data_5IZB # _entry.id 5IZB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5IZB pdb_00005izb 10.2210/pdb5izb/pdb WWPDB D_1000219466 ? ? BMRB 30042 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 30042 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5IZB _pdbx_database_status.recvd_initial_deposition_date 2016-03-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Monneau, Y.R.' 1 'Lortat-Jacob, H.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Murin CXCL13 solution structure featuring a folded N-terminal domain' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Monneau, Y.R.' 1 ? primary 'Luo, L.' 2 ? primary 'Vives, R.' 3 ? primary 'Arenzana-Seidedos, F.' 4 ? primary 'Lortat-Jacob, H.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'C-X-C motif chemokine 13' _entity.formula_weight 9938.868 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'B lymphocyte chemoattractant,CXC chemokine BLC,Small-inducible cytokine B13' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQ APVSKRRAA ; _entity_poly.pdbx_seq_one_letter_code_can ;MILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQ APVSKRRAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 LEU n 1 4 GLU n 1 5 ALA n 1 6 HIS n 1 7 TYR n 1 8 THR n 1 9 ASN n 1 10 LEU n 1 11 LYS n 1 12 CYS n 1 13 ARG n 1 14 CYS n 1 15 SER n 1 16 GLY n 1 17 VAL n 1 18 ILE n 1 19 SER n 1 20 THR n 1 21 VAL n 1 22 VAL n 1 23 GLY n 1 24 LEU n 1 25 ASN n 1 26 ILE n 1 27 ILE n 1 28 ASP n 1 29 ARG n 1 30 ILE n 1 31 GLN n 1 32 VAL n 1 33 THR n 1 34 PRO n 1 35 PRO n 1 36 GLY n 1 37 ASN n 1 38 GLY n 1 39 CYS n 1 40 PRO n 1 41 LYS n 1 42 THR n 1 43 GLU n 1 44 VAL n 1 45 VAL n 1 46 ILE n 1 47 TRP n 1 48 THR n 1 49 LYS n 1 50 MET n 1 51 LYS n 1 52 LYS n 1 53 VAL n 1 54 ILE n 1 55 CYS n 1 56 VAL n 1 57 ASN n 1 58 PRO n 1 59 ARG n 1 60 ALA n 1 61 LYS n 1 62 TRP n 1 63 LEU n 1 64 GLN n 1 65 ARG n 1 66 LEU n 1 67 LEU n 1 68 ARG n 1 69 HIS n 1 70 VAL n 1 71 GLN n 1 72 SER n 1 73 LYS n 1 74 SER n 1 75 LEU n 1 76 SER n 1 77 SER n 1 78 THR n 1 79 PRO n 1 80 GLN n 1 81 ALA n 1 82 PRO n 1 83 VAL n 1 84 SER n 1 85 LYS n 1 86 ARG n 1 87 ARG n 1 88 ALA n 1 89 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 89 _entity_src_gen.gene_src_common_name 'House mouse' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Cxcl13, Blc, Scyb13' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant 'codon plus' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector pET17b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CXL13_MOUSE _struct_ref.pdbx_db_accession O55038 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQA PVSKRRAA ; _struct_ref.pdbx_align_begin 22 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5IZB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O55038 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 109 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 89 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5IZB _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O55038 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 15N-edited NOESY' 1 isotropic 2 1 2 '3D 13C-edited NOESY' 3 isotropic 3 1 2 '3D 13C-HMQC-NOESY-13C,1H-HMQC' 3 isotropic 4 1 3 '3D HNCACB' 4 isotropic 5 1 3 '3D HNCA' 4 isotropic 6 1 3 '3D CBCA(CO)NH' 4 isotropic 18 1 3 '3D HN(CO)CA' 4 isotropic 7 1 3 '3D HNCO' 4 isotropic 8 1 3 '3D HACACO' 4 isotropic 9 1 3 '3D HCCH-TOCSY' 4 isotropic 10 1 3 '3D HCCH-TOCSY' 4 isotropic 11 1 2 '2D 1H-13C HSQC aliphatic' 2 isotropic 12 1 2 '2D 1H-13C HSQC aromatic' 2 isotropic 13 1 3 '2D 1H-15N HSQC' 4 isotropic 14 1 4 '2D 1H-13C CT-HSQC aliphatic' 1 isotropic 15 1 4 '2D COSYdqf' 2 isotropic 16 1 4 '2D TOCSY' 2 isotropic 17 1 2 '2D CBCGCDHD' 4 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.details ;20 mM Phosphate buffer 100 mM NaCl ; _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '850 uM U-[15N] CXCL13, 95% H2O/5% D2O' '95% H2O/5% D2O' 15Nnoesy solution ? 2 '280 uM U-[13C,15N] CXCL13, 100% D2O' '100% D2O' 13Cnoesy solution ? 3 '280 uM U-[13C,15N] CXCL13, 95% H2O/5% D2O' '95% H2O/5% D2O' assignment solution ? 4 '280 uM [U-10% 13C; U-100% 15N] CXCL13, 100% D2O' '100% D2O' aro+met solution ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 cryoprobe 2 'AVANCE III' ? Bruker 700 cryoprobe 3 'AVANCE III' ? Bruker 950 cryoprobe 4 'AVANCE III' ? Bruker 850 cryoprobe # _pdbx_nmr_refine.entry_id 5IZB _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'in presence of water' _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 5IZB _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5IZB _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA ? 'Guntert, P., Mumenthaler, C., & Wuthrich, K., Herrmann, T.,' 2 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 3 'chemical shift assignment' NMRFAM-SPARKY ? 'Lee et al. Bioinformatics 2015 Apr 15; 31(8):1325-7' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5IZB _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5IZB _struct.title 'Murin CXCL13 solution structure featuring a folded N-terminal domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5IZB _struct_keywords.text 'Chemokine structure N-terminal domain conformational exchange, Signaling protein' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 60 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 70 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 60 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 70 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 12 A CYS 39 1_555 ? ? ? ? ? ? ? 2.039 ? ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 55 SG ? ? A CYS 14 A CYS 55 1_555 ? ? ? ? ? ? ? 2.027 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 2 ? ALA A 5 ? ILE A 2 ALA A 5 AA1 2 ILE A 27 ? THR A 33 ? ILE A 27 THR A 33 AA1 3 GLU A 43 ? THR A 48 ? GLU A 43 THR A 48 AA1 4 VAL A 53 ? VAL A 56 ? VAL A 53 VAL A 56 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 4 ? N GLU A 4 O VAL A 32 ? O VAL A 32 AA1 2 3 N GLN A 31 ? N GLN A 31 O VAL A 45 ? O VAL A 45 AA1 3 4 N ILE A 46 ? N ILE A 46 O ILE A 54 ? O ILE A 54 # _atom_sites.entry_id 5IZB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 TRP 62 62 62 TRP TRP A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ALA 89 89 89 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7380 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-04-05 2 'Structure model' 1 1 2017-09-06 3 'Structure model' 1 2 2019-05-08 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Data collection' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 2 'Structure model' pdbx_struct_sheet_hbond 3 2 'Structure model' struct_conn 4 3 'Structure model' pdbx_nmr_software 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status 7 4 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_comp_id' 3 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_seq_id' 4 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_comp_id' 5 2 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_seq_id' 6 2 'Structure model' '_struct_conn.pdbx_dist_value' 7 3 'Structure model' '_pdbx_nmr_software.name' 8 4 'Structure model' '_database_2.pdbx_DOI' 9 4 'Structure model' '_database_2.pdbx_database_accession' 10 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 11 4 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 CXCL13 850 ? uM '[U-15N]' 2 CXCL13 280 ? uM 'U-[13C,15N]' 3 CXCL13 280 ? uM 'U-[13C,15N]' 4 CXCL13 280 ? uM '[U-10% 13C; U-100% 15N]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 15 ? ? -65.05 87.57 2 1 PRO A 35 ? ? -68.13 76.96 3 2 TYR A 7 ? ? -137.65 -51.23 4 2 LYS A 11 ? ? -154.50 46.53 5 2 CYS A 12 ? ? -57.16 107.24 6 2 PRO A 35 ? ? -68.73 83.20 7 2 ASN A 37 ? ? 60.98 62.10 8 2 SER A 84 ? ? -94.76 -71.76 9 2 LYS A 85 ? ? -175.89 149.54 10 3 ASN A 9 ? ? -146.50 -117.18 11 3 LEU A 10 ? ? -174.67 -54.01 12 4 THR A 8 ? ? -74.58 -72.35 13 4 ASN A 9 ? ? 56.66 89.72 14 4 GLN A 71 ? ? -90.72 57.63 15 4 SER A 72 ? ? 46.20 75.84 16 4 SER A 84 ? ? -75.56 -70.36 17 5 TYR A 7 ? ? -135.71 -50.07 18 5 ASN A 9 ? ? -68.44 4.51 19 5 ASN A 37 ? ? 75.20 -69.00 20 5 GLN A 71 ? ? -88.55 -152.82 21 5 SER A 76 ? ? -172.41 27.72 22 5 ARG A 86 ? ? 61.79 75.98 23 6 LEU A 10 ? ? -173.50 140.52 24 6 CYS A 12 ? ? -59.06 105.26 25 6 LYS A 85 ? ? -77.25 -168.78 26 7 ILE A 2 ? ? -62.45 96.51 27 7 ASN A 9 ? ? -69.80 89.53 28 7 LYS A 73 ? ? -55.71 102.24 29 7 SER A 77 ? ? 64.42 178.47 30 8 LYS A 73 ? ? -164.88 94.07 31 8 SER A 74 ? ? -87.97 37.25 32 8 SER A 76 ? ? -128.78 -160.23 33 8 VAL A 83 ? ? -110.24 72.53 34 8 ARG A 87 ? ? -68.09 76.92 35 9 TYR A 7 ? ? -151.40 -25.77 36 9 ASN A 9 ? ? -63.86 93.57 37 9 LYS A 11 ? ? -51.55 102.55 38 9 SER A 19 ? ? -91.44 30.95 39 9 SER A 84 ? ? -68.81 89.29 40 9 LYS A 85 ? ? -103.42 -162.16 41 10 LEU A 10 ? ? -170.23 97.36 42 10 SER A 72 ? ? -64.46 81.28 43 10 LYS A 73 ? ? -84.28 -79.30 44 10 SER A 74 ? ? 176.32 163.38 45 10 SER A 77 ? ? -61.86 99.37 46 11 LYS A 11 ? ? -61.18 94.70 47 11 PRO A 35 ? ? -77.92 -167.76 48 11 GLN A 71 ? ? -81.02 41.90 49 12 LYS A 11 ? ? -167.99 107.70 50 12 SER A 19 ? ? -97.10 48.30 51 12 GLN A 80 ? ? -68.54 97.44 52 12 ARG A 86 ? ? 66.27 85.09 53 13 LEU A 10 ? ? -75.21 -167.52 54 13 LYS A 11 ? ? -56.83 92.61 55 13 PRO A 35 ? ? -64.81 91.12 56 13 ASN A 37 ? ? -146.33 -50.98 57 13 SER A 72 ? ? 75.41 103.56 58 13 LYS A 73 ? ? -137.83 -77.31 59 13 ALA A 88 ? ? -93.39 -61.89 60 14 THR A 8 ? ? 58.18 83.61 61 14 SER A 19 ? ? -91.40 37.63 62 14 GLN A 71 ? ? -93.32 -102.82 63 14 SER A 76 ? ? 64.99 179.67 64 14 PRO A 82 ? ? -51.48 107.50 65 14 ALA A 88 ? ? -172.56 102.56 66 15 LYS A 11 ? ? -61.18 86.46 67 15 SER A 72 ? ? -86.32 -74.53 68 15 PRO A 79 ? ? -43.48 108.72 69 15 LYS A 85 ? ? -67.23 87.97 70 16 THR A 8 ? ? -68.64 93.39 71 16 SER A 15 ? ? -61.65 1.95 72 16 SER A 19 ? ? -82.82 34.79 73 16 LYS A 73 ? ? 64.37 112.58 74 16 PRO A 79 ? ? -78.00 -163.52 75 16 SER A 84 ? ? -119.60 79.80 76 17 LYS A 11 ? ? -69.76 91.30 77 17 SER A 72 ? ? -50.32 89.22 78 17 SER A 84 ? ? -103.34 64.99 79 18 ASN A 9 ? ? -68.60 86.27 80 18 ASN A 37 ? ? 51.42 77.11 81 18 GLN A 71 ? ? -100.87 -160.30 82 18 SER A 72 ? ? -68.58 79.67 83 18 SER A 84 ? ? -55.35 106.37 84 18 ALA A 88 ? ? -129.59 -169.78 85 19 GLN A 71 ? ? -70.22 -163.05 86 19 SER A 72 ? ? -78.69 20.25 87 20 TYR A 7 ? ? -103.38 -60.92 88 20 GLN A 71 ? ? -78.60 -73.79 89 20 SER A 72 ? ? 179.02 152.28 90 20 LEU A 75 ? ? -50.81 109.19 # _pdbx_audit_support.funding_organization 'French National Research Agency' _pdbx_audit_support.country France _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 #