data_5IIV # _entry.id 5IIV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5IIV pdb_00005iiv 10.2210/pdb5iiv/pdb WWPDB D_1000218850 ? ? BMRB 30029 ? 10.13018/BMR30029 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-03-15 2 'Structure model' 1 1 2017-03-29 3 'Structure model' 1 2 2017-04-05 4 'Structure model' 1 3 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5IIV _pdbx_database_status.recvd_initial_deposition_date 2016-03-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB . 30029 unspecified PDB . 5IIR unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Brady, M.R.' 1 ? 'Kaplan, A.R.' 2 ? 'Alexandrescu, A.T.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 1520-4995 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 56 _citation.language ? _citation.page_first 1604 _citation.page_last 1619 _citation.title ;Nuclear Magnetic Resonance Structures of GCN4p Are Largely Conserved When Ion Pairs Are Disrupted at Acidic pH but Show a Relaxation of the Coiled Coil Superhelix. ; _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.6b00634 _citation.pdbx_database_id_PubMed 28230348 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kaplan, A.R.' 1 ? primary 'Brady, M.R.' 2 ? primary 'Maciejewski, M.W.' 3 ? primary 'Kammerer, R.A.' 4 ? primary 'Alexandrescu, A.T.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'General control protein GCN4' _entity.formula_weight 3835.406 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 250-280' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Amino acid biosynthesis regulatory protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSMKQLEDKVEELLSKNYHLENEVARLKKLVGE _entity_poly.pdbx_seq_one_letter_code_can GSMKQLEDKVEELLSKNYHLENEVARLKKLVGE _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 LYS n 1 5 GLN n 1 6 LEU n 1 7 GLU n 1 8 ASP n 1 9 LYS n 1 10 VAL n 1 11 GLU n 1 12 GLU n 1 13 LEU n 1 14 LEU n 1 15 SER n 1 16 LYS n 1 17 ASN n 1 18 TYR n 1 19 HIS n 1 20 LEU n 1 21 GLU n 1 22 ASN n 1 23 GLU n 1 24 VAL n 1 25 ALA n 1 26 ARG n 1 27 LEU n 1 28 LYS n 1 29 LYS n 1 30 LEU n 1 31 VAL n 1 32 GLY n 1 33 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 33 _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'GCN4, AAS3, ARG9, YEL009C' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLU 33 33 33 GLU GLU A . n B 1 1 GLY 1 1 1 GLY GLY B . n B 1 2 SER 2 2 2 SER SER B . n B 1 3 MET 3 3 3 MET MET B . n B 1 4 LYS 4 4 4 LYS LYS B . n B 1 5 GLN 5 5 5 GLN GLN B . n B 1 6 LEU 6 6 6 LEU LEU B . n B 1 7 GLU 7 7 7 GLU GLU B . n B 1 8 ASP 8 8 8 ASP ASP B . n B 1 9 LYS 9 9 9 LYS LYS B . n B 1 10 VAL 10 10 10 VAL VAL B . n B 1 11 GLU 11 11 11 GLU GLU B . n B 1 12 GLU 12 12 12 GLU GLU B . n B 1 13 LEU 13 13 13 LEU LEU B . n B 1 14 LEU 14 14 14 LEU LEU B . n B 1 15 SER 15 15 15 SER SER B . n B 1 16 LYS 16 16 16 LYS LYS B . n B 1 17 ASN 17 17 17 ASN ASN B . n B 1 18 TYR 18 18 18 TYR TYR B . n B 1 19 HIS 19 19 19 HIS HIS B . n B 1 20 LEU 20 20 20 LEU LEU B . n B 1 21 GLU 21 21 21 GLU GLU B . n B 1 22 ASN 22 22 22 ASN ASN B . n B 1 23 GLU 23 23 23 GLU GLU B . n B 1 24 VAL 24 24 24 VAL VAL B . n B 1 25 ALA 25 25 25 ALA ALA B . n B 1 26 ARG 26 26 26 ARG ARG B . n B 1 27 LEU 27 27 27 LEU LEU B . n B 1 28 LYS 28 28 28 LYS LYS B . n B 1 29 LYS 29 29 29 LYS LYS B . n B 1 30 LEU 30 30 30 LEU LEU B . n B 1 31 VAL 31 31 31 VAL VAL B . n B 1 32 GLY 32 32 32 GLY GLY B . n B 1 33 GLU 33 33 33 GLU GLU B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5IIV _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5IIV _struct.title 'GCN4p pH 1.5' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5IIV _struct_keywords.text ;Supercoil parameters, leucine zipper, salt bridge, closely related NMR structures, conformational transition, electrostatics, knobs-into-holes, canonical alpha helix, TRANSCRIPTION ; _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GCN4_YEAST _struct_ref.pdbx_db_accession P03069 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MKQLEDKVEELLSKNYHLENEVARLKKLVGE _struct_ref.pdbx_align_begin 250 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5IIV A 3 ? 33 ? P03069 250 ? 280 ? 3 33 2 1 5IIV B 3 ? 33 ? P03069 250 ? 280 ? 3 33 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5IIV GLY A 1 ? UNP P03069 ? ? 'expression tag' 1 1 1 5IIV SER A 2 ? UNP P03069 ? ? 'expression tag' 2 2 2 5IIV GLY B 1 ? UNP P03069 ? ? 'expression tag' 1 3 2 5IIV SER B 2 ? UNP P03069 ? ? 'expression tag' 2 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1630 ? 1 MORE -23 ? 1 'SSA (A^2)' 5360 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? GLU A 33 ? SER A 2 GLU A 33 1 ? 32 HELX_P HELX_P2 AA2 SER B 2 ? GLU B 33 ? SER B 2 GLU B 33 1 ? 32 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 20 O B GLU 12 ? ? HG B SER 15 ? ? 1.59 2 20 O A GLU 12 ? ? HG A SER 15 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -145.68 -55.30 2 1 SER B 2 ? ? -145.47 -55.16 3 4 SER A 2 ? ? -168.53 -54.61 4 4 SER B 2 ? ? -168.45 -54.05 5 8 SER A 2 ? ? -145.23 50.88 6 8 SER B 2 ? ? -145.84 51.08 7 11 SER A 2 ? ? -154.73 -63.96 8 11 MET A 3 ? ? 54.75 -170.75 9 11 SER B 2 ? ? -154.57 -63.81 10 11 MET B 3 ? ? 54.86 -170.40 11 15 SER A 2 ? ? -147.43 -60.82 12 15 SER B 2 ? ? -147.47 -60.58 13 16 SER A 2 ? ? -124.47 -66.14 14 16 MET A 3 ? ? 42.24 -158.39 15 16 LYS A 9 ? ? -100.58 -61.19 16 16 SER B 2 ? ? -124.55 -66.32 17 16 MET B 3 ? ? 42.52 -158.41 18 16 LYS B 9 ? ? -100.65 -61.16 19 17 SER A 2 ? ? -138.40 -83.95 20 17 MET A 3 ? ? 58.90 174.12 21 17 SER B 2 ? ? -138.03 -83.68 22 17 MET B 3 ? ? 58.68 174.55 # _pdbx_nmr_ensemble.entry_id 5IIV _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 4 '1.5 mM [U-99% 13C; U-99% 15N] GCN4p, 90% H2O/10% D2O' '90% H2O/10% D2O' 1 solution ? 2 '1.5 mM [U-99% 13C; U-99% 15N] GCN4p, 100% D2O' '100% D2O' '13C, 15N' solution ? 3 '1.5 mM 66% - 13C 33%- 12C GCN4p, 100% D2O' '100% D2O' 3 solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 4 GCN4p 1.5 ? mM '[U-99% 13C; U-99% 15N]' 2 GCN4p 1.5 ? mM '[U-99% 13C; U-99% 15N]' 3 GCN4p 1.5 ? mM '66% - 13C 33%- 12C' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 atm 1 1.5 20 ? ? mM 1 ? pH ? ? K 2 298 atm 1 1.5 20 'sample consists of mixed dimer where 66% is 13C labelled monomers and 33% is natural abundance (12C) labelled monomers' ? mM IF-mixed ? pH ? ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 4 '3D HNCACB' 1 isotropic 2 1 4 '2D 1H-15N HSQC' 1 isotropic 3 1 4 '3D 1H-15N NOESY' 1 isotropic 4 1 4 '3D 1H-13C NOESY' 1 isotropic 5 1 4 '3D HNCO' 1 isotropic 6 1 2 '2D 1H-15N HSQC' 1 isotropic 7 1 4 '2D 15N NOESY' 1 isotropic 8 2 3 '3D IF 1H-13C NOESY' 2 isotropic # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing Felix ? 'Accelrys Software Inc.' 2 'chemical shift assignment' CcpNMR ? CCPN 3 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 4 refinement ARIA ? ;Linge, O'Donoghue and Nilges ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 LEU N N N N 144 LEU CA C N S 145 LEU C C N N 146 LEU O O N N 147 LEU CB C N N 148 LEU CG C N N 149 LEU CD1 C N N 150 LEU CD2 C N N 151 LEU OXT O N N 152 LEU H H N N 153 LEU H2 H N N 154 LEU HA H N N 155 LEU HB2 H N N 156 LEU HB3 H N N 157 LEU HG H N N 158 LEU HD11 H N N 159 LEU HD12 H N N 160 LEU HD13 H N N 161 LEU HD21 H N N 162 LEU HD22 H N N 163 LEU HD23 H N N 164 LEU HXT H N N 165 LYS N N N N 166 LYS CA C N S 167 LYS C C N N 168 LYS O O N N 169 LYS CB C N N 170 LYS CG C N N 171 LYS CD C N N 172 LYS CE C N N 173 LYS NZ N N N 174 LYS OXT O N N 175 LYS H H N N 176 LYS H2 H N N 177 LYS HA H N N 178 LYS HB2 H N N 179 LYS HB3 H N N 180 LYS HG2 H N N 181 LYS HG3 H N N 182 LYS HD2 H N N 183 LYS HD3 H N N 184 LYS HE2 H N N 185 LYS HE3 H N N 186 LYS HZ1 H N N 187 LYS HZ2 H N N 188 LYS HZ3 H N N 189 LYS HXT H N N 190 MET N N N N 191 MET CA C N S 192 MET C C N N 193 MET O O N N 194 MET CB C N N 195 MET CG C N N 196 MET SD S N N 197 MET CE C N N 198 MET OXT O N N 199 MET H H N N 200 MET H2 H N N 201 MET HA H N N 202 MET HB2 H N N 203 MET HB3 H N N 204 MET HG2 H N N 205 MET HG3 H N N 206 MET HE1 H N N 207 MET HE2 H N N 208 MET HE3 H N N 209 MET HXT H N N 210 SER N N N N 211 SER CA C N S 212 SER C C N N 213 SER O O N N 214 SER CB C N N 215 SER OG O N N 216 SER OXT O N N 217 SER H H N N 218 SER H2 H N N 219 SER HA H N N 220 SER HB2 H N N 221 SER HB3 H N N 222 SER HG H N N 223 SER HXT H N N 224 TYR N N N N 225 TYR CA C N S 226 TYR C C N N 227 TYR O O N N 228 TYR CB C N N 229 TYR CG C Y N 230 TYR CD1 C Y N 231 TYR CD2 C Y N 232 TYR CE1 C Y N 233 TYR CE2 C Y N 234 TYR CZ C Y N 235 TYR OH O N N 236 TYR OXT O N N 237 TYR H H N N 238 TYR H2 H N N 239 TYR HA H N N 240 TYR HB2 H N N 241 TYR HB3 H N N 242 TYR HD1 H N N 243 TYR HD2 H N N 244 TYR HE1 H N N 245 TYR HE2 H N N 246 TYR HH H N N 247 TYR HXT H N N 248 VAL N N N N 249 VAL CA C N S 250 VAL C C N N 251 VAL O O N N 252 VAL CB C N N 253 VAL CG1 C N N 254 VAL CG2 C N N 255 VAL OXT O N N 256 VAL H H N N 257 VAL H2 H N N 258 VAL HA H N N 259 VAL HB H N N 260 VAL HG11 H N N 261 VAL HG12 H N N 262 VAL HG13 H N N 263 VAL HG21 H N N 264 VAL HG22 H N N 265 VAL HG23 H N N 266 VAL HXT H N N 267 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 SER N CA sing N N 201 SER N H sing N N 202 SER N H2 sing N N 203 SER CA C sing N N 204 SER CA CB sing N N 205 SER CA HA sing N N 206 SER C O doub N N 207 SER C OXT sing N N 208 SER CB OG sing N N 209 SER CB HB2 sing N N 210 SER CB HB3 sing N N 211 SER OG HG sing N N 212 SER OXT HXT sing N N 213 TYR N CA sing N N 214 TYR N H sing N N 215 TYR N H2 sing N N 216 TYR CA C sing N N 217 TYR CA CB sing N N 218 TYR CA HA sing N N 219 TYR C O doub N N 220 TYR C OXT sing N N 221 TYR CB CG sing N N 222 TYR CB HB2 sing N N 223 TYR CB HB3 sing N N 224 TYR CG CD1 doub Y N 225 TYR CG CD2 sing Y N 226 TYR CD1 CE1 sing Y N 227 TYR CD1 HD1 sing N N 228 TYR CD2 CE2 doub Y N 229 TYR CD2 HD2 sing N N 230 TYR CE1 CZ doub Y N 231 TYR CE1 HE1 sing N N 232 TYR CE2 CZ sing Y N 233 TYR CE2 HE2 sing N N 234 TYR CZ OH sing N N 235 TYR OH HH sing N N 236 TYR OXT HXT sing N N 237 VAL N CA sing N N 238 VAL N H sing N N 239 VAL N H2 sing N N 240 VAL CA C sing N N 241 VAL CA CB sing N N 242 VAL CA HA sing N N 243 VAL C O doub N N 244 VAL C OXT sing N N 245 VAL CB CG1 sing N N 246 VAL CB CG2 sing N N 247 VAL CB HB sing N N 248 VAL CG1 HG11 sing N N 249 VAL CG1 HG12 sing N N 250 VAL CG1 HG13 sing N N 251 VAL CG2 HG21 sing N N 252 VAL CG2 HG22 sing N N 253 VAL CG2 HG23 sing N N 254 VAL OXT HXT sing N N 255 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 INOVA ? Varian 600 'cryogenic probe' 2 VNMRS ? Varian 800 'cryogenic probe' # _atom_sites.entry_id 5IIV _atom_sites.fract_transf_matrix[1][1] 0.001000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.001000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.001000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_