_other ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 0.412 3.000 545 ? r_scbond_it ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_scbond_other ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 0.628 4.500 560 ? r_scangle_it ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_scangle_other ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_long_range_B_refined ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_long_range_B_other ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_rigid_bond_restr ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_sphericity_free ? ? 'ELECTRON CRYSTALLOGRAPHY' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'ELECTRON CRYSTALLOGRAPHY' _refine_ls_shell.d_res_high 3.498 _refine_ls_shell.d_res_low 3.577 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 7 _refine_ls_shell.number_reflns_R_work 172 _refine_ls_shell.percent_reflns_obs 58.50 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.257 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.257 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5IA9 _struct.title 'The structure of microsomal glutathione transferase 1 in complex with Meisenheimer complex' _struct.pdbx_descriptor 'Microsomal glutathione S-transferase 1 (E.C.2.5.1.18)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5IA9 _struct_keywords.text 'Membrane, Enzyme, Meisenheimer complex, Transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 10 ? ASN A 41 ? ASN A 10 ASN A 41 1 ? 32 HELX_P HELX_P2 AA2 GLU A 67 ? SER A 96 ? GLU A 67 SER A 96 1 ? 30 HELX_P HELX_P3 AA3 ALA A 103 ? TYR A 121 ? ALA A 103 TYR A 121 1 ? 19 HELX_P HELX_P4 AA4 GLY A 131 ? LEU A 155 ? GLY A 131 LEU A 155 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLN _struct_mon_prot_cis.label_seq_id 127 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLN _struct_mon_prot_cis.auth_seq_id 127 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 128 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 128 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 14.36 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GTD 201 ? 4 'binding site for residue GTD A 201' AC2 Software A PC1 202 ? 4 'binding site for residue PC1 A 202' AC3 Software A PC1 203 ? 3 'binding site for residue PC1 A 203' AC4 Software A PLM 204 ? 6 'binding site for residue PLM A 204' AC5 Software A PLM 205 ? 6 'binding site for residue PLM A 205' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ARG A 38 ? ARG A 38 . ? 1_555 ? 2 AC1 4 LEU A 39 ? LEU A 39 . ? 1_555 ? 3 AC1 4 HIS A 76 ? HIS A 76 . ? 1_555 ? 4 AC1 4 LEU A 77 ? LEU A 77 . ? 1_555 ? 5 AC2 4 ILE A 105 ? ILE A 105 . ? 1_555 ? 6 AC2 4 VAL A 136 ? VAL A 136 . ? 1_555 ? 7 AC2 4 VAL A 140 ? VAL A 140 . ? 1_555 ? 8 AC2 4 MET A 144 ? MET A 144 . ? 1_555 ? 9 AC3 3 TYR A 116 ? TYR A 116 . ? 1_555 ? 10 AC3 3 ALA A 120 ? ALA A 120 . ? 1_555 ? 11 AC3 3 PRO A 124 ? PRO A 124 . ? 1_555 ? 12 AC4 6 LEU A 30 ? LEU A 30 . ? 1_555 ? 13 AC4 6 ILE A 115 ? ILE A 115 . ? 1_555 ? 14 AC4 6 THR A 118 ? THR A 118 . ? 1_555 ? 15 AC4 6 ILE A 119 ? ILE A 119 . ? 1_555 ? 16 AC4 6 TYR A 121 ? TYR A 121 . ? 1_555 ? 17 AC4 6 LEU A 122 ? LEU A 122 . ? 1_555 ? 18 AC5 6 PRO A 85 ? PRO A 85 . ? 1_555 ? 19 AC5 6 ILE A 89 ? ILE A 89 . ? 1_555 ? 20 AC5 6 LEU A 92 ? LEU A 92 . ? 1_555 ? 21 AC5 6 TYR A 93 ? TYR A 93 . ? 1_555 ? 22 AC5 6 LEU A 149 ? LEU A 149 . ? 1_555 ? 23 AC5 6 LEU A 153 ? LEU A 153 . ? 1_555 ? # _atom_sites.entry_id 5IA9 _atom_sites.fract_transf_matrix[1][1] 0.012225 _atom_sites.fract_transf_matrix[1][2] 0.007058 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014116 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol _atom_type.analytical_mass_percent _atom_type.description _atom_type.number_in_cell _atom_type.oxidation_number _atom_type.pdbx_scat_Cromer_Mann_a5 _atom_type.pdbx_scat_Cromer_Mann_b5 _atom_type.radius_bond _atom_type.radius_contact _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_dispersion_imag _atom_type.scat_dispersion_real _atom_type.scat_dispersion_source _atom_type.scat_length_neutron _atom_type.scat_source _atom_type.scat_versus_stol_list C ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? N ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? O ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? P ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? S ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _database_PDB_caveat.id _database_PDB_caveat.text 1 'PC1 A 202 HAS WRONG CHIRALITY AT ATOM C2' 2 'PC1 A 203 HAS WRONG CHIRALITY AT ATOM C2' # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 LEU 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 GLN 6 6 ? ? ? A . n A 1 7 LEU 7 7 ? ? ? A . n A 1 8 MET 8 8 ? ? ? A . n A 1 9 ASP 9 9 ? ? ? A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 VAL 43 43 ? ? ? A . n A 1 44 PHE 44 44 ? ? ? A . n A 1 45 ALA 45 45 ? ? ? A . n A 1 46 ASN 46 46 ? ? ? A . n A 1 47 PRO 47 47 ? ? ? A . n A 1 48 GLU 48 48 ? ? ? A . n A 1 49 ASP 49 49 ? ? ? A . n A 1 50 CYS 50 50 ? ? ? A . n A 1 51 ALA 51 51 ? ? ? A . n A 1 52 GLY 52 52 ? ? ? A . n A 1 53 PHE 53 53 ? ? ? A . n A 1 54 GLY 54 54 ? ? ? A . n A 1 55 LYS 55 55 ? ? ? A . n A 1 56 GLY 56 56 ? ? ? A . n A 1 57 GLU 57 57 ? ? ? A . n A 1 58 ASN 58 58 ? ? ? A . n A 1 59 ALA 59 59 ? ? ? A . n A 1 60 LYS 60 60 ? ? ? A . n A 1 61 LYS 61 61 ? ? ? A . n A 1 62 PHE 62 62 ? ? ? A . n A 1 63 LEU 63 63 ? ? ? A . n A 1 64 ARG 64 64 ? ? ? A . n A 1 65 THR 65 65 ? ? ? A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 PRO 124 124 124 PRO PRO A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 TYR 138 138 138 TYR TYR A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 THR 141 141 141 THR THR A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 MET 144 144 144 MET MET A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 ARG 150 150 150 ARG ARG A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 TYR 154 154 154 TYR TYR A . n A 1 155 LEU 155 155 155 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GTD 1 201 200 GTD GTD A . C 3 PC1 1 202 300 PC1 PC2 A . D 3 PC1 1 203 400 PC1 PC2 A . E 4 PLM 1 204 500 PLM PLM A . F 4 PLM 1 205 700 PLM PLM A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 15790 ? 1 MORE -91 ? 1 'SSA (A^2)' 20160 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -y+1,x-y,z -0.5000000000 -0.8660254038 0.0000000000 81.8000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038 0.0000000000 40.9000000000 -0.8660254038 -0.5000000000 0.0000000000 70.8408780296 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-07-12 2 'Structure model' 1 1 2017-08-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' em_image_scans # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.name' # _software.citation_id ? _software.classification refinement _software.compiler_name ? _software.compiler_version ? _software.contact_author ? _software.contact_author_email ? _software.date ? _software.description ? _software.dependencies ? _software.hardware ? _software.language ? _software.location ? _software.mods ? _software.name REFMAC _software.os ? _software.os_version ? _software.type ? _software.version 5.5.0110 _software.pdbx_ordinal 1 # _em_3d_fitting.entry_id 5IA9 _em_3d_fitting.id 1 _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_protocol ? _em_3d_fitting.ref_space ? _em_3d_fitting.target_criteria ? _em_3d_fitting.method ? # _em_3d_reconstruction.entry_id 5IA9 _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.details ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.num_particles ? _em_3d_reconstruction.resolution 3.5 _em_3d_reconstruction.resolution_method 'DIFFRACTION PATTERN/LAYERLINES' _em_3d_reconstruction.symmetry_type '2D CRYSTAL' _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details ? _em_buffer.pH 7.4 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details ? _em_entity_assembly.name 'The structure of microsomal glutathione transferase 1 in complex with the Meisenheimer complex' _em_entity_assembly.source RECOMBINANT _em_entity_assembly.type COMPLEX _em_entity_assembly.entity_id_list 1 _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_imaging.id 1 _em_imaging.entry_id 5IA9 _em_imaging.accelerating_voltage 200 _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.calibrated_defocus_max ? _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_magnification ? _em_imaging.cryogen ? _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.microscope_model 'JEOL 2100F' _em_imaging.mode DIFFRACTION _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_max ? _em_imaging.nominal_defocus_min ? _em_imaging.nominal_magnification ? _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model ? _em_imaging.specimen_id 1 _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.specimen_holder_type ? _em_imaging.citation_id ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature ? _em_vitrification.cryogen_name NITROGEN _em_vitrification.details ? _em_vitrification.humidity ? _em_vitrification.instrument ? _em_vitrification.entry_id 5IA9 _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 5IA9 _em_experiment.id 1 _em_experiment.aggregation_state '2D ARRAY' _em_experiment.reconstruction_method CRYSTALLOGRAPHY _em_experiment.entity_assembly_id 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 99 ? ? N A SER 101 ? ? 1.97 2 1 O A LEU 91 ? ? CB A SER 94 ? ? 2.00 3 1 O A GLU 81 ? ? CD A PRO 85 ? ? 2.02 4 1 OD1 A ASN 82 ? ? NH2 A ARG 114 ? ? 2.10 5 1 O A ARG 38 ? ? O A ASN 41 ? ? 2.11 6 1 O A THR 141 ? ? CB A ALA 145 ? ? 2.11 7 1 O A ASN 78 ? ? OD1 A ASN 82 ? ? 2.13 8 1 OG1 A THR 34 ? ? NE2 A HIS 76 ? ? 2.15 9 1 OD1 A ASN 41 ? ? NZ A LYS 68 ? ? 2.19 10 1 O A ALA 15 ? ? OG A SER 18 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 N A SER 32 ? ? 1_555 OH A TYR 138 ? ? 3_665 1.97 2 1 CZ A PHE 36 ? ? 1_555 C36 A PC1 203 ? ? 4_665 1.97 3 1 OG A SER 31 ? ? 1_555 OH A TYR 138 ? ? 3_665 2.03 4 1 CE2 A PHE 36 ? ? 1_555 C36 A PC1 203 ? ? 4_665 2.10 5 1 CA A SER 32 ? ? 1_555 OH A TYR 138 ? ? 3_665 2.19 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 VAL _pdbx_validate_rmsd_angle.auth_seq_id_1 12 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 VAL _pdbx_validate_rmsd_angle.auth_seq_id_2 12 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 VAL _pdbx_validate_rmsd_angle.auth_seq_id_3 12 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 98.72 _pdbx_validate_rmsd_angle.angle_target_value 111.40 _pdbx_validate_rmsd_angle.angle_deviation -12.68 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.90 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 14 ? ? -26.28 -60.83 2 1 ILE A 22 ? ? -55.40 -75.05 3 1 LYS A 26 ? ? -64.43 -70.40 4 1 TYR A 93 ? ? -59.18 -8.51 5 1 SER A 94 ? ? -55.00 -71.22 6 1 SER A 96 ? ? -118.99 50.27 7 1 THR A 123 ? ? -150.54 -24.10 8 1 PRO A 124 ? ? -52.84 98.53 9 1 SER A 151 ? ? -54.80 -71.80 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 TYR _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 121 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 LEU _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 122 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -44.76 # loop_ _pdbx_validate_chiral.id _pdbx_validate_chiral.PDB_model_num _pdbx_validate_chiral.auth_atom_id _pdbx_validate_chiral.label_alt_id _pdbx_validate_chiral.auth_asym_id _pdbx_validate_chiral.auth_comp_id _pdbx_validate_chiral.auth_seq_id _pdbx_validate_chiral.PDB_ins_code _pdbx_validate_chiral.details _pdbx_validate_chiral.omega 1 1 C2 ? A PC1 202 ? 'WRONG HAND' . 2 1 C2 ? A PC1 203 ? 'WRONG HAND' . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 1 A PLM 204 ? O1 ? E PLM 1 O1 2 1 N 1 A PLM 204 ? O2 ? E PLM 1 O2 3 1 N 1 A PLM 204 ? CB ? E PLM 1 CB 4 1 N 1 A PLM 204 ? CC ? E PLM 1 CC 5 1 N 1 A PLM 204 ? CD ? E PLM 1 CD 6 1 N 1 A PLM 204 ? CE ? E PLM 1 CE 7 1 N 1 A PLM 204 ? CF ? E PLM 1 CF 8 1 N 1 A PLM 204 ? CG ? E PLM 1 CG 9 1 N 1 A PLM 205 ? O1 ? F PLM 1 O1 10 1 N 1 A PLM 205 ? O2 ? F PLM 1 O2 11 1 N 1 A PLM 205 ? CB ? F PLM 1 CB 12 1 N 1 A PLM 205 ? CC ? F PLM 1 CC 13 1 N 1 A PLM 205 ? CD ? F PLM 1 CD 14 1 N 1 A PLM 205 ? CE ? F PLM 1 CE 15 1 N 1 A PLM 205 ? CF ? F PLM 1 CF 16 1 N 1 A PLM 205 ? CG ? F PLM 1 CG # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A LEU 4 ? A LEU 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A GLN 6 ? A GLN 6 7 1 Y 1 A LEU 7 ? A LEU 7 8 1 Y 1 A MET 8 ? A MET 8 9 1 Y 1 A ASP 9 ? A ASP 9 10 1 Y 1 A VAL 43 ? A VAL 43 11 1 Y 1 A PHE 44 ? A PHE 44 12 1 Y 1 A ALA 45 ? A ALA 45 13 1 Y 1 A ASN 46 ? A ASN 46 14 1 Y 1 A PRO 47 ? A PRO 47 15 1 Y 1 A GLU 48 ? A GLU 48 16 1 Y 1 A ASP 49 ? A ASP 49 17 1 Y 1 A CYS 50 ? A CYS 50 18 1 Y 1 A ALA 51 ? A ALA 51 19 1 Y 1 A GLY 52 ? A GLY 52 20 1 Y 1 A PHE 53 ? A PHE 53 21 1 Y 1 A GLY 54 ? A GLY 54 22 1 Y 1 A LYS 55 ? A LYS 55 23 1 Y 1 A GLY 56 ? A GLY 56 24 1 Y 1 A GLU 57 ? A GLU 57 25 1 Y 1 A ASN 58 ? A ASN 58 26 1 Y 1 A ALA 59 ? A ALA 59 27 1 Y 1 A LYS 60 ? A LYS 60 28 1 Y 1 A LYS 61 ? A LYS 61 29 1 Y 1 A PHE 62 ? A PHE 62 30 1 Y 1 A LEU 63 ? A LEU 63 31 1 Y 1 A ARG 64 ? A ARG 64 32 1 Y 1 A THR 65 ? A THR 65 # _em_2d_crystal_entity.id 1 _em_2d_crystal_entity.image_processing_id 1 _em_2d_crystal_entity.angle_gamma 120.0 _em_2d_crystal_entity.length_a 81.8 _em_2d_crystal_entity.length_b 81.8 _em_2d_crystal_entity.length_c 100.0 _em_2d_crystal_entity.space_group_name_H-M 'P 6' _em_2d_crystal_entity.c_sampling_length ? # _em_crystal_formation.id 1 _em_crystal_formation.specimen_id 1 _em_crystal_formation.atmosphere ? _em_crystal_formation.details dialysis _em_crystal_formation.instrument ? _em_crystal_formation.lipid_mixture 'bovine liver lecithin' _em_crystal_formation.lipid_protein_ratio 3 _em_crystal_formation.temperature 303 _em_crystal_formation.time 7 _em_crystal_formation.time_unit ? # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type NONE _em_ctf_correction.details ? # _em_diffraction.id 1 _em_diffraction.camera_length 200 _em_diffraction.imaging_id 1 _em_diffraction.tilt_angle_list ? # _em_diffraction_stats.id 1 _em_diffraction_stats.details ? _em_diffraction_stats.image_processing_id 1 _em_diffraction_stats.fourier_space_coverage 72.4 _em_diffraction_stats.high_resolution 3.5 _em_diffraction_stats.num_intensities_measured 43603 _em_diffraction_stats.num_structure_factors 3063 _em_diffraction_stats.overall_phase_error 0.0001 _em_diffraction_stats.overall_phase_residual 0.0001 _em_diffraction_stats.phase_error_rejection_criteria 0 _em_diffraction_stats.r_merge 34.3 _em_diffraction_stats.r_sym 12.0 # _em_embedding.id 1 _em_embedding.details ? _em_embedding.specimen_id 1 _em_embedding.material trehalose # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.experimental_flag NO _em_entity_assembly_molwt.units MEGADALTONS _em_entity_assembly_molwt.value 0.54357 # _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.ncbi_tax_id 10116 _em_entity_assembly_naturalsource.organ . _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism 'Rattus norvegicus' _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_entity_assembly_recombinant.id 2 _em_entity_assembly_recombinant.entity_assembly_id 1 _em_entity_assembly_recombinant.cell ? _em_entity_assembly_recombinant.ncbi_tax_id 562 _em_entity_assembly_recombinant.organism 'Escherichia coli' _em_entity_assembly_recombinant.plasmid pSP19T7LT _em_entity_assembly_recombinant.strain ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 1 _em_image_recording.average_exposure_time ? _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'TVIPS TEMCAM-F415 (4k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # _em_imaging_optics.id 1 _em_imaging_optics.imaging_id 1 _em_imaging_optics.chr_aberration_corrector ? _em_imaging_optics.energyfilter_lower ? _em_imaging_optics.energyfilter_name ? _em_imaging_optics.energyfilter_upper ? _em_imaging_optics.phase_plate ? _em_imaging_optics.sph_aberration_corrector ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'IMAGE ACQUISITION' ? ? ? ? ? 1 2 MASKING ? ? ? ? ? ? 3 'CTF CORRECTION' ? ? ? 1 ? ? 4 'LAYERLINE INDEXING' ? ? ? ? ? ? 5 'DIFFRACTION INDEXING' ? ? ? ? ? ? 6 'MODEL FITTING' ? ? ? ? 1 ? 7 OTHER ? ? ? ? ? ? 8 'MOLECULAR REPLACEMENT' ? ? ? 1 ? ? 9 'MOLECULAR REPLACEMENT' ? ? ? 1 ? ? 10 'SYMMETRY DETERMINATION' ? ? ? 1 ? ? 11 'CRYSTALLOGRAPHY MERGING' ? ? ? 1 ? ? 12 RECONSTRUCTION ? ? ? 1 ? ? 13 'MODEL REFINEMENT' ? REFMAC 5 ? 1 ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied YES _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal VR Sweden ? 1 CIMED Sweden ? 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-(S-GLUTATHIONYL)-2,4,6-TRINITROCYCLOHEXA-2,5-DIENE' GTD 3 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE PC1 4 'PALMITIC ACID' PLM # loop_ _pdbx_reflns_twin.domain_id _pdbx_reflns_twin.crystal_id _pdbx_reflns_twin.diffrn_id _pdbx_reflns_twin.type _pdbx_reflns_twin.operator _pdbx_reflns_twin.fraction 1 1 1 ? 'H, K, L' 0.500 2 1 1 ? '-H-K, K, -L' 0.500 #