data_5IO5 # _entry.id 5IO5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5IO5 pdb_00005io5 10.2210/pdb5io5/pdb WWPDB D_1000219151 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-03-16 2 'Structure model' 1 1 2017-11-15 3 'Structure model' 1 2 2024-01-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' citation 6 3 'Structure model' database_2 7 3 'Structure model' diffrn_radiation_wavelength 8 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' 11 3 'Structure model' '_citation.country' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5IO5 _pdbx_database_status.recvd_initial_deposition_date 2016-03-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 3NPO unspecified PDB . 5IO6 unspecified PDB . 5IO7 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kurpiewska, K.' 1 'Biela, A.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Colloids Surf B Biointerfaces' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1873-4367 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 161 _citation.language ? _citation.page_first 387 _citation.page_last 393 _citation.title 'Investigation of high pressure effect on the structure and adsorption of beta-lactoglobulin.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.colsurfb.2017.10.069 _citation.pdbx_database_id_PubMed 29112912 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kurpiewska, K.' 1 ? primary 'Biela, A.' 2 ? primary 'Loch, J.I.' 3 ? primary 'Swiatek, S.' 4 ? primary 'Jachimska, B.' 5 ? primary 'Lewinski, K.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat Beta-lactoglobulin 18301.174 1 ? ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 water nat water 18.015 14 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Beta-LG # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPA VFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC HI ; _entity_poly.pdbx_seq_one_letter_code_can ;LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPA VFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC HI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 ILE n 1 3 VAL n 1 4 THR n 1 5 GLN n 1 6 THR n 1 7 MET n 1 8 LYS n 1 9 GLY n 1 10 LEU n 1 11 ASP n 1 12 ILE n 1 13 GLN n 1 14 LYS n 1 15 VAL n 1 16 ALA n 1 17 GLY n 1 18 THR n 1 19 TRP n 1 20 TYR n 1 21 SER n 1 22 LEU n 1 23 ALA n 1 24 MET n 1 25 ALA n 1 26 ALA n 1 27 SER n 1 28 ASP n 1 29 ILE n 1 30 SER n 1 31 LEU n 1 32 LEU n 1 33 ASP n 1 34 ALA n 1 35 GLN n 1 36 SER n 1 37 ALA n 1 38 PRO n 1 39 LEU n 1 40 ARG n 1 41 VAL n 1 42 TYR n 1 43 VAL n 1 44 GLU n 1 45 GLU n 1 46 LEU n 1 47 LYS n 1 48 PRO n 1 49 THR n 1 50 PRO n 1 51 GLU n 1 52 GLY n 1 53 ASP n 1 54 LEU n 1 55 GLU n 1 56 ILE n 1 57 LEU n 1 58 LEU n 1 59 GLN n 1 60 LYS n 1 61 TRP n 1 62 GLU n 1 63 ASN n 1 64 GLY n 1 65 GLU n 1 66 CYS n 1 67 ALA n 1 68 GLN n 1 69 LYS n 1 70 LYS n 1 71 ILE n 1 72 ILE n 1 73 ALA n 1 74 GLU n 1 75 LYS n 1 76 THR n 1 77 LYS n 1 78 ILE n 1 79 PRO n 1 80 ALA n 1 81 VAL n 1 82 PHE n 1 83 LYS n 1 84 ILE n 1 85 ASP n 1 86 ALA n 1 87 LEU n 1 88 ASN n 1 89 GLU n 1 90 ASN n 1 91 LYS n 1 92 VAL n 1 93 LEU n 1 94 VAL n 1 95 LEU n 1 96 ASP n 1 97 THR n 1 98 ASP n 1 99 TYR n 1 100 LYS n 1 101 LYS n 1 102 TYR n 1 103 LEU n 1 104 LEU n 1 105 PHE n 1 106 CYS n 1 107 MET n 1 108 GLU n 1 109 ASN n 1 110 SER n 1 111 ALA n 1 112 GLU n 1 113 PRO n 1 114 GLU n 1 115 GLN n 1 116 SER n 1 117 LEU n 1 118 ALA n 1 119 CYS n 1 120 GLN n 1 121 CYS n 1 122 LEU n 1 123 VAL n 1 124 ARG n 1 125 THR n 1 126 PRO n 1 127 GLU n 1 128 VAL n 1 129 ASP n 1 130 ASP n 1 131 GLU n 1 132 ALA n 1 133 LEU n 1 134 GLU n 1 135 LYS n 1 136 PHE n 1 137 ASP n 1 138 LYS n 1 139 ALA n 1 140 LEU n 1 141 LYS n 1 142 ALA n 1 143 LEU n 1 144 PRO n 1 145 MET n 1 146 HIS n 1 147 ILE n 1 148 ARG n 1 149 LEU n 1 150 SER n 1 151 PHE n 1 152 ASN n 1 153 PRO n 1 154 THR n 1 155 GLN n 1 156 LEU n 1 157 GLU n 1 158 GLU n 1 159 GLN n 1 160 CYS n 1 161 HIS n 1 162 ILE n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 162 _entity_src_nat.common_name Bovine _entity_src_nat.pdbx_organism_scientific 'Bos taurus' _entity_src_nat.pdbx_ncbi_taxonomy_id 9913 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue MILK _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 TRP 19 19 19 TRP TRP A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 CYS 106 106 106 CYS CYS A . n A 1 107 MET 107 107 107 MET MET A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 CYS 119 119 119 CYS CYS A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 CYS 121 121 121 CYS CYS A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 MET 145 145 145 MET MET A . n A 1 146 HIS 146 146 146 HIS HIS A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 CYS 160 160 160 CYS CYS A . n A 1 161 HIS 161 161 161 HIS HIS A . n A 1 162 ILE 162 162 162 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 201 1 CL CL A . C 3 HOH 1 301 14 HOH HOH A . C 3 HOH 2 302 13 HOH HOH A . C 3 HOH 3 303 11 HOH HOH A . C 3 HOH 4 304 15 HOH HOH A . C 3 HOH 5 305 10 HOH HOH A . C 3 HOH 6 306 9 HOH HOH A . C 3 HOH 7 307 8 HOH HOH A . C 3 HOH 8 308 1 HOH HOH A . C 3 HOH 9 309 12 HOH HOH A . C 3 HOH 10 310 4 HOH HOH A . C 3 HOH 11 311 7 HOH HOH A . C 3 HOH 12 312 3 HOH HOH A . C 3 HOH 13 313 6 HOH HOH A . C 3 HOH 14 314 2 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 5 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 6 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 7 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5IO5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 53.366 _cell.length_a_esd ? _cell.length_b 53.366 _cell.length_b_esd ? _cell.length_c 113.007 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5IO5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5IO5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.54 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.54 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.34 M citric sodium pH 7.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 298 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'Nonius Kappa CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2008-12-12 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.7 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'SEALED TUBE' _diffrn_source.target ? _diffrn_source.type 'OXFORD DIFFRACTION ENHANCE ULTRA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.7 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5IO5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.79 _reflns.d_resolution_low 46.22 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4831 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.8 _reflns.pdbx_Rmerge_I_obs 0.097 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 3.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.79 _reflns_shell.d_res_low 2.99 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 97.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.488 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 4.4 _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 108.770 _refine.B_iso_mean 40.0368 _refine.B_iso_min 11.940 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5IO5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8500 _refine.ls_d_res_low 37.6700 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4305 _refine.ls_number_reflns_R_free 424 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 91.0000 _refine.ls_percent_reflns_R_free 9.8900 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2041 _refine.ls_R_factor_R_free 0.2952 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1993 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3LBG _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.6600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5000 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.8500 _refine_hist.d_res_low 37.6700 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 14 _refine_hist.number_atoms_total 1295 _refine_hist.pdbx_number_residues_total 162 _refine_hist.pdbx_B_iso_mean_ligand 64.91 _refine_hist.pdbx_B_iso_mean_solvent 32.72 _refine_hist.pdbx_number_atoms_protein 1280 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 ? 1303 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.190 ? 1766 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.054 ? 207 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 225 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.905 ? 821 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.8503 3.2627 1354 . 130 1224 89.0000 . . . 0.3986 . 0.3104 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 3.2627 4.1103 1552 . 161 1391 100.0000 . . . 0.3057 . 0.1895 . . . . . . 3 . . . 'X-RAY DIFFRACTION' 4.1103 46.2224 1632 . 158 1474 100.0000 . . . 0.2389 . 0.1549 . . . . . . 3 . . . # _struct.entry_id 5IO5 _struct.title 'Unliganded form of bovine beta-lactoglobulin, ambient pressure' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5IO5 _struct_keywords.text 'BETA-LACTOGLOBULIN, LIPOCALIN, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LACB_BOVIN _struct_ref.pdbx_db_accession P02754 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPA VFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC HI ; _struct_ref.pdbx_align_begin 17 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5IO5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 162 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02754 _struct_ref_seq.db_align_beg 17 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 178 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 162 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8300 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 11 ? ALA A 16 ? ASP A 11 ALA A 16 5 ? 6 HELX_P HELX_P2 AA2 ASP A 28 ? LEU A 32 ? ASP A 28 LEU A 32 5 ? 5 HELX_P HELX_P3 AA3 ASP A 129 ? LYS A 141 ? ASP A 129 LYS A 141 1 ? 13 HELX_P HELX_P4 AA4 ASN A 152 ? GLU A 158 ? ASN A 152 GLU A 158 1 ? 7 HELX_P HELX_P5 AA5 GLN A 159 ? ILE A 162 ? GLN A 159 ILE A 162 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 66 SG ? ? ? 1_555 A CYS 160 SG ? ? A CYS 66 A CYS 160 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf2 disulf ? ? A CYS 106 SG ? ? ? 1_555 A CYS 119 SG ? ? A CYS 106 A CYS 119 1_555 ? ? ? ? ? ? ? 2.028 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 85 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 85 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 ALA _struct_mon_prot_cis.pdbx_label_seq_id_2 86 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 ALA _struct_mon_prot_cis.pdbx_auth_seq_id_2 86 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -5.25 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 17 ? THR A 18 ? GLY A 17 THR A 18 AA1 2 VAL A 41 ? PRO A 48 ? VAL A 41 PRO A 48 AA1 3 LEU A 54 ? TRP A 61 ? LEU A 54 TRP A 61 AA1 4 CYS A 66 ? LYS A 75 ? CYS A 66 LYS A 75 AA1 5 VAL A 81 ? ILE A 84 ? VAL A 81 ILE A 84 AA1 6 ASN A 90 ? THR A 97 ? ASN A 90 THR A 97 AA1 7 TYR A 102 ? GLU A 108 ? TYR A 102 GLU A 108 AA1 8 LEU A 117 ? VAL A 123 ? LEU A 117 VAL A 123 AA1 9 TYR A 20 ? ALA A 26 ? TYR A 20 ALA A 26 AA1 10 ILE A 147 ? SER A 150 ? ILE A 147 SER A 150 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 17 ? N GLY A 17 O LEU A 46 ? O LEU A 46 AA1 2 3 N LYS A 47 ? N LYS A 47 O GLU A 55 ? O GLU A 55 AA1 3 4 N LEU A 54 ? N LEU A 54 O ALA A 73 ? O ALA A 73 AA1 4 5 N GLU A 74 ? N GLU A 74 O LYS A 83 ? O LYS A 83 AA1 5 6 N PHE A 82 ? N PHE A 82 O VAL A 92 ? O VAL A 92 AA1 6 7 N ASP A 96 ? N ASP A 96 O LEU A 104 ? O LEU A 104 AA1 7 8 N LEU A 103 ? N LEU A 103 O LEU A 122 ? O LEU A 122 AA1 8 9 O CYS A 119 ? O CYS A 119 N ALA A 25 ? N ALA A 25 AA1 9 10 N MET A 24 ? N MET A 24 O LEU A 149 ? O LEU A 149 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NE2 A GLN 35 ? ? OH A TYR 42 ? ? 2.05 2 1 O A ASP 33 ? ? NH1 A ARG 40 ? ? 2.08 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 33 ? ? -66.12 -95.08 2 1 GLU A 62 ? ? -92.71 -65.44 3 1 ASN A 63 ? ? -120.64 -81.73 4 1 ALA A 86 ? ? -165.07 28.43 5 1 TYR A 99 ? ? 66.57 -43.24 6 1 LYS A 101 ? ? -127.50 -63.85 7 1 LEU A 103 ? ? -160.04 119.54 8 1 GLU A 112 ? ? -150.62 87.71 9 1 PRO A 126 ? ? -84.33 45.17 10 1 CYS A 160 ? ? 49.55 27.83 11 1 HIS A 161 ? ? 66.94 -12.52 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 LEU A 87 ? ? ASN A 88 ? ? 142.03 2 1 HIS A 161 ? ? ILE A 162 ? ? 141.77 # _phasing.method MR # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'European Regional Development Fund' _pdbx_audit_support.country Poland _pdbx_audit_support.grant_number POIG.02.01.00-12-023/08 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3LBG _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5IO5 _atom_sites.fract_transf_matrix[1][1] 0.018739 _atom_sites.fract_transf_matrix[1][2] 0.010819 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021637 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008849 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL N O S # loop_