data_5J7V # _entry.id 5J7V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5J7V pdb_00005j7v 10.2210/pdb5j7v/pdb WWPDB D_1000220089 ? ? EMDB EMD-8144 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-05-18 2 'Structure model' 1 1 2016-06-01 3 'Structure model' 1 2 2016-06-15 4 'Structure model' 1 3 2017-09-13 5 'Structure model' 1 4 2018-01-24 6 'Structure model' 1 5 2018-07-18 7 'Structure model' 1 6 2019-12-11 8 'Structure model' 1 7 2022-04-13 9 'Structure model' 1 8 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Data collection' 5 5 'Structure model' 'Experimental preparation' 6 6 'Structure model' 'Data collection' 7 7 'Structure model' 'Author supporting evidence' 8 8 'Structure model' 'Database references' 9 8 'Structure model' 'Derived calculations' 10 8 'Structure model' Other 11 9 'Structure model' 'Data collection' 12 9 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' em_image_scans 2 4 'Structure model' em_software 3 4 'Structure model' pdbx_audit_support 4 5 'Structure model' em_vitrification 5 6 'Structure model' em_software 6 7 'Structure model' pdbx_audit_support 7 8 'Structure model' database_2 8 8 'Structure model' pdbx_database_status 9 8 'Structure model' pdbx_struct_oper_list 10 8 'Structure model' pdbx_struct_sheet_hbond 11 8 'Structure model' struct_sheet 12 8 'Structure model' struct_sheet_order 13 8 'Structure model' struct_sheet_range 14 9 'Structure model' chem_comp_atom 15 9 'Structure model' chem_comp_bond 16 9 'Structure model' em_3d_fitting_list 17 9 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_em_software.name' 2 4 'Structure model' '_pdbx_audit_support.funding_organization' 3 5 'Structure model' '_em_vitrification.details' 4 6 'Structure model' '_em_software.name' 5 7 'Structure model' '_pdbx_audit_support.funding_organization' 6 8 'Structure model' '_database_2.pdbx_DOI' 7 8 'Structure model' '_database_2.pdbx_database_accession' 8 8 'Structure model' '_pdbx_database_status.pdb_format_compatible' 9 8 'Structure model' '_pdbx_struct_oper_list.name' 10 8 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 11 8 'Structure model' '_pdbx_struct_oper_list.type' 12 9 'Structure model' '_em_3d_fitting_list.accession_code' 13 9 'Structure model' '_em_3d_fitting_list.initial_refinement_model_id' 14 9 'Structure model' '_em_3d_fitting_list.source_name' 15 9 'Structure model' '_em_3d_fitting_list.type' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5J7V _pdbx_database_status.recvd_initial_deposition_date 2016-04-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type EMDB . EMD-8144 'associated EM volume' EMDB . EMD-8145 'other EM volume' PDB . 5J7U unspecified PDB . 5J7O unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Klose, T.' 1 ? 'Rossmann, M.G.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 113 _citation.language ? _citation.page_first 6206 _citation.page_last 6211 _citation.title 'Structure of faustovirus, a large dsDNA virus.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1523999113 _citation.pdbx_database_id_PubMed 27185929 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Klose, T.' 1 ? primary 'Reteno, D.G.' 2 ? primary 'Benamar, S.' 3 ? primary 'Hollerbach, A.' 4 ? primary 'Colson, P.' 5 ? primary 'La Scola, B.' 6 ? primary 'Rossmann, M.G.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'major capsid protein' _entity.formula_weight 71781.891 _entity.pdbx_number_of_molecules 3 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EAGGVFKLIANDGKADRMIMANDLLNDRIKSIMCLRAKQGFSDPTPTLVDIERTHILLINSHYKPFAAMGYEYQKTRPNT GNPTYNSTIQFSIPQFGDFFSDMVVHVQLAATSASAGTVPALPAFIGADDQVLTSTSVVSATENTTSGVYTLYTQSYVNQ QGTTQTVAAAATNFVRYCEYPGLRLFKRVKFEVNGNPLDEYTALAAIMYNKFHVPDFKLTGWKRLIGQEVPVEAASNLVN IASTTPWGSPIVALSDVNGTAVTGSPVNAAITARKLTQVVFGAQTPKATQEQLNMFVPLLFWFRDPRLAIASVSIPYGQR FITVDIEQQSNILFTAPGNLFLQTTVETLLTTGAGKGTATGVLLTQYNRYTTYTPTLASGSSIDGTQAVQNIELYINNIF VTPEIHDIYIKRIGFTLIRVYREQVQREVNAADQVLQSQLKWPVEFIYLGLRPANNIAAGNTYQWRDWHHLTSVTNEPVY DVSQSYARVSIDDTVAPVGSTTFKQSASQVMQNQYIVPVETETLDTVRVKAHGIELYAQYRAQFYRDYIPWNYGSFNLVT PQDKGALFLNFCLYPGTYQPSGHVNISRAREFYIEYTSSFCDSSNPCDLISIAKCINFLLISDGSAVLRYSTKEFYLQCL ILRCI ; _entity_poly.pdbx_seq_one_letter_code_can ;EAGGVFKLIANDGKADRMIMANDLLNDRIKSIMCLRAKQGFSDPTPTLVDIERTHILLINSHYKPFAAMGYEYQKTRPNT GNPTYNSTIQFSIPQFGDFFSDMVVHVQLAATSASAGTVPALPAFIGADDQVLTSTSVVSATENTTSGVYTLYTQSYVNQ QGTTQTVAAAATNFVRYCEYPGLRLFKRVKFEVNGNPLDEYTALAAIMYNKFHVPDFKLTGWKRLIGQEVPVEAASNLVN IASTTPWGSPIVALSDVNGTAVTGSPVNAAITARKLTQVVFGAQTPKATQEQLNMFVPLLFWFRDPRLAIASVSIPYGQR FITVDIEQQSNILFTAPGNLFLQTTVETLLTTGAGKGTATGVLLTQYNRYTTYTPTLASGSSIDGTQAVQNIELYINNIF VTPEIHDIYIKRIGFTLIRVYREQVQREVNAADQVLQSQLKWPVEFIYLGLRPANNIAAGNTYQWRDWHHLTSVTNEPVY DVSQSYARVSIDDTVAPVGSTTFKQSASQVMQNQYIVPVETETLDTVRVKAHGIELYAQYRAQFYRDYIPWNYGSFNLVT PQDKGALFLNFCLYPGTYQPSGHVNISRAREFYIEYTSSFCDSSNPCDLISIAKCINFLLISDGSAVLRYSTKEFYLQCL ILRCI ; _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ALA n 1 3 GLY n 1 4 GLY n 1 5 VAL n 1 6 PHE n 1 7 LYS n 1 8 LEU n 1 9 ILE n 1 10 ALA n 1 11 ASN n 1 12 ASP n 1 13 GLY n 1 14 LYS n 1 15 ALA n 1 16 ASP n 1 17 ARG n 1 18 MET n 1 19 ILE n 1 20 MET n 1 21 ALA n 1 22 ASN n 1 23 ASP n 1 24 LEU n 1 25 LEU n 1 26 ASN n 1 27 ASP n 1 28 ARG n 1 29 ILE n 1 30 LYS n 1 31 SER n 1 32 ILE n 1 33 MET n 1 34 CYS n 1 35 LEU n 1 36 ARG n 1 37 ALA n 1 38 LYS n 1 39 GLN n 1 40 GLY n 1 41 PHE n 1 42 SER n 1 43 ASP n 1 44 PRO n 1 45 THR n 1 46 PRO n 1 47 THR n 1 48 LEU n 1 49 VAL n 1 50 ASP n 1 51 ILE n 1 52 GLU n 1 53 ARG n 1 54 THR n 1 55 HIS n 1 56 ILE n 1 57 LEU n 1 58 LEU n 1 59 ILE n 1 60 ASN n 1 61 SER n 1 62 HIS n 1 63 TYR n 1 64 LYS n 1 65 PRO n 1 66 PHE n 1 67 ALA n 1 68 ALA n 1 69 MET n 1 70 GLY n 1 71 TYR n 1 72 GLU n 1 73 TYR n 1 74 GLN n 1 75 LYS n 1 76 THR n 1 77 ARG n 1 78 PRO n 1 79 ASN n 1 80 THR n 1 81 GLY n 1 82 ASN n 1 83 PRO n 1 84 THR n 1 85 TYR n 1 86 ASN n 1 87 SER n 1 88 THR n 1 89 ILE n 1 90 GLN n 1 91 PHE n 1 92 SER n 1 93 ILE n 1 94 PRO n 1 95 GLN n 1 96 PHE n 1 97 GLY n 1 98 ASP n 1 99 PHE n 1 100 PHE n 1 101 SER n 1 102 ASP n 1 103 MET n 1 104 VAL n 1 105 VAL n 1 106 HIS n 1 107 VAL n 1 108 GLN n 1 109 LEU n 1 110 ALA n 1 111 ALA n 1 112 THR n 1 113 SER n 1 114 ALA n 1 115 SER n 1 116 ALA n 1 117 GLY n 1 118 THR n 1 119 VAL n 1 120 PRO n 1 121 ALA n 1 122 LEU n 1 123 PRO n 1 124 ALA n 1 125 PHE n 1 126 ILE n 1 127 GLY n 1 128 ALA n 1 129 ASP n 1 130 ASP n 1 131 GLN n 1 132 VAL n 1 133 LEU n 1 134 THR n 1 135 SER n 1 136 THR n 1 137 SER n 1 138 VAL n 1 139 VAL n 1 140 SER n 1 141 ALA n 1 142 THR n 1 143 GLU n 1 144 ASN n 1 145 THR n 1 146 THR n 1 147 SER n 1 148 GLY n 1 149 VAL n 1 150 TYR n 1 151 THR n 1 152 LEU n 1 153 TYR n 1 154 THR n 1 155 GLN n 1 156 SER n 1 157 TYR n 1 158 VAL n 1 159 ASN n 1 160 GLN n 1 161 GLN n 1 162 GLY n 1 163 THR n 1 164 THR n 1 165 GLN n 1 166 THR n 1 167 VAL n 1 168 ALA n 1 169 ALA n 1 170 ALA n 1 171 ALA n 1 172 THR n 1 173 ASN n 1 174 PHE n 1 175 VAL n 1 176 ARG n 1 177 TYR n 1 178 CYS n 1 179 GLU n 1 180 TYR n 1 181 PRO n 1 182 GLY n 1 183 LEU n 1 184 ARG n 1 185 LEU n 1 186 PHE n 1 187 LYS n 1 188 ARG n 1 189 VAL n 1 190 LYS n 1 191 PHE n 1 192 GLU n 1 193 VAL n 1 194 ASN n 1 195 GLY n 1 196 ASN n 1 197 PRO n 1 198 LEU n 1 199 ASP n 1 200 GLU n 1 201 TYR n 1 202 THR n 1 203 ALA n 1 204 LEU n 1 205 ALA n 1 206 ALA n 1 207 ILE n 1 208 MET n 1 209 TYR n 1 210 ASN n 1 211 LYS n 1 212 PHE n 1 213 HIS n 1 214 VAL n 1 215 PRO n 1 216 ASP n 1 217 PHE n 1 218 LYS n 1 219 LEU n 1 220 THR n 1 221 GLY n 1 222 TRP n 1 223 LYS n 1 224 ARG n 1 225 LEU n 1 226 ILE n 1 227 GLY n 1 228 GLN n 1 229 GLU n 1 230 VAL n 1 231 PRO n 1 232 VAL n 1 233 GLU n 1 234 ALA n 1 235 ALA n 1 236 SER n 1 237 ASN n 1 238 LEU n 1 239 VAL n 1 240 ASN n 1 241 ILE n 1 242 ALA n 1 243 SER n 1 244 THR n 1 245 THR n 1 246 PRO n 1 247 TRP n 1 248 GLY n 1 249 SER n 1 250 PRO n 1 251 ILE n 1 252 VAL n 1 253 ALA n 1 254 LEU n 1 255 SER n 1 256 ASP n 1 257 VAL n 1 258 ASN n 1 259 GLY n 1 260 THR n 1 261 ALA n 1 262 VAL n 1 263 THR n 1 264 GLY n 1 265 SER n 1 266 PRO n 1 267 VAL n 1 268 ASN n 1 269 ALA n 1 270 ALA n 1 271 ILE n 1 272 THR n 1 273 ALA n 1 274 ARG n 1 275 LYS n 1 276 LEU n 1 277 THR n 1 278 GLN n 1 279 VAL n 1 280 VAL n 1 281 PHE n 1 282 GLY n 1 283 ALA n 1 284 GLN n 1 285 THR n 1 286 PRO n 1 287 LYS n 1 288 ALA n 1 289 THR n 1 290 GLN n 1 291 GLU n 1 292 GLN n 1 293 LEU n 1 294 ASN n 1 295 MET n 1 296 PHE n 1 297 VAL n 1 298 PRO n 1 299 LEU n 1 300 LEU n 1 301 PHE n 1 302 TRP n 1 303 PHE n 1 304 ARG n 1 305 ASP n 1 306 PRO n 1 307 ARG n 1 308 LEU n 1 309 ALA n 1 310 ILE n 1 311 ALA n 1 312 SER n 1 313 VAL n 1 314 SER n 1 315 ILE n 1 316 PRO n 1 317 TYR n 1 318 GLY n 1 319 GLN n 1 320 ARG n 1 321 PHE n 1 322 ILE n 1 323 THR n 1 324 VAL n 1 325 ASP n 1 326 ILE n 1 327 GLU n 1 328 GLN n 1 329 GLN n 1 330 SER n 1 331 ASN n 1 332 ILE n 1 333 LEU n 1 334 PHE n 1 335 THR n 1 336 ALA n 1 337 PRO n 1 338 GLY n 1 339 ASN n 1 340 LEU n 1 341 PHE n 1 342 LEU n 1 343 GLN n 1 344 THR n 1 345 THR n 1 346 VAL n 1 347 GLU n 1 348 THR n 1 349 LEU n 1 350 LEU n 1 351 THR n 1 352 THR n 1 353 GLY n 1 354 ALA n 1 355 GLY n 1 356 LYS n 1 357 GLY n 1 358 THR n 1 359 ALA n 1 360 THR n 1 361 GLY n 1 362 VAL n 1 363 LEU n 1 364 LEU n 1 365 THR n 1 366 GLN n 1 367 TYR n 1 368 ASN n 1 369 ARG n 1 370 TYR n 1 371 THR n 1 372 THR n 1 373 TYR n 1 374 THR n 1 375 PRO n 1 376 THR n 1 377 LEU n 1 378 ALA n 1 379 SER n 1 380 GLY n 1 381 SER n 1 382 SER n 1 383 ILE n 1 384 ASP n 1 385 GLY n 1 386 THR n 1 387 GLN n 1 388 ALA n 1 389 VAL n 1 390 GLN n 1 391 ASN n 1 392 ILE n 1 393 GLU n 1 394 LEU n 1 395 TYR n 1 396 ILE n 1 397 ASN n 1 398 ASN n 1 399 ILE n 1 400 PHE n 1 401 VAL n 1 402 THR n 1 403 PRO n 1 404 GLU n 1 405 ILE n 1 406 HIS n 1 407 ASP n 1 408 ILE n 1 409 TYR n 1 410 ILE n 1 411 LYS n 1 412 ARG n 1 413 ILE n 1 414 GLY n 1 415 PHE n 1 416 THR n 1 417 LEU n 1 418 ILE n 1 419 ARG n 1 420 VAL n 1 421 TYR n 1 422 ARG n 1 423 GLU n 1 424 GLN n 1 425 VAL n 1 426 GLN n 1 427 ARG n 1 428 GLU n 1 429 VAL n 1 430 ASN n 1 431 ALA n 1 432 ALA n 1 433 ASP n 1 434 GLN n 1 435 VAL n 1 436 LEU n 1 437 GLN n 1 438 SER n 1 439 GLN n 1 440 LEU n 1 441 LYS n 1 442 TRP n 1 443 PRO n 1 444 VAL n 1 445 GLU n 1 446 PHE n 1 447 ILE n 1 448 TYR n 1 449 LEU n 1 450 GLY n 1 451 LEU n 1 452 ARG n 1 453 PRO n 1 454 ALA n 1 455 ASN n 1 456 ASN n 1 457 ILE n 1 458 ALA n 1 459 ALA n 1 460 GLY n 1 461 ASN n 1 462 THR n 1 463 TYR n 1 464 GLN n 1 465 TRP n 1 466 ARG n 1 467 ASP n 1 468 TRP n 1 469 HIS n 1 470 HIS n 1 471 LEU n 1 472 THR n 1 473 SER n 1 474 VAL n 1 475 THR n 1 476 ASN n 1 477 GLU n 1 478 PRO n 1 479 VAL n 1 480 TYR n 1 481 ASP n 1 482 VAL n 1 483 SER n 1 484 GLN n 1 485 SER n 1 486 TYR n 1 487 ALA n 1 488 ARG n 1 489 VAL n 1 490 SER n 1 491 ILE n 1 492 ASP n 1 493 ASP n 1 494 THR n 1 495 VAL n 1 496 ALA n 1 497 PRO n 1 498 VAL n 1 499 GLY n 1 500 SER n 1 501 THR n 1 502 THR n 1 503 PHE n 1 504 LYS n 1 505 GLN n 1 506 SER n 1 507 ALA n 1 508 SER n 1 509 GLN n 1 510 VAL n 1 511 MET n 1 512 GLN n 1 513 ASN n 1 514 GLN n 1 515 TYR n 1 516 ILE n 1 517 VAL n 1 518 PRO n 1 519 VAL n 1 520 GLU n 1 521 THR n 1 522 GLU n 1 523 THR n 1 524 LEU n 1 525 ASP n 1 526 THR n 1 527 VAL n 1 528 ARG n 1 529 VAL n 1 530 LYS n 1 531 ALA n 1 532 HIS n 1 533 GLY n 1 534 ILE n 1 535 GLU n 1 536 LEU n 1 537 TYR n 1 538 ALA n 1 539 GLN n 1 540 TYR n 1 541 ARG n 1 542 ALA n 1 543 GLN n 1 544 PHE n 1 545 TYR n 1 546 ARG n 1 547 ASP n 1 548 TYR n 1 549 ILE n 1 550 PRO n 1 551 TRP n 1 552 ASN n 1 553 TYR n 1 554 GLY n 1 555 SER n 1 556 PHE n 1 557 ASN n 1 558 LEU n 1 559 VAL n 1 560 THR n 1 561 PRO n 1 562 GLN n 1 563 ASP n 1 564 LYS n 1 565 GLY n 1 566 ALA n 1 567 LEU n 1 568 PHE n 1 569 LEU n 1 570 ASN n 1 571 PHE n 1 572 CYS n 1 573 LEU n 1 574 TYR n 1 575 PRO n 1 576 GLY n 1 577 THR n 1 578 TYR n 1 579 GLN n 1 580 PRO n 1 581 SER n 1 582 GLY n 1 583 HIS n 1 584 VAL n 1 585 ASN n 1 586 ILE n 1 587 SER n 1 588 ARG n 1 589 ALA n 1 590 ARG n 1 591 GLU n 1 592 PHE n 1 593 TYR n 1 594 ILE n 1 595 GLU n 1 596 TYR n 1 597 THR n 1 598 SER n 1 599 SER n 1 600 PHE n 1 601 CYS n 1 602 ASP n 1 603 SER n 1 604 SER n 1 605 ASN n 1 606 PRO n 1 607 CYS n 1 608 ASP n 1 609 LEU n 1 610 ILE n 1 611 SER n 1 612 ILE n 1 613 ALA n 1 614 LYS n 1 615 CYS n 1 616 ILE n 1 617 ASN n 1 618 PHE n 1 619 LEU n 1 620 LEU n 1 621 ILE n 1 622 SER n 1 623 ASP n 1 624 GLY n 1 625 SER n 1 626 ALA n 1 627 VAL n 1 628 LEU n 1 629 ARG n 1 630 TYR n 1 631 SER n 1 632 THR n 1 633 LYS n 1 634 GLU n 1 635 PHE n 1 636 TYR n 1 637 LEU n 1 638 GLN n 1 639 CYS n 1 640 LEU n 1 641 ILE n 1 642 LEU n 1 643 ARG n 1 644 CYS n 1 645 ILE n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 645 _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific Faustovirus _entity_src_nat.pdbx_ncbi_taxonomy_id 1477405 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 0 ? ? ? A . n A 1 2 ALA 2 1 ? ? ? A . n A 1 3 GLY 3 2 ? ? ? A . n A 1 4 GLY 4 3 ? ? ? A . n A 1 5 VAL 5 4 ? ? ? A . n A 1 6 PHE 6 5 ? ? ? A . n A 1 7 LYS 7 6 ? ? ? A . n A 1 8 LEU 8 7 ? ? ? A . n A 1 9 ILE 9 8 ? ? ? A . n A 1 10 ALA 10 9 ? ? ? A . n A 1 11 ASN 11 10 ? ? ? A . n A 1 12 ASP 12 11 11 ASP ASP A . n A 1 13 GLY 13 12 12 GLY GLY A . n A 1 14 LYS 14 13 13 LYS LYS A . n A 1 15 ALA 15 14 14 ALA ALA A . n A 1 16 ASP 16 15 15 ASP ASP A . n A 1 17 ARG 17 16 16 ARG ARG A . n A 1 18 MET 18 17 17 MET MET A . n A 1 19 ILE 19 18 18 ILE ILE A . n A 1 20 MET 20 19 19 MET MET A . n A 1 21 ALA 21 20 20 ALA ALA A . n A 1 22 ASN 22 21 21 ASN ASN A . n A 1 23 ASP 23 22 22 ASP ASP A . n A 1 24 LEU 24 23 23 LEU LEU A . n A 1 25 LEU 25 24 24 LEU LEU A . n A 1 26 ASN 26 25 25 ASN ASN A . n A 1 27 ASP 27 26 26 ASP ASP A . n A 1 28 ARG 28 27 27 ARG ARG A . n A 1 29 ILE 29 28 28 ILE ILE A . n A 1 30 LYS 30 29 29 LYS LYS A . n A 1 31 SER 31 30 30 SER SER A . n A 1 32 ILE 32 31 31 ILE ILE A . n A 1 33 MET 33 32 32 MET MET A . n A 1 34 CYS 34 33 33 CYS CYS A . n A 1 35 LEU 35 34 34 LEU LEU A . n A 1 36 ARG 36 35 35 ARG ARG A . n A 1 37 ALA 37 36 36 ALA ALA A . n A 1 38 LYS 38 37 37 LYS LYS A . n A 1 39 GLN 39 38 38 GLN GLN A . n A 1 40 GLY 40 39 39 GLY GLY A . n A 1 41 PHE 41 40 40 PHE PHE A . n A 1 42 SER 42 41 41 SER SER A . n A 1 43 ASP 43 42 42 ASP ASP A . n A 1 44 PRO 44 43 43 PRO PRO A . n A 1 45 THR 45 44 44 THR THR A . n A 1 46 PRO 46 45 45 PRO PRO A . n A 1 47 THR 47 46 46 THR THR A . n A 1 48 LEU 48 47 47 LEU LEU A . n A 1 49 VAL 49 48 48 VAL VAL A . n A 1 50 ASP 50 49 49 ASP ASP A . n A 1 51 ILE 51 50 50 ILE ILE A . n A 1 52 GLU 52 51 51 GLU GLU A . n A 1 53 ARG 53 52 52 ARG ARG A . n A 1 54 THR 54 53 53 THR THR A . n A 1 55 HIS 55 54 54 HIS HIS A . n A 1 56 ILE 56 55 55 ILE ILE A . n A 1 57 LEU 57 56 56 LEU LEU A . n A 1 58 LEU 58 57 57 LEU LEU A . n A 1 59 ILE 59 58 58 ILE ILE A . n A 1 60 ASN 60 59 59 ASN ASN A . n A 1 61 SER 61 60 60 SER SER A . n A 1 62 HIS 62 61 61 HIS HIS A . n A 1 63 TYR 63 62 62 TYR TYR A . n A 1 64 LYS 64 63 63 LYS LYS A . n A 1 65 PRO 65 64 64 PRO PRO A . n A 1 66 PHE 66 65 65 PHE PHE A . n A 1 67 ALA 67 66 66 ALA ALA A . n A 1 68 ALA 68 67 67 ALA ALA A . n A 1 69 MET 69 68 68 MET MET A . n A 1 70 GLY 70 69 69 GLY GLY A . n A 1 71 TYR 71 70 70 TYR TYR A . n A 1 72 GLU 72 71 71 GLU GLU A . n A 1 73 TYR 73 72 72 TYR TYR A . n A 1 74 GLN 74 73 73 GLN GLN A . n A 1 75 LYS 75 74 74 LYS LYS A . n A 1 76 THR 76 75 75 THR THR A . n A 1 77 ARG 77 76 76 ARG ARG A . n A 1 78 PRO 78 77 77 PRO PRO A . n A 1 79 ASN 79 78 78 ASN ASN A . n A 1 80 THR 80 79 79 THR THR A . n A 1 81 GLY 81 80 80 GLY GLY A . n A 1 82 ASN 82 81 81 ASN ASN A . n A 1 83 PRO 83 82 82 PRO PRO A . n A 1 84 THR 84 83 83 THR THR A . n A 1 85 TYR 85 84 84 TYR TYR A . n A 1 86 ASN 86 85 85 ASN ASN A . n A 1 87 SER 87 86 86 SER SER A . n A 1 88 THR 88 87 87 THR THR A . n A 1 89 ILE 89 88 88 ILE ILE A . n A 1 90 GLN 90 89 89 GLN GLN A . n A 1 91 PHE 91 90 90 PHE PHE A . n A 1 92 SER 92 91 91 SER SER A . n A 1 93 ILE 93 92 92 ILE ILE A . n A 1 94 PRO 94 93 93 PRO PRO A . n A 1 95 GLN 95 94 94 GLN GLN A . n A 1 96 PHE 96 95 95 PHE PHE A . n A 1 97 GLY 97 96 96 GLY GLY A . n A 1 98 ASP 98 97 97 ASP ASP A . n A 1 99 PHE 99 98 98 PHE PHE A . n A 1 100 PHE 100 99 99 PHE PHE A . n A 1 101 SER 101 100 100 SER SER A . n A 1 102 ASP 102 101 101 ASP ASP A . n A 1 103 MET 103 102 102 MET MET A . n A 1 104 VAL 104 103 103 VAL VAL A . n A 1 105 VAL 105 104 104 VAL VAL A . n A 1 106 HIS 106 105 105 HIS HIS A . n A 1 107 VAL 107 106 106 VAL VAL A . n A 1 108 GLN 108 107 107 GLN GLN A . n A 1 109 LEU 109 108 108 LEU LEU A . n A 1 110 ALA 110 109 109 ALA ALA A . n A 1 111 ALA 111 110 110 ALA ALA A . n A 1 112 THR 112 111 111 THR THR A . n A 1 113 SER 113 112 112 SER SER A . n A 1 114 ALA 114 113 113 ALA ALA A . n A 1 115 SER 115 114 114 SER SER A . n A 1 116 ALA 116 115 115 ALA ALA A . n A 1 117 GLY 117 116 116 GLY GLY A . n A 1 118 THR 118 117 117 THR THR A . n A 1 119 VAL 119 118 118 VAL VAL A . n A 1 120 PRO 120 119 119 PRO PRO A . n A 1 121 ALA 121 120 120 ALA ALA A . n A 1 122 LEU 122 121 121 LEU LEU A . n A 1 123 PRO 123 122 122 PRO PRO A . n A 1 124 ALA 124 123 123 ALA ALA A . n A 1 125 PHE 125 124 124 PHE PHE A . n A 1 126 ILE 126 125 125 ILE ILE A . n A 1 127 GLY 127 126 126 GLY GLY A . n A 1 128 ALA 128 127 127 ALA ALA A . n A 1 129 ASP 129 128 128 ASP ASP A . n A 1 130 ASP 130 129 129 ASP ASP A . n A 1 131 GLN 131 130 130 GLN GLN A . n A 1 132 VAL 132 131 131 VAL VAL A . n A 1 133 LEU 133 132 132 LEU LEU A . n A 1 134 THR 134 133 133 THR THR A . n A 1 135 SER 135 134 134 SER SER A . n A 1 136 THR 136 135 135 THR THR A . n A 1 137 SER 137 136 136 SER SER A . n A 1 138 VAL 138 137 137 VAL VAL A . n A 1 139 VAL 139 138 138 VAL VAL A . n A 1 140 SER 140 139 139 SER SER A . n A 1 141 ALA 141 140 140 ALA ALA A . n A 1 142 THR 142 141 141 THR THR A . n A 1 143 GLU 143 142 142 GLU GLU A . n A 1 144 ASN 144 143 143 ASN ASN A . n A 1 145 THR 145 144 144 THR THR A . n A 1 146 THR 146 145 145 THR THR A . n A 1 147 SER 147 146 146 SER SER A . n A 1 148 GLY 148 147 147 GLY GLY A . n A 1 149 VAL 149 148 148 VAL VAL A . n A 1 150 TYR 150 149 149 TYR TYR A . n A 1 151 THR 151 150 150 THR THR A . n A 1 152 LEU 152 151 151 LEU LEU A . n A 1 153 TYR 153 152 152 TYR TYR A . n A 1 154 THR 154 153 153 THR THR A . n A 1 155 GLN 155 154 154 GLN GLN A . n A 1 156 SER 156 155 155 SER SER A . n A 1 157 TYR 157 156 156 TYR TYR A . n A 1 158 VAL 158 157 157 VAL VAL A . n A 1 159 ASN 159 158 158 ASN ASN A . n A 1 160 GLN 160 159 159 GLN GLN A . n A 1 161 GLN 161 160 160 GLN GLN A . n A 1 162 GLY 162 161 161 GLY GLY A . n A 1 163 THR 163 162 162 THR THR A . n A 1 164 THR 164 163 163 THR THR A . n A 1 165 GLN 165 164 164 GLN GLN A . n A 1 166 THR 166 165 165 THR THR A . n A 1 167 VAL 167 166 166 VAL VAL A . n A 1 168 ALA 168 167 167 ALA ALA A . n A 1 169 ALA 169 168 168 ALA ALA A . n A 1 170 ALA 170 169 169 ALA ALA A . n A 1 171 ALA 171 170 170 ALA ALA A . n A 1 172 THR 172 171 171 THR THR A . n A 1 173 ASN 173 172 172 ASN ASN A . n A 1 174 PHE 174 173 173 PHE PHE A . n A 1 175 VAL 175 174 174 VAL VAL A . n A 1 176 ARG 176 175 175 ARG ARG A . n A 1 177 TYR 177 176 176 TYR TYR A . n A 1 178 CYS 178 177 177 CYS CYS A . n A 1 179 GLU 179 178 178 GLU GLU A . n A 1 180 TYR 180 179 179 TYR TYR A . n A 1 181 PRO 181 180 180 PRO PRO A . n A 1 182 GLY 182 181 181 GLY GLY A . n A 1 183 LEU 183 182 182 LEU LEU A . n A 1 184 ARG 184 183 183 ARG ARG A . n A 1 185 LEU 185 184 184 LEU LEU A . n A 1 186 PHE 186 185 185 PHE PHE A . n A 1 187 LYS 187 186 186 LYS LYS A . n A 1 188 ARG 188 187 187 ARG ARG A . n A 1 189 VAL 189 188 188 VAL VAL A . n A 1 190 LYS 190 189 189 LYS LYS A . n A 1 191 PHE 191 190 190 PHE PHE A . n A 1 192 GLU 192 191 191 GLU GLU A . n A 1 193 VAL 193 192 192 VAL VAL A . n A 1 194 ASN 194 193 193 ASN ASN A . n A 1 195 GLY 195 194 194 GLY GLY A . n A 1 196 ASN 196 195 195 ASN ASN A . n A 1 197 PRO 197 196 196 PRO PRO A . n A 1 198 LEU 198 197 197 LEU LEU A . n A 1 199 ASP 199 198 198 ASP ASP A . n A 1 200 GLU 200 199 199 GLU GLU A . n A 1 201 TYR 201 200 200 TYR TYR A . n A 1 202 THR 202 201 201 THR THR A . n A 1 203 ALA 203 202 202 ALA ALA A . n A 1 204 LEU 204 203 203 LEU LEU A . n A 1 205 ALA 205 204 204 ALA ALA A . n A 1 206 ALA 206 205 205 ALA ALA A . n A 1 207 ILE 207 206 206 ILE ILE A . n A 1 208 MET 208 207 207 MET MET A . n A 1 209 TYR 209 208 208 TYR TYR A . n A 1 210 ASN 210 209 209 ASN ASN A . n A 1 211 LYS 211 210 210 LYS LYS A . n A 1 212 PHE 212 211 211 PHE PHE A . n A 1 213 HIS 213 212 212 HIS HIS A . n A 1 214 VAL 214 213 213 VAL VAL A . n A 1 215 PRO 215 214 214 PRO PRO A . n A 1 216 ASP 216 215 215 ASP ASP A . n A 1 217 PHE 217 216 216 PHE PHE A . n A 1 218 LYS 218 217 217 LYS LYS A . n A 1 219 LEU 219 218 218 LEU LEU A . n A 1 220 THR 220 219 219 THR THR A . n A 1 221 GLY 221 220 220 GLY GLY A . n A 1 222 TRP 222 221 221 TRP TRP A . n A 1 223 LYS 223 222 222 LYS LYS A . n A 1 224 ARG 224 223 223 ARG ARG A . n A 1 225 LEU 225 224 224 LEU LEU A . n A 1 226 ILE 226 225 225 ILE ILE A . n A 1 227 GLY 227 226 226 GLY GLY A . n A 1 228 GLN 228 227 227 GLN GLN A . n A 1 229 GLU 229 228 228 GLU GLU A . n A 1 230 VAL 230 229 229 VAL VAL A . n A 1 231 PRO 231 230 230 PRO PRO A . n A 1 232 VAL 232 231 231 VAL VAL A . n A 1 233 GLU 233 232 232 GLU GLU A . n A 1 234 ALA 234 233 233 ALA ALA A . n A 1 235 ALA 235 234 234 ALA ALA A . n A 1 236 SER 236 235 235 SER SER A . n A 1 237 ASN 237 236 236 ASN ASN A . n A 1 238 LEU 238 237 237 LEU LEU A . n A 1 239 VAL 239 238 238 VAL VAL A . n A 1 240 ASN 240 239 239 ASN ASN A . n A 1 241 ILE 241 240 240 ILE ILE A . n A 1 242 ALA 242 241 241 ALA ALA A . n A 1 243 SER 243 242 242 SER SER A . n A 1 244 THR 244 243 243 THR THR A . n A 1 245 THR 245 244 244 THR THR A . n A 1 246 PRO 246 245 245 PRO PRO A . n A 1 247 TRP 247 246 246 TRP TRP A . n A 1 248 GLY 248 247 247 GLY GLY A . n A 1 249 SER 249 248 248 SER SER A . n A 1 250 PRO 250 249 249 PRO PRO A . n A 1 251 ILE 251 250 250 ILE ILE A . n A 1 252 VAL 252 251 251 VAL VAL A . n A 1 253 ALA 253 252 252 ALA ALA A . n A 1 254 LEU 254 253 253 LEU LEU A . n A 1 255 SER 255 254 254 SER SER A . n A 1 256 ASP 256 255 255 ASP ASP A . n A 1 257 VAL 257 256 256 VAL VAL A . n A 1 258 ASN 258 257 257 ASN ASN A . n A 1 259 GLY 259 258 258 GLY GLY A . n A 1 260 THR 260 259 259 THR THR A . n A 1 261 ALA 261 260 260 ALA ALA A . n A 1 262 VAL 262 261 261 VAL VAL A . n A 1 263 THR 263 262 262 THR THR A . n A 1 264 GLY 264 263 263 GLY GLY A . n A 1 265 SER 265 264 264 SER SER A . n A 1 266 PRO 266 265 265 PRO PRO A . n A 1 267 VAL 267 266 266 VAL VAL A . n A 1 268 ASN 268 267 267 ASN ASN A . n A 1 269 ALA 269 268 268 ALA ALA A . n A 1 270 ALA 270 269 269 ALA ALA A . n A 1 271 ILE 271 270 270 ILE ILE A . n A 1 272 THR 272 271 271 THR THR A . n A 1 273 ALA 273 272 272 ALA ALA A . n A 1 274 ARG 274 273 273 ARG ARG A . n A 1 275 LYS 275 274 274 LYS LYS A . n A 1 276 LEU 276 275 275 LEU LEU A . n A 1 277 THR 277 276 276 THR THR A . n A 1 278 GLN 278 277 277 GLN GLN A . n A 1 279 VAL 279 278 278 VAL VAL A . n A 1 280 VAL 280 279 279 VAL VAL A . n A 1 281 PHE 281 280 280 PHE PHE A . n A 1 282 GLY 282 281 281 GLY GLY A . n A 1 283 ALA 283 282 282 ALA ALA A . n A 1 284 GLN 284 283 283 GLN GLN A . n A 1 285 THR 285 284 284 THR THR A . n A 1 286 PRO 286 285 285 PRO PRO A . n A 1 287 LYS 287 286 286 LYS LYS A . n A 1 288 ALA 288 287 287 ALA ALA A . n A 1 289 THR 289 288 288 THR THR A . n A 1 290 GLN 290 289 289 GLN GLN A . n A 1 291 GLU 291 290 290 GLU GLU A . n A 1 292 GLN 292 291 291 GLN GLN A . n A 1 293 LEU 293 292 292 LEU LEU A . n A 1 294 ASN 294 293 293 ASN ASN A . n A 1 295 MET 295 294 294 MET MET A . n A 1 296 PHE 296 295 295 PHE PHE A . n A 1 297 VAL 297 296 296 VAL VAL A . n A 1 298 PRO 298 297 297 PRO PRO A . n A 1 299 LEU 299 298 298 LEU LEU A . n A 1 300 LEU 300 299 299 LEU LEU A . n A 1 301 PHE 301 300 300 PHE PHE A . n A 1 302 TRP 302 301 301 TRP TRP A . n A 1 303 PHE 303 302 302 PHE PHE A . n A 1 304 ARG 304 303 303 ARG ARG A . n A 1 305 ASP 305 304 304 ASP ASP A . n A 1 306 PRO 306 305 305 PRO PRO A . n A 1 307 ARG 307 306 306 ARG ARG A . n A 1 308 LEU 308 307 307 LEU LEU A . n A 1 309 ALA 309 308 308 ALA ALA A . n A 1 310 ILE 310 309 309 ILE ILE A . n A 1 311 ALA 311 310 310 ALA ALA A . n A 1 312 SER 312 311 311 SER SER A . n A 1 313 VAL 313 312 312 VAL VAL A . n A 1 314 SER 314 313 313 SER SER A . n A 1 315 ILE 315 314 314 ILE ILE A . n A 1 316 PRO 316 315 315 PRO PRO A . n A 1 317 TYR 317 316 316 TYR TYR A . n A 1 318 GLY 318 317 317 GLY GLY A . n A 1 319 GLN 319 318 318 GLN GLN A . n A 1 320 ARG 320 319 319 ARG ARG A . n A 1 321 PHE 321 320 320 PHE PHE A . n A 1 322 ILE 322 321 321 ILE ILE A . n A 1 323 THR 323 322 322 THR THR A . n A 1 324 VAL 324 323 323 VAL VAL A . n A 1 325 ASP 325 324 324 ASP ASP A . n A 1 326 ILE 326 325 325 ILE ILE A . n A 1 327 GLU 327 326 326 GLU GLU A . n A 1 328 GLN 328 327 327 GLN GLN A . n A 1 329 GLN 329 328 328 GLN GLN A . n A 1 330 SER 330 329 329 SER SER A . n A 1 331 ASN 331 330 330 ASN ASN A . n A 1 332 ILE 332 331 331 ILE ILE A . n A 1 333 LEU 333 332 332 LEU LEU A . n A 1 334 PHE 334 333 333 PHE PHE A . n A 1 335 THR 335 334 334 THR THR A . n A 1 336 ALA 336 335 335 ALA ALA A . n A 1 337 PRO 337 336 336 PRO PRO A . n A 1 338 GLY 338 337 337 GLY GLY A . n A 1 339 ASN 339 338 338 ASN ASN A . n A 1 340 LEU 340 339 339 LEU LEU A . n A 1 341 PHE 341 340 340 PHE PHE A . n A 1 342 LEU 342 341 341 LEU LEU A . n A 1 343 GLN 343 342 342 GLN GLN A . n A 1 344 THR 344 343 343 THR THR A . n A 1 345 THR 345 344 344 THR THR A . n A 1 346 VAL 346 345 345 VAL VAL A . n A 1 347 GLU 347 346 346 GLU GLU A . n A 1 348 THR 348 347 347 THR THR A . n A 1 349 LEU 349 348 348 LEU LEU A . n A 1 350 LEU 350 349 349 LEU LEU A . n A 1 351 THR 351 350 350 THR THR A . n A 1 352 THR 352 351 351 THR THR A . n A 1 353 GLY 353 352 352 GLY GLY A . n A 1 354 ALA 354 353 353 ALA ALA A . n A 1 355 GLY 355 354 354 GLY GLY A . n A 1 356 LYS 356 355 355 LYS LYS A . n A 1 357 GLY 357 356 356 GLY GLY A . n A 1 358 THR 358 357 357 THR THR A . n A 1 359 ALA 359 358 358 ALA ALA A . n A 1 360 THR 360 359 359 THR THR A . n A 1 361 GLY 361 360 360 GLY GLY A . n A 1 362 VAL 362 361 361 VAL VAL A . n A 1 363 LEU 363 362 362 LEU LEU A . n A 1 364 LEU 364 363 363 LEU LEU A . n A 1 365 THR 365 364 364 THR THR A . n A 1 366 GLN 366 365 365 GLN GLN A . n A 1 367 TYR 367 366 366 TYR TYR A . n A 1 368 ASN 368 367 367 ASN ASN A . n A 1 369 ARG 369 368 368 ARG ARG A . n A 1 370 TYR 370 369 369 TYR TYR A . n A 1 371 THR 371 370 370 THR THR A . n A 1 372 THR 372 371 371 THR THR A . n A 1 373 TYR 373 372 372 TYR TYR A . n A 1 374 THR 374 373 373 THR THR A . n A 1 375 PRO 375 374 374 PRO PRO A . n A 1 376 THR 376 375 375 THR THR A . n A 1 377 LEU 377 376 376 LEU LEU A . n A 1 378 ALA 378 377 377 ALA ALA A . n A 1 379 SER 379 378 378 SER SER A . n A 1 380 GLY 380 379 379 GLY GLY A . n A 1 381 SER 381 380 380 SER SER A . n A 1 382 SER 382 381 381 SER SER A . n A 1 383 ILE 383 382 382 ILE ILE A . n A 1 384 ASP 384 383 383 ASP ASP A . n A 1 385 GLY 385 384 384 GLY GLY A . n A 1 386 THR 386 385 385 THR THR A . n A 1 387 GLN 387 386 386 GLN GLN A . n A 1 388 ALA 388 387 387 ALA ALA A . n A 1 389 VAL 389 388 388 VAL VAL A . n A 1 390 GLN 390 389 389 GLN GLN A . n A 1 391 ASN 391 390 390 ASN ASN A . n A 1 392 ILE 392 391 391 ILE ILE A . n A 1 393 GLU 393 392 392 GLU GLU A . n A 1 394 LEU 394 393 393 LEU LEU A . n A 1 395 TYR 395 394 394 TYR TYR A . n A 1 396 ILE 396 395 395 ILE ILE A . n A 1 397 ASN 397 396 396 ASN ASN A . n A 1 398 ASN 398 397 397 ASN ASN A . n A 1 399 ILE 399 398 398 ILE ILE A . n A 1 400 PHE 400 399 399 PHE PHE A . n A 1 401 VAL 401 400 400 VAL VAL A . n A 1 402 THR 402 401 401 THR THR A . n A 1 403 PRO 403 402 402 PRO PRO A . n A 1 404 GLU 404 403 403 GLU GLU A . n A 1 405 ILE 405 404 404 ILE ILE A . n A 1 406 HIS 406 405 405 HIS HIS A . n A 1 407 ASP 407 406 406 ASP ASP A . n A 1 408 ILE 408 407 407 ILE ILE A . n A 1 409 TYR 409 408 408 TYR TYR A . n A 1 410 ILE 410 409 409 ILE ILE A . n A 1 411 LYS 411 410 410 LYS LYS A . n A 1 412 ARG 412 411 411 ARG ARG A . n A 1 413 ILE 413 412 412 ILE ILE A . n A 1 414 GLY 414 413 413 GLY GLY A . n A 1 415 PHE 415 414 414 PHE PHE A . n A 1 416 THR 416 415 415 THR THR A . n A 1 417 LEU 417 416 416 LEU LEU A . n A 1 418 ILE 418 417 417 ILE ILE A . n A 1 419 ARG 419 418 418 ARG ARG A . n A 1 420 VAL 420 419 419 VAL VAL A . n A 1 421 TYR 421 420 420 TYR TYR A . n A 1 422 ARG 422 421 421 ARG ARG A . n A 1 423 GLU 423 422 422 GLU GLU A . n A 1 424 GLN 424 423 423 GLN GLN A . n A 1 425 VAL 425 424 424 VAL VAL A . n A 1 426 GLN 426 425 425 GLN GLN A . n A 1 427 ARG 427 426 426 ARG ARG A . n A 1 428 GLU 428 427 427 GLU GLU A . n A 1 429 VAL 429 428 428 VAL VAL A . n A 1 430 ASN 430 429 429 ASN ASN A . n A 1 431 ALA 431 430 430 ALA ALA A . n A 1 432 ALA 432 431 431 ALA ALA A . n A 1 433 ASP 433 432 432 ASP ASP A . n A 1 434 GLN 434 433 433 GLN GLN A . n A 1 435 VAL 435 434 434 VAL VAL A . n A 1 436 LEU 436 435 435 LEU LEU A . n A 1 437 GLN 437 436 436 GLN GLN A . n A 1 438 SER 438 437 437 SER SER A . n A 1 439 GLN 439 438 438 GLN GLN A . n A 1 440 LEU 440 439 439 LEU LEU A . n A 1 441 LYS 441 440 440 LYS LYS A . n A 1 442 TRP 442 441 441 TRP TRP A . n A 1 443 PRO 443 442 442 PRO PRO A . n A 1 444 VAL 444 443 443 VAL VAL A . n A 1 445 GLU 445 444 444 GLU GLU A . n A 1 446 PHE 446 445 445 PHE PHE A . n A 1 447 ILE 447 446 446 ILE ILE A . n A 1 448 TYR 448 447 447 TYR TYR A . n A 1 449 LEU 449 448 448 LEU LEU A . n A 1 450 GLY 450 449 449 GLY GLY A . n A 1 451 LEU 451 450 450 LEU LEU A . n A 1 452 ARG 452 451 451 ARG ARG A . n A 1 453 PRO 453 452 452 PRO PRO A . n A 1 454 ALA 454 453 453 ALA ALA A . n A 1 455 ASN 455 454 454 ASN ASN A . n A 1 456 ASN 456 455 455 ASN ASN A . n A 1 457 ILE 457 456 456 ILE ILE A . n A 1 458 ALA 458 457 457 ALA ALA A . n A 1 459 ALA 459 458 458 ALA ALA A . n A 1 460 GLY 460 459 459 GLY GLY A . n A 1 461 ASN 461 460 460 ASN ASN A . n A 1 462 THR 462 461 461 THR THR A . n A 1 463 TYR 463 462 462 TYR TYR A . n A 1 464 GLN 464 463 463 GLN GLN A . n A 1 465 TRP 465 464 464 TRP TRP A . n A 1 466 ARG 466 465 465 ARG ARG A . n A 1 467 ASP 467 466 466 ASP ASP A . n A 1 468 TRP 468 467 467 TRP TRP A . n A 1 469 HIS 469 468 468 HIS HIS A . n A 1 470 HIS 470 469 469 HIS HIS A . n A 1 471 LEU 471 470 470 LEU LEU A . n A 1 472 THR 472 471 471 THR THR A . n A 1 473 SER 473 472 472 SER SER A . n A 1 474 VAL 474 473 473 VAL VAL A . n A 1 475 THR 475 474 474 THR THR A . n A 1 476 ASN 476 475 475 ASN ASN A . n A 1 477 GLU 477 476 476 GLU GLU A . n A 1 478 PRO 478 477 477 PRO PRO A . n A 1 479 VAL 479 478 478 VAL VAL A . n A 1 480 TYR 480 479 479 TYR TYR A . n A 1 481 ASP 481 480 480 ASP ASP A . n A 1 482 VAL 482 481 481 VAL VAL A . n A 1 483 SER 483 482 482 SER SER A . n A 1 484 GLN 484 483 483 GLN GLN A . n A 1 485 SER 485 484 484 SER SER A . n A 1 486 TYR 486 485 485 TYR TYR A . n A 1 487 ALA 487 486 486 ALA ALA A . n A 1 488 ARG 488 487 487 ARG ARG A . n A 1 489 VAL 489 488 488 VAL VAL A . n A 1 490 SER 490 489 489 SER SER A . n A 1 491 ILE 491 490 490 ILE ILE A . n A 1 492 ASP 492 491 491 ASP ASP A . n A 1 493 ASP 493 492 492 ASP ASP A . n A 1 494 THR 494 493 493 THR THR A . n A 1 495 VAL 495 494 494 VAL VAL A . n A 1 496 ALA 496 495 495 ALA ALA A . n A 1 497 PRO 497 496 496 PRO PRO A . n A 1 498 VAL 498 497 497 VAL VAL A . n A 1 499 GLY 499 498 498 GLY GLY A . n A 1 500 SER 500 499 499 SER SER A . n A 1 501 THR 501 500 500 THR THR A . n A 1 502 THR 502 501 501 THR THR A . n A 1 503 PHE 503 502 502 PHE PHE A . n A 1 504 LYS 504 503 503 LYS LYS A . n A 1 505 GLN 505 504 504 GLN GLN A . n A 1 506 SER 506 505 505 SER SER A . n A 1 507 ALA 507 506 506 ALA ALA A . n A 1 508 SER 508 507 507 SER SER A . n A 1 509 GLN 509 508 508 GLN GLN A . n A 1 510 VAL 510 509 509 VAL VAL A . n A 1 511 MET 511 510 510 MET MET A . n A 1 512 GLN 512 511 511 GLN GLN A . n A 1 513 ASN 513 512 512 ASN ASN A . n A 1 514 GLN 514 513 513 GLN GLN A . n A 1 515 TYR 515 514 514 TYR TYR A . n A 1 516 ILE 516 515 515 ILE ILE A . n A 1 517 VAL 517 516 516 VAL VAL A . n A 1 518 PRO 518 517 517 PRO PRO A . n A 1 519 VAL 519 518 518 VAL VAL A . n A 1 520 GLU 520 519 519 GLU GLU A . n A 1 521 THR 521 520 520 THR THR A . n A 1 522 GLU 522 521 521 GLU GLU A . n A 1 523 THR 523 522 522 THR THR A . n A 1 524 LEU 524 523 523 LEU LEU A . n A 1 525 ASP 525 524 524 ASP ASP A . n A 1 526 THR 526 525 525 THR THR A . n A 1 527 VAL 527 526 526 VAL VAL A . n A 1 528 ARG 528 527 527 ARG ARG A . n A 1 529 VAL 529 528 528 VAL VAL A . n A 1 530 LYS 530 529 529 LYS LYS A . n A 1 531 ALA 531 530 530 ALA ALA A . n A 1 532 HIS 532 531 531 HIS HIS A . n A 1 533 GLY 533 532 532 GLY GLY A . n A 1 534 ILE 534 533 533 ILE ILE A . n A 1 535 GLU 535 534 534 GLU GLU A . n A 1 536 LEU 536 535 535 LEU LEU A . n A 1 537 TYR 537 536 536 TYR TYR A . n A 1 538 ALA 538 537 537 ALA ALA A . n A 1 539 GLN 539 538 538 GLN GLN A . n A 1 540 TYR 540 539 539 TYR TYR A . n A 1 541 ARG 541 540 540 ARG ARG A . n A 1 542 ALA 542 541 541 ALA ALA A . n A 1 543 GLN 543 542 542 GLN GLN A . n A 1 544 PHE 544 543 543 PHE PHE A . n A 1 545 TYR 545 544 544 TYR TYR A . n A 1 546 ARG 546 545 545 ARG ARG A . n A 1 547 ASP 547 546 546 ASP ASP A . n A 1 548 TYR 548 547 547 TYR TYR A . n A 1 549 ILE 549 548 548 ILE ILE A . n A 1 550 PRO 550 549 549 PRO PRO A . n A 1 551 TRP 551 550 550 TRP TRP A . n A 1 552 ASN 552 551 551 ASN ASN A . n A 1 553 TYR 553 552 552 TYR TYR A . n A 1 554 GLY 554 553 553 GLY GLY A . n A 1 555 SER 555 554 554 SER SER A . n A 1 556 PHE 556 555 555 PHE PHE A . n A 1 557 ASN 557 556 556 ASN ASN A . n A 1 558 LEU 558 557 557 LEU LEU A . n A 1 559 VAL 559 558 558 VAL VAL A . n A 1 560 THR 560 559 559 THR THR A . n A 1 561 PRO 561 560 560 PRO PRO A . n A 1 562 GLN 562 561 561 GLN GLN A . n A 1 563 ASP 563 562 562 ASP ASP A . n A 1 564 LYS 564 563 563 LYS LYS A . n A 1 565 GLY 565 564 564 GLY GLY A . n A 1 566 ALA 566 565 565 ALA ALA A . n A 1 567 LEU 567 566 566 LEU LEU A . n A 1 568 PHE 568 567 567 PHE PHE A . n A 1 569 LEU 569 568 568 LEU LEU A . n A 1 570 ASN 570 569 569 ASN ASN A . n A 1 571 PHE 571 570 570 PHE PHE A . n A 1 572 CYS 572 571 571 CYS CYS A . n A 1 573 LEU 573 572 572 LEU LEU A . n A 1 574 TYR 574 573 573 TYR TYR A . n A 1 575 PRO 575 574 574 PRO PRO A . n A 1 576 GLY 576 575 575 GLY GLY A . n A 1 577 THR 577 576 576 THR THR A . n A 1 578 TYR 578 577 577 TYR TYR A . n A 1 579 GLN 579 578 578 GLN GLN A . n A 1 580 PRO 580 579 579 PRO PRO A . n A 1 581 SER 581 580 580 SER SER A . n A 1 582 GLY 582 581 581 GLY GLY A . n A 1 583 HIS 583 582 582 HIS HIS A . n A 1 584 VAL 584 583 583 VAL VAL A . n A 1 585 ASN 585 584 584 ASN ASN A . n A 1 586 ILE 586 585 585 ILE ILE A . n A 1 587 SER 587 586 586 SER SER A . n A 1 588 ARG 588 587 587 ARG ARG A . n A 1 589 ALA 589 588 588 ALA ALA A . n A 1 590 ARG 590 589 589 ARG ARG A . n A 1 591 GLU 591 590 590 GLU GLU A . n A 1 592 PHE 592 591 591 PHE PHE A . n A 1 593 TYR 593 592 592 TYR TYR A . n A 1 594 ILE 594 593 593 ILE ILE A . n A 1 595 GLU 595 594 594 GLU GLU A . n A 1 596 TYR 596 595 595 TYR TYR A . n A 1 597 THR 597 596 596 THR THR A . n A 1 598 SER 598 597 597 SER SER A . n A 1 599 SER 599 598 598 SER SER A . n A 1 600 PHE 600 599 599 PHE PHE A . n A 1 601 CYS 601 600 600 CYS CYS A . n A 1 602 ASP 602 601 601 ASP ASP A . n A 1 603 SER 603 602 602 SER SER A . n A 1 604 SER 604 603 603 SER SER A . n A 1 605 ASN 605 604 604 ASN ASN A . n A 1 606 PRO 606 605 605 PRO PRO A . n A 1 607 CYS 607 606 606 CYS CYS A . n A 1 608 ASP 608 607 607 ASP ASP A . n A 1 609 LEU 609 608 608 LEU LEU A . n A 1 610 ILE 610 609 609 ILE ILE A . n A 1 611 SER 611 610 610 SER SER A . n A 1 612 ILE 612 611 611 ILE ILE A . n A 1 613 ALA 613 612 612 ALA ALA A . n A 1 614 LYS 614 613 613 LYS LYS A . n A 1 615 CYS 615 614 614 CYS CYS A . n A 1 616 ILE 616 615 615 ILE ILE A . n A 1 617 ASN 617 616 616 ASN ASN A . n A 1 618 PHE 618 617 617 PHE PHE A . n A 1 619 LEU 619 618 618 LEU LEU A . n A 1 620 LEU 620 619 619 LEU LEU A . n A 1 621 ILE 621 620 620 ILE ILE A . n A 1 622 SER 622 621 621 SER SER A . n A 1 623 ASP 623 622 ? ? ? A . n A 1 624 GLY 624 623 ? ? ? A . n A 1 625 SER 625 624 ? ? ? A . n A 1 626 ALA 626 625 ? ? ? A . n A 1 627 VAL 627 626 ? ? ? A . n A 1 628 LEU 628 627 ? ? ? A . n A 1 629 ARG 629 628 ? ? ? A . n A 1 630 TYR 630 629 ? ? ? A . n A 1 631 SER 631 630 ? ? ? A . n A 1 632 THR 632 631 ? ? ? A . n A 1 633 LYS 633 632 ? ? ? A . n A 1 634 GLU 634 633 ? ? ? A . n A 1 635 PHE 635 634 ? ? ? A . n A 1 636 TYR 636 635 ? ? ? A . n A 1 637 LEU 637 636 ? ? ? A . n A 1 638 GLN 638 637 ? ? ? A . n A 1 639 CYS 639 638 ? ? ? A . n A 1 640 LEU 640 639 ? ? ? A . n A 1 641 ILE 641 640 ? ? ? A . n A 1 642 LEU 642 641 ? ? ? A . n A 1 643 ARG 643 642 ? ? ? A . n A 1 644 CYS 644 643 ? ? ? A . n A 1 645 ILE 645 644 ? ? ? A . n B 1 1 GLU 1 0 ? ? ? B . n B 1 2 ALA 2 1 ? ? ? B . n B 1 3 GLY 3 2 ? ? ? B . n B 1 4 GLY 4 3 ? ? ? B . n B 1 5 VAL 5 4 ? ? ? B . n B 1 6 PHE 6 5 ? ? ? B . n B 1 7 LYS 7 6 6 LYS LYS B . n B 1 8 LEU 8 7 7 LEU LEU B . n B 1 9 ILE 9 8 8 ILE ILE B . n B 1 10 ALA 10 9 9 ALA ALA B . n B 1 11 ASN 11 10 10 ASN ASN B . n B 1 12 ASP 12 11 11 ASP ASP B . n B 1 13 GLY 13 12 12 GLY GLY B . n B 1 14 LYS 14 13 13 LYS LYS B . n B 1 15 ALA 15 14 14 ALA ALA B . n B 1 16 ASP 16 15 15 ASP ASP B . n B 1 17 ARG 17 16 16 ARG ARG B . n B 1 18 MET 18 17 17 MET MET B . n B 1 19 ILE 19 18 18 ILE ILE B . n B 1 20 MET 20 19 19 MET MET B . n B 1 21 ALA 21 20 20 ALA ALA B . n B 1 22 ASN 22 21 21 ASN ASN B . n B 1 23 ASP 23 22 22 ASP ASP B . n B 1 24 LEU 24 23 23 LEU LEU B . n B 1 25 LEU 25 24 24 LEU LEU B . n B 1 26 ASN 26 25 25 ASN ASN B . n B 1 27 ASP 27 26 26 ASP ASP B . n B 1 28 ARG 28 27 27 ARG ARG B . n B 1 29 ILE 29 28 28 ILE ILE B . n B 1 30 LYS 30 29 29 LYS LYS B . n B 1 31 SER 31 30 30 SER SER B . n B 1 32 ILE 32 31 31 ILE ILE B . n B 1 33 MET 33 32 32 MET MET B . n B 1 34 CYS 34 33 33 CYS CYS B . n B 1 35 LEU 35 34 34 LEU LEU B . n B 1 36 ARG 36 35 35 ARG ARG B . n B 1 37 ALA 37 36 36 ALA ALA B . n B 1 38 LYS 38 37 37 LYS LYS B . n B 1 39 GLN 39 38 38 GLN GLN B . n B 1 40 GLY 40 39 39 GLY GLY B . n B 1 41 PHE 41 40 40 PHE PHE B . n B 1 42 SER 42 41 41 SER SER B . n B 1 43 ASP 43 42 42 ASP ASP B . n B 1 44 PRO 44 43 43 PRO PRO B . n B 1 45 THR 45 44 44 THR THR B . n B 1 46 PRO 46 45 45 PRO PRO B . n B 1 47 THR 47 46 46 THR THR B . n B 1 48 LEU 48 47 47 LEU LEU B . n B 1 49 VAL 49 48 48 VAL VAL B . n B 1 50 ASP 50 49 49 ASP ASP B . n B 1 51 ILE 51 50 50 ILE ILE B . n B 1 52 GLU 52 51 51 GLU GLU B . n B 1 53 ARG 53 52 52 ARG ARG B . n B 1 54 THR 54 53 53 THR THR B . n B 1 55 HIS 55 54 54 HIS HIS B . n B 1 56 ILE 56 55 55 ILE ILE B . n B 1 57 LEU 57 56 56 LEU LEU B . n B 1 58 LEU 58 57 57 LEU LEU B . n B 1 59 ILE 59 58 58 ILE ILE B . n B 1 60 ASN 60 59 59 ASN ASN B . n B 1 61 SER 61 60 60 SER SER B . n B 1 62 HIS 62 61 61 HIS HIS B . n B 1 63 TYR 63 62 62 TYR TYR B . n B 1 64 LYS 64 63 63 LYS LYS B . n B 1 65 PRO 65 64 64 PRO PRO B . n B 1 66 PHE 66 65 65 PHE PHE B . n B 1 67 ALA 67 66 66 ALA ALA B . n B 1 68 ALA 68 67 67 ALA ALA B . n B 1 69 MET 69 68 68 MET MET B . n B 1 70 GLY 70 69 69 GLY GLY B . n B 1 71 TYR 71 70 70 TYR TYR B . n B 1 72 GLU 72 71 71 GLU GLU B . n B 1 73 TYR 73 72 72 TYR TYR B . n B 1 74 GLN 74 73 73 GLN GLN B . n B 1 75 LYS 75 74 74 LYS LYS B . n B 1 76 THR 76 75 75 THR THR B . n B 1 77 ARG 77 76 76 ARG ARG B . n B 1 78 PRO 78 77 77 PRO PRO B . n B 1 79 ASN 79 78 78 ASN ASN B . n B 1 80 THR 80 79 79 THR THR B . n B 1 81 GLY 81 80 80 GLY GLY B . n B 1 82 ASN 82 81 81 ASN ASN B . n B 1 83 PRO 83 82 82 PRO PRO B . n B 1 84 THR 84 83 83 THR THR B . n B 1 85 TYR 85 84 84 TYR TYR B . n B 1 86 ASN 86 85 85 ASN ASN B . n B 1 87 SER 87 86 86 SER SER B . n B 1 88 THR 88 87 87 THR THR B . n B 1 89 ILE 89 88 88 ILE ILE B . n B 1 90 GLN 90 89 89 GLN GLN B . n B 1 91 PHE 91 90 90 PHE PHE B . n B 1 92 SER 92 91 91 SER SER B . n B 1 93 ILE 93 92 92 ILE ILE B . n B 1 94 PRO 94 93 93 PRO PRO B . n B 1 95 GLN 95 94 94 GLN GLN B . n B 1 96 PHE 96 95 95 PHE PHE B . n B 1 97 GLY 97 96 96 GLY GLY B . n B 1 98 ASP 98 97 97 ASP ASP B . n B 1 99 PHE 99 98 98 PHE PHE B . n B 1 100 PHE 100 99 99 PHE PHE B . n B 1 101 SER 101 100 100 SER SER B . n B 1 102 ASP 102 101 101 ASP ASP B . n B 1 103 MET 103 102 102 MET MET B . n B 1 104 VAL 104 103 103 VAL VAL B . n B 1 105 VAL 105 104 104 VAL VAL B . n B 1 106 HIS 106 105 105 HIS HIS B . n B 1 107 VAL 107 106 106 VAL VAL B . n B 1 108 GLN 108 107 107 GLN GLN B . n B 1 109 LEU 109 108 108 LEU LEU B . n B 1 110 ALA 110 109 109 ALA ALA B . n B 1 111 ALA 111 110 110 ALA ALA B . n B 1 112 THR 112 111 111 THR THR B . n B 1 113 SER 113 112 112 SER SER B . n B 1 114 ALA 114 113 113 ALA ALA B . n B 1 115 SER 115 114 114 SER SER B . n B 1 116 ALA 116 115 115 ALA ALA B . n B 1 117 GLY 117 116 116 GLY GLY B . n B 1 118 THR 118 117 117 THR THR B . n B 1 119 VAL 119 118 118 VAL VAL B . n B 1 120 PRO 120 119 119 PRO PRO B . n B 1 121 ALA 121 120 120 ALA ALA B . n B 1 122 LEU 122 121 121 LEU LEU B . n B 1 123 PRO 123 122 122 PRO PRO B . n B 1 124 ALA 124 123 123 ALA ALA B . n B 1 125 PHE 125 124 124 PHE PHE B . n B 1 126 ILE 126 125 125 ILE ILE B . n B 1 127 GLY 127 126 126 GLY GLY B . n B 1 128 ALA 128 127 127 ALA ALA B . n B 1 129 ASP 129 128 128 ASP ASP B . n B 1 130 ASP 130 129 129 ASP ASP B . n B 1 131 GLN 131 130 130 GLN GLN B . n B 1 132 VAL 132 131 131 VAL VAL B . n B 1 133 LEU 133 132 132 LEU LEU B . n B 1 134 THR 134 133 133 THR THR B . n B 1 135 SER 135 134 134 SER SER B . n B 1 136 THR 136 135 135 THR THR B . n B 1 137 SER 137 136 136 SER SER B . n B 1 138 VAL 138 137 137 VAL VAL B . n B 1 139 VAL 139 138 138 VAL VAL B . n B 1 140 SER 140 139 139 SER SER B . n B 1 141 ALA 141 140 140 ALA ALA B . n B 1 142 THR 142 141 141 THR THR B . n B 1 143 GLU 143 142 142 GLU GLU B . n B 1 144 ASN 144 143 143 ASN ASN B . n B 1 145 THR 145 144 144 THR THR B . n B 1 146 THR 146 145 145 THR THR B . n B 1 147 SER 147 146 146 SER SER B . n B 1 148 GLY 148 147 147 GLY GLY B . n B 1 149 VAL 149 148 148 VAL VAL B . n B 1 150 TYR 150 149 149 TYR TYR B . n B 1 151 THR 151 150 150 THR THR B . n B 1 152 LEU 152 151 151 LEU LEU B . n B 1 153 TYR 153 152 152 TYR TYR B . n B 1 154 THR 154 153 153 THR THR B . n B 1 155 GLN 155 154 154 GLN GLN B . n B 1 156 SER 156 155 155 SER SER B . n B 1 157 TYR 157 156 156 TYR TYR B . n B 1 158 VAL 158 157 157 VAL VAL B . n B 1 159 ASN 159 158 158 ASN ASN B . n B 1 160 GLN 160 159 159 GLN GLN B . n B 1 161 GLN 161 160 160 GLN GLN B . n B 1 162 GLY 162 161 161 GLY GLY B . n B 1 163 THR 163 162 162 THR THR B . n B 1 164 THR 164 163 163 THR THR B . n B 1 165 GLN 165 164 164 GLN GLN B . n B 1 166 THR 166 165 165 THR THR B . n B 1 167 VAL 167 166 166 VAL VAL B . n B 1 168 ALA 168 167 167 ALA ALA B . n B 1 169 ALA 169 168 168 ALA ALA B . n B 1 170 ALA 170 169 169 ALA ALA B . n B 1 171 ALA 171 170 170 ALA ALA B . n B 1 172 THR 172 171 171 THR THR B . n B 1 173 ASN 173 172 172 ASN ASN B . n B 1 174 PHE 174 173 173 PHE PHE B . n B 1 175 VAL 175 174 174 VAL VAL B . n B 1 176 ARG 176 175 175 ARG ARG B . n B 1 177 TYR 177 176 176 TYR TYR B . n B 1 178 CYS 178 177 177 CYS CYS B . n B 1 179 GLU 179 178 178 GLU GLU B . n B 1 180 TYR 180 179 179 TYR TYR B . n B 1 181 PRO 181 180 180 PRO PRO B . n B 1 182 GLY 182 181 181 GLY GLY B . n B 1 183 LEU 183 182 182 LEU LEU B . n B 1 184 ARG 184 183 183 ARG ARG B . n B 1 185 LEU 185 184 184 LEU LEU B . n B 1 186 PHE 186 185 185 PHE PHE B . n B 1 187 LYS 187 186 186 LYS LYS B . n B 1 188 ARG 188 187 187 ARG ARG B . n B 1 189 VAL 189 188 188 VAL VAL B . n B 1 190 LYS 190 189 189 LYS LYS B . n B 1 191 PHE 191 190 190 PHE PHE B . n B 1 192 GLU 192 191 191 GLU GLU B . n B 1 193 VAL 193 192 192 VAL VAL B . n B 1 194 ASN 194 193 193 ASN ASN B . n B 1 195 GLY 195 194 194 GLY GLY B . n B 1 196 ASN 196 195 195 ASN ASN B . n B 1 197 PRO 197 196 196 PRO PRO B . n B 1 198 LEU 198 197 197 LEU LEU B . n B 1 199 ASP 199 198 198 ASP ASP B . n B 1 200 GLU 200 199 199 GLU GLU B . n B 1 201 TYR 201 200 200 TYR TYR B . n B 1 202 THR 202 201 201 THR THR B . n B 1 203 ALA 203 202 202 ALA ALA B . n B 1 204 LEU 204 203 203 LEU LEU B . n B 1 205 ALA 205 204 204 ALA ALA B . n B 1 206 ALA 206 205 205 ALA ALA B . n B 1 207 ILE 207 206 206 ILE ILE B . n B 1 208 MET 208 207 207 MET MET B . n B 1 209 TYR 209 208 208 TYR TYR B . n B 1 210 ASN 210 209 209 ASN ASN B . n B 1 211 LYS 211 210 210 LYS LYS B . n B 1 212 PHE 212 211 211 PHE PHE B . n B 1 213 HIS 213 212 212 HIS HIS B . n B 1 214 VAL 214 213 213 VAL VAL B . n B 1 215 PRO 215 214 214 PRO PRO B . n B 1 216 ASP 216 215 215 ASP ASP B . n B 1 217 PHE 217 216 216 PHE PHE B . n B 1 218 LYS 218 217 217 LYS LYS B . n B 1 219 LEU 219 218 218 LEU LEU B . n B 1 220 THR 220 219 219 THR THR B . n B 1 221 GLY 221 220 220 GLY GLY B . n B 1 222 TRP 222 221 221 TRP TRP B . n B 1 223 LYS 223 222 222 LYS LYS B . n B 1 224 ARG 224 223 223 ARG ARG B . n B 1 225 LEU 225 224 224 LEU LEU B . n B 1 226 ILE 226 225 225 ILE ILE B . n B 1 227 GLY 227 226 226 GLY GLY B . n B 1 228 GLN 228 227 227 GLN GLN B . n B 1 229 GLU 229 228 228 GLU GLU B . n B 1 230 VAL 230 229 229 VAL VAL B . n B 1 231 PRO 231 230 230 PRO PRO B . n B 1 232 VAL 232 231 231 VAL VAL B . n B 1 233 GLU 233 232 232 GLU GLU B . n B 1 234 ALA 234 233 233 ALA ALA B . n B 1 235 ALA 235 234 234 ALA ALA B . n B 1 236 SER 236 235 235 SER SER B . n B 1 237 ASN 237 236 236 ASN ASN B . n B 1 238 LEU 238 237 237 LEU LEU B . n B 1 239 VAL 239 238 238 VAL VAL B . n B 1 240 ASN 240 239 239 ASN ASN B . n B 1 241 ILE 241 240 240 ILE ILE B . n B 1 242 ALA 242 241 241 ALA ALA B . n B 1 243 SER 243 242 242 SER SER B . n B 1 244 THR 244 243 243 THR THR B . n B 1 245 THR 245 244 244 THR THR B . n B 1 246 PRO 246 245 245 PRO PRO B . n B 1 247 TRP 247 246 246 TRP TRP B . n B 1 248 GLY 248 247 247 GLY GLY B . n B 1 249 SER 249 248 248 SER SER B . n B 1 250 PRO 250 249 249 PRO PRO B . n B 1 251 ILE 251 250 250 ILE ILE B . n B 1 252 VAL 252 251 251 VAL VAL B . n B 1 253 ALA 253 252 252 ALA ALA B . n B 1 254 LEU 254 253 253 LEU LEU B . n B 1 255 SER 255 254 254 SER SER B . n B 1 256 ASP 256 255 255 ASP ASP B . n B 1 257 VAL 257 256 256 VAL VAL B . n B 1 258 ASN 258 257 257 ASN ASN B . n B 1 259 GLY 259 258 258 GLY GLY B . n B 1 260 THR 260 259 259 THR THR B . n B 1 261 ALA 261 260 260 ALA ALA B . n B 1 262 VAL 262 261 261 VAL VAL B . n B 1 263 THR 263 262 262 THR THR B . n B 1 264 GLY 264 263 263 GLY GLY B . n B 1 265 SER 265 264 264 SER SER B . n B 1 266 PRO 266 265 265 PRO PRO B . n B 1 267 VAL 267 266 266 VAL VAL B . n B 1 268 ASN 268 267 267 ASN ASN B . n B 1 269 ALA 269 268 268 ALA ALA B . n B 1 270 ALA 270 269 269 ALA ALA B . n B 1 271 ILE 271 270 270 ILE ILE B . n B 1 272 THR 272 271 271 THR THR B . n B 1 273 ALA 273 272 272 ALA ALA B . n B 1 274 ARG 274 273 273 ARG ARG B . n B 1 275 LYS 275 274 274 LYS LYS B . n B 1 276 LEU 276 275 275 LEU LEU B . n B 1 277 THR 277 276 276 THR THR B . n B 1 278 GLN 278 277 277 GLN GLN B . n B 1 279 VAL 279 278 278 VAL VAL B . n B 1 280 VAL 280 279 279 VAL VAL B . n B 1 281 PHE 281 280 280 PHE PHE B . n B 1 282 GLY 282 281 281 GLY GLY B . n B 1 283 ALA 283 282 282 ALA ALA B . n B 1 284 GLN 284 283 283 GLN GLN B . n B 1 285 THR 285 284 284 THR THR B . n B 1 286 PRO 286 285 285 PRO PRO B . n B 1 287 LYS 287 286 286 LYS LYS B . n B 1 288 ALA 288 287 287 ALA ALA B . n B 1 289 THR 289 288 288 THR THR B . n B 1 290 GLN 290 289 289 GLN GLN B . n B 1 291 GLU 291 290 290 GLU GLU B . n B 1 292 GLN 292 291 291 GLN GLN B . n B 1 293 LEU 293 292 292 LEU LEU B . n B 1 294 ASN 294 293 293 ASN ASN B . n B 1 295 MET 295 294 294 MET MET B . n B 1 296 PHE 296 295 295 PHE PHE B . n B 1 297 VAL 297 296 296 VAL VAL B . n B 1 298 PRO 298 297 297 PRO PRO B . n B 1 299 LEU 299 298 298 LEU LEU B . n B 1 300 LEU 300 299 299 LEU LEU B . n B 1 301 PHE 301 300 300 PHE PHE B . n B 1 302 TRP 302 301 301 TRP TRP B . n B 1 303 PHE 303 302 302 PHE PHE B . n B 1 304 ARG 304 303 303 ARG ARG B . n B 1 305 ASP 305 304 304 ASP ASP B . n B 1 306 PRO 306 305 305 PRO PRO B . n B 1 307 ARG 307 306 306 ARG ARG B . n B 1 308 LEU 308 307 307 LEU LEU B . n B 1 309 ALA 309 308 308 ALA ALA B . n B 1 310 ILE 310 309 309 ILE ILE B . n B 1 311 ALA 311 310 310 ALA ALA B . n B 1 312 SER 312 311 311 SER SER B . n B 1 313 VAL 313 312 312 VAL VAL B . n B 1 314 SER 314 313 313 SER SER B . n B 1 315 ILE 315 314 314 ILE ILE B . n B 1 316 PRO 316 315 315 PRO PRO B . n B 1 317 TYR 317 316 316 TYR TYR B . n B 1 318 GLY 318 317 317 GLY GLY B . n B 1 319 GLN 319 318 318 GLN GLN B . n B 1 320 ARG 320 319 319 ARG ARG B . n B 1 321 PHE 321 320 320 PHE PHE B . n B 1 322 ILE 322 321 321 ILE ILE B . n B 1 323 THR 323 322 322 THR THR B . n B 1 324 VAL 324 323 323 VAL VAL B . n B 1 325 ASP 325 324 324 ASP ASP B . n B 1 326 ILE 326 325 325 ILE ILE B . n B 1 327 GLU 327 326 326 GLU GLU B . n B 1 328 GLN 328 327 327 GLN GLN B . n B 1 329 GLN 329 328 328 GLN GLN B . n B 1 330 SER 330 329 329 SER SER B . n B 1 331 ASN 331 330 330 ASN ASN B . n B 1 332 ILE 332 331 331 ILE ILE B . n B 1 333 LEU 333 332 332 LEU LEU B . n B 1 334 PHE 334 333 333 PHE PHE B . n B 1 335 THR 335 334 334 THR THR B . n B 1 336 ALA 336 335 335 ALA ALA B . n B 1 337 PRO 337 336 336 PRO PRO B . n B 1 338 GLY 338 337 337 GLY GLY B . n B 1 339 ASN 339 338 338 ASN ASN B . n B 1 340 LEU 340 339 339 LEU LEU B . n B 1 341 PHE 341 340 340 PHE PHE B . n B 1 342 LEU 342 341 341 LEU LEU B . n B 1 343 GLN 343 342 342 GLN GLN B . n B 1 344 THR 344 343 343 THR THR B . n B 1 345 THR 345 344 344 THR THR B . n B 1 346 VAL 346 345 345 VAL VAL B . n B 1 347 GLU 347 346 346 GLU GLU B . n B 1 348 THR 348 347 347 THR THR B . n B 1 349 LEU 349 348 348 LEU LEU B . n B 1 350 LEU 350 349 349 LEU LEU B . n B 1 351 THR 351 350 350 THR THR B . n B 1 352 THR 352 351 351 THR THR B . n B 1 353 GLY 353 352 352 GLY GLY B . n B 1 354 ALA 354 353 353 ALA ALA B . n B 1 355 GLY 355 354 354 GLY GLY B . n B 1 356 LYS 356 355 355 LYS LYS B . n B 1 357 GLY 357 356 356 GLY GLY B . n B 1 358 THR 358 357 357 THR THR B . n B 1 359 ALA 359 358 358 ALA ALA B . n B 1 360 THR 360 359 359 THR THR B . n B 1 361 GLY 361 360 360 GLY GLY B . n B 1 362 VAL 362 361 361 VAL VAL B . n B 1 363 LEU 363 362 362 LEU LEU B . n B 1 364 LEU 364 363 363 LEU LEU B . n B 1 365 THR 365 364 364 THR THR B . n B 1 366 GLN 366 365 365 GLN GLN B . n B 1 367 TYR 367 366 366 TYR TYR B . n B 1 368 ASN 368 367 367 ASN ASN B . n B 1 369 ARG 369 368 368 ARG ARG B . n B 1 370 TYR 370 369 369 TYR TYR B . n B 1 371 THR 371 370 370 THR THR B . n B 1 372 THR 372 371 371 THR THR B . n B 1 373 TYR 373 372 372 TYR TYR B . n B 1 374 THR 374 373 373 THR THR B . n B 1 375 PRO 375 374 374 PRO PRO B . n B 1 376 THR 376 375 375 THR THR B . n B 1 377 LEU 377 376 376 LEU LEU B . n B 1 378 ALA 378 377 377 ALA ALA B . n B 1 379 SER 379 378 378 SER SER B . n B 1 380 GLY 380 379 379 GLY GLY B . n B 1 381 SER 381 380 380 SER SER B . n B 1 382 SER 382 381 381 SER SER B . n B 1 383 ILE 383 382 382 ILE ILE B . n B 1 384 ASP 384 383 383 ASP ASP B . n B 1 385 GLY 385 384 384 GLY GLY B . n B 1 386 THR 386 385 385 THR THR B . n B 1 387 GLN 387 386 386 GLN GLN B . n B 1 388 ALA 388 387 387 ALA ALA B . n B 1 389 VAL 389 388 388 VAL VAL B . n B 1 390 GLN 390 389 389 GLN GLN B . n B 1 391 ASN 391 390 390 ASN ASN B . n B 1 392 ILE 392 391 391 ILE ILE B . n B 1 393 GLU 393 392 392 GLU GLU B . n B 1 394 LEU 394 393 393 LEU LEU B . n B 1 395 TYR 395 394 394 TYR TYR B . n B 1 396 ILE 396 395 395 ILE ILE B . n B 1 397 ASN 397 396 396 ASN ASN B . n B 1 398 ASN 398 397 397 ASN ASN B . n B 1 399 ILE 399 398 398 ILE ILE B . n B 1 400 PHE 400 399 399 PHE PHE B . n B 1 401 VAL 401 400 400 VAL VAL B . n B 1 402 THR 402 401 401 THR THR B . n B 1 403 PRO 403 402 402 PRO PRO B . n B 1 404 GLU 404 403 403 GLU GLU B . n B 1 405 ILE 405 404 404 ILE ILE B . n B 1 406 HIS 406 405 405 HIS HIS B . n B 1 407 ASP 407 406 406 ASP ASP B . n B 1 408 ILE 408 407 407 ILE ILE B . n B 1 409 TYR 409 408 408 TYR TYR B . n B 1 410 ILE 410 409 409 ILE ILE B . n B 1 411 LYS 411 410 410 LYS LYS B . n B 1 412 ARG 412 411 411 ARG ARG B . n B 1 413 ILE 413 412 412 ILE ILE B . n B 1 414 GLY 414 413 413 GLY GLY B . n B 1 415 PHE 415 414 414 PHE PHE B . n B 1 416 THR 416 415 415 THR THR B . n B 1 417 LEU 417 416 416 LEU LEU B . n B 1 418 ILE 418 417 417 ILE ILE B . n B 1 419 ARG 419 418 418 ARG ARG B . n B 1 420 VAL 420 419 419 VAL VAL B . n B 1 421 TYR 421 420 420 TYR TYR B . n B 1 422 ARG 422 421 421 ARG ARG B . n B 1 423 GLU 423 422 422 GLU GLU B . n B 1 424 GLN 424 423 423 GLN GLN B . n B 1 425 VAL 425 424 424 VAL VAL B . n B 1 426 GLN 426 425 425 GLN GLN B . n B 1 427 ARG 427 426 426 ARG ARG B . n B 1 428 GLU 428 427 427 GLU GLU B . n B 1 429 VAL 429 428 428 VAL VAL B . n B 1 430 ASN 430 429 429 ASN ASN B . n B 1 431 ALA 431 430 430 ALA ALA B . n B 1 432 ALA 432 431 431 ALA ALA B . n B 1 433 ASP 433 432 432 ASP ASP B . n B 1 434 GLN 434 433 433 GLN GLN B . n B 1 435 VAL 435 434 434 VAL VAL B . n B 1 436 LEU 436 435 435 LEU LEU B . n B 1 437 GLN 437 436 436 GLN GLN B . n B 1 438 SER 438 437 437 SER SER B . n B 1 439 GLN 439 438 438 GLN GLN B . n B 1 440 LEU 440 439 439 LEU LEU B . n B 1 441 LYS 441 440 440 LYS LYS B . n B 1 442 TRP 442 441 441 TRP TRP B . n B 1 443 PRO 443 442 442 PRO PRO B . n B 1 444 VAL 444 443 443 VAL VAL B . n B 1 445 GLU 445 444 444 GLU GLU B . n B 1 446 PHE 446 445 445 PHE PHE B . n B 1 447 ILE 447 446 446 ILE ILE B . n B 1 448 TYR 448 447 447 TYR TYR B . n B 1 449 LEU 449 448 448 LEU LEU B . n B 1 450 GLY 450 449 449 GLY GLY B . n B 1 451 LEU 451 450 450 LEU LEU B . n B 1 452 ARG 452 451 451 ARG ARG B . n B 1 453 PRO 453 452 452 PRO PRO B . n B 1 454 ALA 454 453 453 ALA ALA B . n B 1 455 ASN 455 454 454 ASN ASN B . n B 1 456 ASN 456 455 455 ASN ASN B . n B 1 457 ILE 457 456 456 ILE ILE B . n B 1 458 ALA 458 457 457 ALA ALA B . n B 1 459 ALA 459 458 458 ALA ALA B . n B 1 460 GLY 460 459 459 GLY GLY B . n B 1 461 ASN 461 460 460 ASN ASN B . n B 1 462 THR 462 461 461 THR THR B . n B 1 463 TYR 463 462 462 TYR TYR B . n B 1 464 GLN 464 463 463 GLN GLN B . n B 1 465 TRP 465 464 464 TRP TRP B . n B 1 466 ARG 466 465 465 ARG ARG B . n B 1 467 ASP 467 466 466 ASP ASP B . n B 1 468 TRP 468 467 467 TRP TRP B . n B 1 469 HIS 469 468 468 HIS HIS B . n B 1 470 HIS 470 469 469 HIS HIS B . n B 1 471 LEU 471 470 470 LEU LEU B . n B 1 472 THR 472 471 471 THR THR B . n B 1 473 SER 473 472 472 SER SER B . n B 1 474 VAL 474 473 473 VAL VAL B . n B 1 475 THR 475 474 474 THR THR B . n B 1 476 ASN 476 475 475 ASN ASN B . n B 1 477 GLU 477 476 476 GLU GLU B . n B 1 478 PRO 478 477 477 PRO PRO B . n B 1 479 VAL 479 478 478 VAL VAL B . n B 1 480 TYR 480 479 479 TYR TYR B . n B 1 481 ASP 481 480 480 ASP ASP B . n B 1 482 VAL 482 481 481 VAL VAL B . n B 1 483 SER 483 482 482 SER SER B . n B 1 484 GLN 484 483 483 GLN GLN B . n B 1 485 SER 485 484 484 SER SER B . n B 1 486 TYR 486 485 485 TYR TYR B . n B 1 487 ALA 487 486 486 ALA ALA B . n B 1 488 ARG 488 487 487 ARG ARG B . n B 1 489 VAL 489 488 488 VAL VAL B . n B 1 490 SER 490 489 489 SER SER B . n B 1 491 ILE 491 490 490 ILE ILE B . n B 1 492 ASP 492 491 491 ASP ASP B . n B 1 493 ASP 493 492 492 ASP ASP B . n B 1 494 THR 494 493 493 THR THR B . n B 1 495 VAL 495 494 494 VAL VAL B . n B 1 496 ALA 496 495 495 ALA ALA B . n B 1 497 PRO 497 496 496 PRO PRO B . n B 1 498 VAL 498 497 497 VAL VAL B . n B 1 499 GLY 499 498 498 GLY GLY B . n B 1 500 SER 500 499 499 SER SER B . n B 1 501 THR 501 500 500 THR THR B . n B 1 502 THR 502 501 501 THR THR B . n B 1 503 PHE 503 502 502 PHE PHE B . n B 1 504 LYS 504 503 503 LYS LYS B . n B 1 505 GLN 505 504 504 GLN GLN B . n B 1 506 SER 506 505 505 SER SER B . n B 1 507 ALA 507 506 506 ALA ALA B . n B 1 508 SER 508 507 507 SER SER B . n B 1 509 GLN 509 508 508 GLN GLN B . n B 1 510 VAL 510 509 509 VAL VAL B . n B 1 511 MET 511 510 510 MET MET B . n B 1 512 GLN 512 511 511 GLN GLN B . n B 1 513 ASN 513 512 512 ASN ASN B . n B 1 514 GLN 514 513 513 GLN GLN B . n B 1 515 TYR 515 514 514 TYR TYR B . n B 1 516 ILE 516 515 515 ILE ILE B . n B 1 517 VAL 517 516 516 VAL VAL B . n B 1 518 PRO 518 517 517 PRO PRO B . n B 1 519 VAL 519 518 518 VAL VAL B . n B 1 520 GLU 520 519 519 GLU GLU B . n B 1 521 THR 521 520 520 THR THR B . n B 1 522 GLU 522 521 521 GLU GLU B . n B 1 523 THR 523 522 522 THR THR B . n B 1 524 LEU 524 523 523 LEU LEU B . n B 1 525 ASP 525 524 524 ASP ASP B . n B 1 526 THR 526 525 525 THR THR B . n B 1 527 VAL 527 526 526 VAL VAL B . n B 1 528 ARG 528 527 527 ARG ARG B . n B 1 529 VAL 529 528 528 VAL VAL B . n B 1 530 LYS 530 529 529 LYS LYS B . n B 1 531 ALA 531 530 530 ALA ALA B . n B 1 532 HIS 532 531 531 HIS HIS B . n B 1 533 GLY 533 532 532 GLY GLY B . n B 1 534 ILE 534 533 533 ILE ILE B . n B 1 535 GLU 535 534 534 GLU GLU B . n B 1 536 LEU 536 535 535 LEU LEU B . n B 1 537 TYR 537 536 536 TYR TYR B . n B 1 538 ALA 538 537 537 ALA ALA B . n B 1 539 GLN 539 538 538 GLN GLN B . n B 1 540 TYR 540 539 539 TYR TYR B . n B 1 541 ARG 541 540 540 ARG ARG B . n B 1 542 ALA 542 541 541 ALA ALA B . n B 1 543 GLN 543 542 542 GLN GLN B . n B 1 544 PHE 544 543 543 PHE PHE B . n B 1 545 TYR 545 544 544 TYR TYR B . n B 1 546 ARG 546 545 545 ARG ARG B . n B 1 547 ASP 547 546 546 ASP ASP B . n B 1 548 TYR 548 547 547 TYR TYR B . n B 1 549 ILE 549 548 548 ILE ILE B . n B 1 550 PRO 550 549 549 PRO PRO B . n B 1 551 TRP 551 550 550 TRP TRP B . n B 1 552 ASN 552 551 551 ASN ASN B . n B 1 553 TYR 553 552 552 TYR TYR B . n B 1 554 GLY 554 553 553 GLY GLY B . n B 1 555 SER 555 554 554 SER SER B . n B 1 556 PHE 556 555 555 PHE PHE B . n B 1 557 ASN 557 556 556 ASN ASN B . n B 1 558 LEU 558 557 557 LEU LEU B . n B 1 559 VAL 559 558 558 VAL VAL B . n B 1 560 THR 560 559 559 THR THR B . n B 1 561 PRO 561 560 560 PRO PRO B . n B 1 562 GLN 562 561 561 GLN GLN B . n B 1 563 ASP 563 562 562 ASP ASP B . n B 1 564 LYS 564 563 563 LYS LYS B . n B 1 565 GLY 565 564 564 GLY GLY B . n B 1 566 ALA 566 565 565 ALA ALA B . n B 1 567 LEU 567 566 566 LEU LEU B . n B 1 568 PHE 568 567 567 PHE PHE B . n B 1 569 LEU 569 568 568 LEU LEU B . n B 1 570 ASN 570 569 569 ASN ASN B . n B 1 571 PHE 571 570 570 PHE PHE B . n B 1 572 CYS 572 571 571 CYS CYS B . n B 1 573 LEU 573 572 572 LEU LEU B . n B 1 574 TYR 574 573 573 TYR TYR B . n B 1 575 PRO 575 574 574 PRO PRO B . n B 1 576 GLY 576 575 575 GLY GLY B . n B 1 577 THR 577 576 576 THR THR B . n B 1 578 TYR 578 577 577 TYR TYR B . n B 1 579 GLN 579 578 578 GLN GLN B . n B 1 580 PRO 580 579 579 PRO PRO B . n B 1 581 SER 581 580 580 SER SER B . n B 1 582 GLY 582 581 581 GLY GLY B . n B 1 583 HIS 583 582 582 HIS HIS B . n B 1 584 VAL 584 583 583 VAL VAL B . n B 1 585 ASN 585 584 584 ASN ASN B . n B 1 586 ILE 586 585 585 ILE ILE B . n B 1 587 SER 587 586 586 SER SER B . n B 1 588 ARG 588 587 587 ARG ARG B . n B 1 589 ALA 589 588 588 ALA ALA B . n B 1 590 ARG 590 589 589 ARG ARG B . n B 1 591 GLU 591 590 590 GLU GLU B . n B 1 592 PHE 592 591 591 PHE PHE B . n B 1 593 TYR 593 592 592 TYR TYR B . n B 1 594 ILE 594 593 593 ILE ILE B . n B 1 595 GLU 595 594 594 GLU GLU B . n B 1 596 TYR 596 595 595 TYR TYR B . n B 1 597 THR 597 596 596 THR THR B . n B 1 598 SER 598 597 597 SER SER B . n B 1 599 SER 599 598 598 SER SER B . n B 1 600 PHE 600 599 599 PHE PHE B . n B 1 601 CYS 601 600 600 CYS CYS B . n B 1 602 ASP 602 601 601 ASP ASP B . n B 1 603 SER 603 602 602 SER SER B . n B 1 604 SER 604 603 603 SER SER B . n B 1 605 ASN 605 604 604 ASN ASN B . n B 1 606 PRO 606 605 605 PRO PRO B . n B 1 607 CYS 607 606 606 CYS CYS B . n B 1 608 ASP 608 607 607 ASP ASP B . n B 1 609 LEU 609 608 608 LEU LEU B . n B 1 610 ILE 610 609 609 ILE ILE B . n B 1 611 SER 611 610 610 SER SER B . n B 1 612 ILE 612 611 611 ILE ILE B . n B 1 613 ALA 613 612 612 ALA ALA B . n B 1 614 LYS 614 613 613 LYS LYS B . n B 1 615 CYS 615 614 614 CYS CYS B . n B 1 616 ILE 616 615 615 ILE ILE B . n B 1 617 ASN 617 616 616 ASN ASN B . n B 1 618 PHE 618 617 617 PHE PHE B . n B 1 619 LEU 619 618 618 LEU LEU B . n B 1 620 LEU 620 619 619 LEU LEU B . n B 1 621 ILE 621 620 620 ILE ILE B . n B 1 622 SER 622 621 621 SER SER B . n B 1 623 ASP 623 622 ? ? ? B . n B 1 624 GLY 624 623 ? ? ? B . n B 1 625 SER 625 624 ? ? ? B . n B 1 626 ALA 626 625 ? ? ? B . n B 1 627 VAL 627 626 ? ? ? B . n B 1 628 LEU 628 627 ? ? ? B . n B 1 629 ARG 629 628 ? ? ? B . n B 1 630 TYR 630 629 ? ? ? B . n B 1 631 SER 631 630 ? ? ? B . n B 1 632 THR 632 631 ? ? ? B . n B 1 633 LYS 633 632 ? ? ? B . n B 1 634 GLU 634 633 ? ? ? B . n B 1 635 PHE 635 634 ? ? ? B . n B 1 636 TYR 636 635 ? ? ? B . n B 1 637 LEU 637 636 ? ? ? B . n B 1 638 GLN 638 637 ? ? ? B . n B 1 639 CYS 639 638 ? ? ? B . n B 1 640 LEU 640 639 ? ? ? B . n B 1 641 ILE 641 640 ? ? ? B . n B 1 642 LEU 642 641 ? ? ? B . n B 1 643 ARG 643 642 ? ? ? B . n B 1 644 CYS 644 643 ? ? ? B . n B 1 645 ILE 645 644 ? ? ? B . n C 1 1 GLU 1 0 ? ? ? C . n C 1 2 ALA 2 1 ? ? ? C . n C 1 3 GLY 3 2 ? ? ? C . n C 1 4 GLY 4 3 ? ? ? C . n C 1 5 VAL 5 4 ? ? ? C . n C 1 6 PHE 6 5 5 PHE PHE C . n C 1 7 LYS 7 6 6 LYS LYS C . n C 1 8 LEU 8 7 7 LEU LEU C . n C 1 9 ILE 9 8 8 ILE ILE C . n C 1 10 ALA 10 9 9 ALA ALA C . n C 1 11 ASN 11 10 10 ASN ASN C . n C 1 12 ASP 12 11 11 ASP ASP C . n C 1 13 GLY 13 12 12 GLY GLY C . n C 1 14 LYS 14 13 13 LYS LYS C . n C 1 15 ALA 15 14 14 ALA ALA C . n C 1 16 ASP 16 15 15 ASP ASP C . n C 1 17 ARG 17 16 16 ARG ARG C . n C 1 18 MET 18 17 17 MET MET C . n C 1 19 ILE 19 18 18 ILE ILE C . n C 1 20 MET 20 19 19 MET MET C . n C 1 21 ALA 21 20 20 ALA ALA C . n C 1 22 ASN 22 21 21 ASN ASN C . n C 1 23 ASP 23 22 22 ASP ASP C . n C 1 24 LEU 24 23 23 LEU LEU C . n C 1 25 LEU 25 24 24 LEU LEU C . n C 1 26 ASN 26 25 25 ASN ASN C . n C 1 27 ASP 27 26 26 ASP ASP C . n C 1 28 ARG 28 27 27 ARG ARG C . n C 1 29 ILE 29 28 28 ILE ILE C . n C 1 30 LYS 30 29 29 LYS LYS C . n C 1 31 SER 31 30 30 SER SER C . n C 1 32 ILE 32 31 31 ILE ILE C . n C 1 33 MET 33 32 32 MET MET C . n C 1 34 CYS 34 33 33 CYS CYS C . n C 1 35 LEU 35 34 34 LEU LEU C . n C 1 36 ARG 36 35 35 ARG ARG C . n C 1 37 ALA 37 36 36 ALA ALA C . n C 1 38 LYS 38 37 37 LYS LYS C . n C 1 39 GLN 39 38 38 GLN GLN C . n C 1 40 GLY 40 39 39 GLY GLY C . n C 1 41 PHE 41 40 40 PHE PHE C . n C 1 42 SER 42 41 41 SER SER C . n C 1 43 ASP 43 42 42 ASP ASP C . n C 1 44 PRO 44 43 43 PRO PRO C . n C 1 45 THR 45 44 44 THR THR C . n C 1 46 PRO 46 45 45 PRO PRO C . n C 1 47 THR 47 46 46 THR THR C . n C 1 48 LEU 48 47 47 LEU LEU C . n C 1 49 VAL 49 48 48 VAL VAL C . n C 1 50 ASP 50 49 49 ASP ASP C . n C 1 51 ILE 51 50 50 ILE ILE C . n C 1 52 GLU 52 51 51 GLU GLU C . n C 1 53 ARG 53 52 52 ARG ARG C . n C 1 54 THR 54 53 53 THR THR C . n C 1 55 HIS 55 54 54 HIS HIS C . n C 1 56 ILE 56 55 55 ILE ILE C . n C 1 57 LEU 57 56 56 LEU LEU C . n C 1 58 LEU 58 57 57 LEU LEU C . n C 1 59 ILE 59 58 58 ILE ILE C . n C 1 60 ASN 60 59 59 ASN ASN C . n C 1 61 SER 61 60 60 SER SER C . n C 1 62 HIS 62 61 61 HIS HIS C . n C 1 63 TYR 63 62 62 TYR TYR C . n C 1 64 LYS 64 63 63 LYS LYS C . n C 1 65 PRO 65 64 64 PRO PRO C . n C 1 66 PHE 66 65 65 PHE PHE C . n C 1 67 ALA 67 66 66 ALA ALA C . n C 1 68 ALA 68 67 67 ALA ALA C . n C 1 69 MET 69 68 68 MET MET C . n C 1 70 GLY 70 69 69 GLY GLY C . n C 1 71 TYR 71 70 70 TYR TYR C . n C 1 72 GLU 72 71 71 GLU GLU C . n C 1 73 TYR 73 72 72 TYR TYR C . n C 1 74 GLN 74 73 73 GLN GLN C . n C 1 75 LYS 75 74 74 LYS LYS C . n C 1 76 THR 76 75 75 THR THR C . n C 1 77 ARG 77 76 76 ARG ARG C . n C 1 78 PRO 78 77 77 PRO PRO C . n C 1 79 ASN 79 78 78 ASN ASN C . n C 1 80 THR 80 79 79 THR THR C . n C 1 81 GLY 81 80 80 GLY GLY C . n C 1 82 ASN 82 81 81 ASN ASN C . n C 1 83 PRO 83 82 82 PRO PRO C . n C 1 84 THR 84 83 83 THR THR C . n C 1 85 TYR 85 84 84 TYR TYR C . n C 1 86 ASN 86 85 85 ASN ASN C . n C 1 87 SER 87 86 86 SER SER C . n C 1 88 THR 88 87 87 THR THR C . n C 1 89 ILE 89 88 88 ILE ILE C . n C 1 90 GLN 90 89 89 GLN GLN C . n C 1 91 PHE 91 90 90 PHE PHE C . n C 1 92 SER 92 91 91 SER SER C . n C 1 93 ILE 93 92 92 ILE ILE C . n C 1 94 PRO 94 93 93 PRO PRO C . n C 1 95 GLN 95 94 94 GLN GLN C . n C 1 96 PHE 96 95 95 PHE PHE C . n C 1 97 GLY 97 96 96 GLY GLY C . n C 1 98 ASP 98 97 97 ASP ASP C . n C 1 99 PHE 99 98 98 PHE PHE C . n C 1 100 PHE 100 99 99 PHE PHE C . n C 1 101 SER 101 100 100 SER SER C . n C 1 102 ASP 102 101 101 ASP ASP C . n C 1 103 MET 103 102 102 MET MET C . n C 1 104 VAL 104 103 103 VAL VAL C . n C 1 105 VAL 105 104 104 VAL VAL C . n C 1 106 HIS 106 105 105 HIS HIS C . n C 1 107 VAL 107 106 106 VAL VAL C . n C 1 108 GLN 108 107 107 GLN GLN C . n C 1 109 LEU 109 108 108 LEU LEU C . n C 1 110 ALA 110 109 109 ALA ALA C . n C 1 111 ALA 111 110 110 ALA ALA C . n C 1 112 THR 112 111 111 THR THR C . n C 1 113 SER 113 112 112 SER SER C . n C 1 114 ALA 114 113 113 ALA ALA C . n C 1 115 SER 115 114 114 SER SER C . n C 1 116 ALA 116 115 115 ALA ALA C . n C 1 117 GLY 117 116 116 GLY GLY C . n C 1 118 THR 118 117 117 THR THR C . n C 1 119 VAL 119 118 118 VAL VAL C . n C 1 120 PRO 120 119 119 PRO PRO C . n C 1 121 ALA 121 120 120 ALA ALA C . n C 1 122 LEU 122 121 121 LEU LEU C . n C 1 123 PRO 123 122 122 PRO PRO C . n C 1 124 ALA 124 123 123 ALA ALA C . n C 1 125 PHE 125 124 124 PHE PHE C . n C 1 126 ILE 126 125 125 ILE ILE C . n C 1 127 GLY 127 126 126 GLY GLY C . n C 1 128 ALA 128 127 127 ALA ALA C . n C 1 129 ASP 129 128 128 ASP ASP C . n C 1 130 ASP 130 129 129 ASP ASP C . n C 1 131 GLN 131 130 130 GLN GLN C . n C 1 132 VAL 132 131 131 VAL VAL C . n C 1 133 LEU 133 132 132 LEU LEU C . n C 1 134 THR 134 133 133 THR THR C . n C 1 135 SER 135 134 134 SER SER C . n C 1 136 THR 136 135 135 THR THR C . n C 1 137 SER 137 136 136 SER SER C . n C 1 138 VAL 138 137 137 VAL VAL C . n C 1 139 VAL 139 138 138 VAL VAL C . n C 1 140 SER 140 139 139 SER SER C . n C 1 141 ALA 141 140 140 ALA ALA C . n C 1 142 THR 142 141 141 THR THR C . n C 1 143 GLU 143 142 142 GLU GLU C . n C 1 144 ASN 144 143 143 ASN ASN C . n C 1 145 THR 145 144 144 THR THR C . n C 1 146 THR 146 145 145 THR THR C . n C 1 147 SER 147 146 146 SER SER C . n C 1 148 GLY 148 147 147 GLY GLY C . n C 1 149 VAL 149 148 148 VAL VAL C . n C 1 150 TYR 150 149 149 TYR TYR C . n C 1 151 THR 151 150 150 THR THR C . n C 1 152 LEU 152 151 151 LEU LEU C . n C 1 153 TYR 153 152 152 TYR TYR C . n C 1 154 THR 154 153 153 THR THR C . n C 1 155 GLN 155 154 154 GLN GLN C . n C 1 156 SER 156 155 155 SER SER C . n C 1 157 TYR 157 156 156 TYR TYR C . n C 1 158 VAL 158 157 157 VAL VAL C . n C 1 159 ASN 159 158 158 ASN ASN C . n C 1 160 GLN 160 159 159 GLN GLN C . n C 1 161 GLN 161 160 160 GLN GLN C . n C 1 162 GLY 162 161 161 GLY GLY C . n C 1 163 THR 163 162 162 THR THR C . n C 1 164 THR 164 163 163 THR THR C . n C 1 165 GLN 165 164 164 GLN GLN C . n C 1 166 THR 166 165 165 THR THR C . n C 1 167 VAL 167 166 166 VAL VAL C . n C 1 168 ALA 168 167 167 ALA ALA C . n C 1 169 ALA 169 168 168 ALA ALA C . n C 1 170 ALA 170 169 169 ALA ALA C . n C 1 171 ALA 171 170 170 ALA ALA C . n C 1 172 THR 172 171 171 THR THR C . n C 1 173 ASN 173 172 172 ASN ASN C . n C 1 174 PHE 174 173 173 PHE PHE C . n C 1 175 VAL 175 174 174 VAL VAL C . n C 1 176 ARG 176 175 175 ARG ARG C . n C 1 177 TYR 177 176 176 TYR TYR C . n C 1 178 CYS 178 177 177 CYS CYS C . n C 1 179 GLU 179 178 178 GLU GLU C . n C 1 180 TYR 180 179 179 TYR TYR C . n C 1 181 PRO 181 180 180 PRO PRO C . n C 1 182 GLY 182 181 181 GLY GLY C . n C 1 183 LEU 183 182 182 LEU LEU C . n C 1 184 ARG 184 183 183 ARG ARG C . n C 1 185 LEU 185 184 184 LEU LEU C . n C 1 186 PHE 186 185 185 PHE PHE C . n C 1 187 LYS 187 186 186 LYS LYS C . n C 1 188 ARG 188 187 187 ARG ARG C . n C 1 189 VAL 189 188 188 VAL VAL C . n C 1 190 LYS 190 189 189 LYS LYS C . n C 1 191 PHE 191 190 190 PHE PHE C . n C 1 192 GLU 192 191 191 GLU GLU C . n C 1 193 VAL 193 192 192 VAL VAL C . n C 1 194 ASN 194 193 193 ASN ASN C . n C 1 195 GLY 195 194 194 GLY GLY C . n C 1 196 ASN 196 195 195 ASN ASN C . n C 1 197 PRO 197 196 196 PRO PRO C . n C 1 198 LEU 198 197 197 LEU LEU C . n C 1 199 ASP 199 198 198 ASP ASP C . n C 1 200 GLU 200 199 199 GLU GLU C . n C 1 201 TYR 201 200 200 TYR TYR C . n C 1 202 THR 202 201 201 THR THR C . n C 1 203 ALA 203 202 202 ALA ALA C . n C 1 204 LEU 204 203 203 LEU LEU C . n C 1 205 ALA 205 204 204 ALA ALA C . n C 1 206 ALA 206 205 205 ALA ALA C . n C 1 207 ILE 207 206 206 ILE ILE C . n C 1 208 MET 208 207 207 MET MET C . n C 1 209 TYR 209 208 208 TYR TYR C . n C 1 210 ASN 210 209 209 ASN ASN C . n C 1 211 LYS 211 210 210 LYS LYS C . n C 1 212 PHE 212 211 211 PHE PHE C . n C 1 213 HIS 213 212 212 HIS HIS C . n C 1 214 VAL 214 213 213 VAL VAL C . n C 1 215 PRO 215 214 214 PRO PRO C . n C 1 216 ASP 216 215 215 ASP ASP C . n C 1 217 PHE 217 216 216 PHE PHE C . n C 1 218 LYS 218 217 217 LYS LYS C . n C 1 219 LEU 219 218 218 LEU LEU C . n C 1 220 THR 220 219 219 THR THR C . n C 1 221 GLY 221 220 220 GLY GLY C . n C 1 222 TRP 222 221 221 TRP TRP C . n C 1 223 LYS 223 222 222 LYS LYS C . n C 1 224 ARG 224 223 223 ARG ARG C . n C 1 225 LEU 225 224 224 LEU LEU C . n C 1 226 ILE 226 225 225 ILE ILE C . n C 1 227 GLY 227 226 226 GLY GLY C . n C 1 228 GLN 228 227 227 GLN GLN C . n C 1 229 GLU 229 228 228 GLU GLU C . n C 1 230 VAL 230 229 229 VAL VAL C . n C 1 231 PRO 231 230 230 PRO PRO C . n C 1 232 VAL 232 231 231 VAL VAL C . n C 1 233 GLU 233 232 232 GLU GLU C . n C 1 234 ALA 234 233 233 ALA ALA C . n C 1 235 ALA 235 234 234 ALA ALA C . n C 1 236 SER 236 235 235 SER SER C . n C 1 237 ASN 237 236 236 ASN ASN C . n C 1 238 LEU 238 237 237 LEU LEU C . n C 1 239 VAL 239 238 238 VAL VAL C . n C 1 240 ASN 240 239 239 ASN ASN C . n C 1 241 ILE 241 240 240 ILE ILE C . n C 1 242 ALA 242 241 241 ALA ALA C . n C 1 243 SER 243 242 242 SER SER C . n C 1 244 THR 244 243 243 THR THR C . n C 1 245 THR 245 244 244 THR THR C . n C 1 246 PRO 246 245 245 PRO PRO C . n C 1 247 TRP 247 246 246 TRP TRP C . n C 1 248 GLY 248 247 247 GLY GLY C . n C 1 249 SER 249 248 248 SER SER C . n C 1 250 PRO 250 249 249 PRO PRO C . n C 1 251 ILE 251 250 250 ILE ILE C . n C 1 252 VAL 252 251 251 VAL VAL C . n C 1 253 ALA 253 252 252 ALA ALA C . n C 1 254 LEU 254 253 253 LEU LEU C . n C 1 255 SER 255 254 254 SER SER C . n C 1 256 ASP 256 255 255 ASP ASP C . n C 1 257 VAL 257 256 256 VAL VAL C . n C 1 258 ASN 258 257 257 ASN ASN C . n C 1 259 GLY 259 258 258 GLY GLY C . n C 1 260 THR 260 259 259 THR THR C . n C 1 261 ALA 261 260 260 ALA ALA C . n C 1 262 VAL 262 261 261 VAL VAL C . n C 1 263 THR 263 262 262 THR THR C . n C 1 264 GLY 264 263 263 GLY GLY C . n C 1 265 SER 265 264 264 SER SER C . n C 1 266 PRO 266 265 265 PRO PRO C . n C 1 267 VAL 267 266 266 VAL VAL C . n C 1 268 ASN 268 267 267 ASN ASN C . n C 1 269 ALA 269 268 268 ALA ALA C . n C 1 270 ALA 270 269 269 ALA ALA C . n C 1 271 ILE 271 270 270 ILE ILE C . n C 1 272 THR 272 271 271 THR THR C . n C 1 273 ALA 273 272 272 ALA ALA C . n C 1 274 ARG 274 273 273 ARG ARG C . n C 1 275 LYS 275 274 274 LYS LYS C . n C 1 276 LEU 276 275 275 LEU LEU C . n C 1 277 THR 277 276 276 THR THR C . n C 1 278 GLN 278 277 277 GLN GLN C . n C 1 279 VAL 279 278 278 VAL VAL C . n C 1 280 VAL 280 279 279 VAL VAL C . n C 1 281 PHE 281 280 280 PHE PHE C . n C 1 282 GLY 282 281 281 GLY GLY C . n C 1 283 ALA 283 282 282 ALA ALA C . n C 1 284 GLN 284 283 283 GLN GLN C . n C 1 285 THR 285 284 284 THR THR C . n C 1 286 PRO 286 285 285 PRO PRO C . n C 1 287 LYS 287 286 286 LYS LYS C . n C 1 288 ALA 288 287 287 ALA ALA C . n C 1 289 THR 289 288 288 THR THR C . n C 1 290 GLN 290 289 289 GLN GLN C . n C 1 291 GLU 291 290 290 GLU GLU C . n C 1 292 GLN 292 291 291 GLN GLN C . n C 1 293 LEU 293 292 292 LEU LEU C . n C 1 294 ASN 294 293 293 ASN ASN C . n C 1 295 MET 295 294 294 MET MET C . n C 1 296 PHE 296 295 295 PHE PHE C . n C 1 297 VAL 297 296 296 VAL VAL C . n C 1 298 PRO 298 297 297 PRO PRO C . n C 1 299 LEU 299 298 298 LEU LEU C . n C 1 300 LEU 300 299 299 LEU LEU C . n C 1 301 PHE 301 300 300 PHE PHE C . n C 1 302 TRP 302 301 301 TRP TRP C . n C 1 303 PHE 303 302 302 PHE PHE C . n C 1 304 ARG 304 303 303 ARG ARG C . n C 1 305 ASP 305 304 304 ASP ASP C . n C 1 306 PRO 306 305 305 PRO PRO C . n C 1 307 ARG 307 306 306 ARG ARG C . n C 1 308 LEU 308 307 307 LEU LEU C . n C 1 309 ALA 309 308 308 ALA ALA C . n C 1 310 ILE 310 309 309 ILE ILE C . n C 1 311 ALA 311 310 310 ALA ALA C . n C 1 312 SER 312 311 311 SER SER C . n C 1 313 VAL 313 312 312 VAL VAL C . n C 1 314 SER 314 313 313 SER SER C . n C 1 315 ILE 315 314 314 ILE ILE C . n C 1 316 PRO 316 315 315 PRO PRO C . n C 1 317 TYR 317 316 316 TYR TYR C . n C 1 318 GLY 318 317 317 GLY GLY C . n C 1 319 GLN 319 318 318 GLN GLN C . n C 1 320 ARG 320 319 319 ARG ARG C . n C 1 321 PHE 321 320 320 PHE PHE C . n C 1 322 ILE 322 321 321 ILE ILE C . n C 1 323 THR 323 322 322 THR THR C . n C 1 324 VAL 324 323 323 VAL VAL C . n C 1 325 ASP 325 324 324 ASP ASP C . n C 1 326 ILE 326 325 325 ILE ILE C . n C 1 327 GLU 327 326 326 GLU GLU C . n C 1 328 GLN 328 327 327 GLN GLN C . n C 1 329 GLN 329 328 328 GLN GLN C . n C 1 330 SER 330 329 329 SER SER C . n C 1 331 ASN 331 330 330 ASN ASN C . n C 1 332 ILE 332 331 331 ILE ILE C . n C 1 333 LEU 333 332 332 LEU LEU C . n C 1 334 PHE 334 333 333 PHE PHE C . n C 1 335 THR 335 334 334 THR THR C . n C 1 336 ALA 336 335 335 ALA ALA C . n C 1 337 PRO 337 336 336 PRO PRO C . n C 1 338 GLY 338 337 337 GLY GLY C . n C 1 339 ASN 339 338 338 ASN ASN C . n C 1 340 LEU 340 339 339 LEU LEU C . n C 1 341 PHE 341 340 340 PHE PHE C . n C 1 342 LEU 342 341 341 LEU LEU C . n C 1 343 GLN 343 342 342 GLN GLN C . n C 1 344 THR 344 343 343 THR THR C . n C 1 345 THR 345 344 344 THR THR C . n C 1 346 VAL 346 345 345 VAL VAL C . n C 1 347 GLU 347 346 346 GLU GLU C . n C 1 348 THR 348 347 347 THR THR C . n C 1 349 LEU 349 348 348 LEU LEU C . n C 1 350 LEU 350 349 349 LEU LEU C . n C 1 351 THR 351 350 350 THR THR C . n C 1 352 THR 352 351 351 THR THR C . n C 1 353 GLY 353 352 352 GLY GLY C . n C 1 354 ALA 354 353 353 ALA ALA C . n C 1 355 GLY 355 354 354 GLY GLY C . n C 1 356 LYS 356 355 355 LYS LYS C . n C 1 357 GLY 357 356 356 GLY GLY C . n C 1 358 THR 358 357 357 THR THR C . n C 1 359 ALA 359 358 358 ALA ALA C . n C 1 360 THR 360 359 359 THR THR C . n C 1 361 GLY 361 360 360 GLY GLY C . n C 1 362 VAL 362 361 361 VAL VAL C . n C 1 363 LEU 363 362 362 LEU LEU C . n C 1 364 LEU 364 363 363 LEU LEU C . n C 1 365 THR 365 364 364 THR THR C . n C 1 366 GLN 366 365 365 GLN GLN C . n C 1 367 TYR 367 366 366 TYR TYR C . n C 1 368 ASN 368 367 367 ASN ASN C . n C 1 369 ARG 369 368 368 ARG ARG C . n C 1 370 TYR 370 369 369 TYR TYR C . n C 1 371 THR 371 370 370 THR THR C . n C 1 372 THR 372 371 371 THR THR C . n C 1 373 TYR 373 372 372 TYR TYR C . n C 1 374 THR 374 373 373 THR THR C . n C 1 375 PRO 375 374 374 PRO PRO C . n C 1 376 THR 376 375 375 THR THR C . n C 1 377 LEU 377 376 376 LEU LEU C . n C 1 378 ALA 378 377 377 ALA ALA C . n C 1 379 SER 379 378 378 SER SER C . n C 1 380 GLY 380 379 379 GLY GLY C . n C 1 381 SER 381 380 380 SER SER C . n C 1 382 SER 382 381 381 SER SER C . n C 1 383 ILE 383 382 382 ILE ILE C . n C 1 384 ASP 384 383 383 ASP ASP C . n C 1 385 GLY 385 384 384 GLY GLY C . n C 1 386 THR 386 385 385 THR THR C . n C 1 387 GLN 387 386 386 GLN GLN C . n C 1 388 ALA 388 387 387 ALA ALA C . n C 1 389 VAL 389 388 388 VAL VAL C . n C 1 390 GLN 390 389 389 GLN GLN C . n C 1 391 ASN 391 390 390 ASN ASN C . n C 1 392 ILE 392 391 391 ILE ILE C . n C 1 393 GLU 393 392 392 GLU GLU C . n C 1 394 LEU 394 393 393 LEU LEU C . n C 1 395 TYR 395 394 394 TYR TYR C . n C 1 396 ILE 396 395 395 ILE ILE C . n C 1 397 ASN 397 396 396 ASN ASN C . n C 1 398 ASN 398 397 397 ASN ASN C . n C 1 399 ILE 399 398 398 ILE ILE C . n C 1 400 PHE 400 399 399 PHE PHE C . n C 1 401 VAL 401 400 400 VAL VAL C . n C 1 402 THR 402 401 401 THR THR C . n C 1 403 PRO 403 402 402 PRO PRO C . n C 1 404 GLU 404 403 403 GLU GLU C . n C 1 405 ILE 405 404 404 ILE ILE C . n C 1 406 HIS 406 405 405 HIS HIS C . n C 1 407 ASP 407 406 406 ASP ASP C . n C 1 408 ILE 408 407 407 ILE ILE C . n C 1 409 TYR 409 408 408 TYR TYR C . n C 1 410 ILE 410 409 409 ILE ILE C . n C 1 411 LYS 411 410 410 LYS LYS C . n C 1 412 ARG 412 411 411 ARG ARG C . n C 1 413 ILE 413 412 412 ILE ILE C . n C 1 414 GLY 414 413 413 GLY GLY C . n C 1 415 PHE 415 414 414 PHE PHE C . n C 1 416 THR 416 415 415 THR THR C . n C 1 417 LEU 417 416 416 LEU LEU C . n C 1 418 ILE 418 417 417 ILE ILE C . n C 1 419 ARG 419 418 418 ARG ARG C . n C 1 420 VAL 420 419 419 VAL VAL C . n C 1 421 TYR 421 420 420 TYR TYR C . n C 1 422 ARG 422 421 421 ARG ARG C . n C 1 423 GLU 423 422 422 GLU GLU C . n C 1 424 GLN 424 423 423 GLN GLN C . n C 1 425 VAL 425 424 424 VAL VAL C . n C 1 426 GLN 426 425 425 GLN GLN C . n C 1 427 ARG 427 426 426 ARG ARG C . n C 1 428 GLU 428 427 427 GLU GLU C . n C 1 429 VAL 429 428 428 VAL VAL C . n C 1 430 ASN 430 429 429 ASN ASN C . n C 1 431 ALA 431 430 430 ALA ALA C . n C 1 432 ALA 432 431 431 ALA ALA C . n C 1 433 ASP 433 432 432 ASP ASP C . n C 1 434 GLN 434 433 433 GLN GLN C . n C 1 435 VAL 435 434 434 VAL VAL C . n C 1 436 LEU 436 435 435 LEU LEU C . n C 1 437 GLN 437 436 436 GLN GLN C . n C 1 438 SER 438 437 437 SER SER C . n C 1 439 GLN 439 438 438 GLN GLN C . n C 1 440 LEU 440 439 439 LEU LEU C . n C 1 441 LYS 441 440 440 LYS LYS C . n C 1 442 TRP 442 441 441 TRP TRP C . n C 1 443 PRO 443 442 442 PRO PRO C . n C 1 444 VAL 444 443 443 VAL VAL C . n C 1 445 GLU 445 444 444 GLU GLU C . n C 1 446 PHE 446 445 445 PHE PHE C . n C 1 447 ILE 447 446 446 ILE ILE C . n C 1 448 TYR 448 447 447 TYR TYR C . n C 1 449 LEU 449 448 448 LEU LEU C . n C 1 450 GLY 450 449 449 GLY GLY C . n C 1 451 LEU 451 450 450 LEU LEU C . n C 1 452 ARG 452 451 451 ARG ARG C . n C 1 453 PRO 453 452 452 PRO PRO C . n C 1 454 ALA 454 453 453 ALA ALA C . n C 1 455 ASN 455 454 454 ASN ASN C . n C 1 456 ASN 456 455 455 ASN ASN C . n C 1 457 ILE 457 456 456 ILE ILE C . n C 1 458 ALA 458 457 457 ALA ALA C . n C 1 459 ALA 459 458 458 ALA ALA C . n C 1 460 GLY 460 459 459 GLY GLY C . n C 1 461 ASN 461 460 460 ASN ASN C . n C 1 462 THR 462 461 461 THR THR C . n C 1 463 TYR 463 462 462 TYR TYR C . n C 1 464 GLN 464 463 463 GLN GLN C . n C 1 465 TRP 465 464 464 TRP TRP C . n C 1 466 ARG 466 465 465 ARG ARG C . n C 1 467 ASP 467 466 466 ASP ASP C . n C 1 468 TRP 468 467 467 TRP TRP C . n C 1 469 HIS 469 468 468 HIS HIS C . n C 1 470 HIS 470 469 469 HIS HIS C . n C 1 471 LEU 471 470 470 LEU LEU C . n C 1 472 THR 472 471 471 THR THR C . n C 1 473 SER 473 472 472 SER SER C . n C 1 474 VAL 474 473 473 VAL VAL C . n C 1 475 THR 475 474 474 THR THR C . n C 1 476 ASN 476 475 475 ASN ASN C . n C 1 477 GLU 477 476 476 GLU GLU C . n C 1 478 PRO 478 477 477 PRO PRO C . n C 1 479 VAL 479 478 478 VAL VAL C . n C 1 480 TYR 480 479 479 TYR TYR C . n C 1 481 ASP 481 480 480 ASP ASP C . n C 1 482 VAL 482 481 481 VAL VAL C . n C 1 483 SER 483 482 482 SER SER C . n C 1 484 GLN 484 483 483 GLN GLN C . n C 1 485 SER 485 484 484 SER SER C . n C 1 486 TYR 486 485 485 TYR TYR C . n C 1 487 ALA 487 486 486 ALA ALA C . n C 1 488 ARG 488 487 487 ARG ARG C . n C 1 489 VAL 489 488 488 VAL VAL C . n C 1 490 SER 490 489 489 SER SER C . n C 1 491 ILE 491 490 490 ILE ILE C . n C 1 492 ASP 492 491 491 ASP ASP C . n C 1 493 ASP 493 492 492 ASP ASP C . n C 1 494 THR 494 493 493 THR THR C . n C 1 495 VAL 495 494 494 VAL VAL C . n C 1 496 ALA 496 495 495 ALA ALA C . n C 1 497 PRO 497 496 496 PRO PRO C . n C 1 498 VAL 498 497 497 VAL VAL C . n C 1 499 GLY 499 498 498 GLY GLY C . n C 1 500 SER 500 499 499 SER SER C . n C 1 501 THR 501 500 500 THR THR C . n C 1 502 THR 502 501 501 THR THR C . n C 1 503 PHE 503 502 502 PHE PHE C . n C 1 504 LYS 504 503 503 LYS LYS C . n C 1 505 GLN 505 504 504 GLN GLN C . n C 1 506 SER 506 505 505 SER SER C . n C 1 507 ALA 507 506 506 ALA ALA C . n C 1 508 SER 508 507 507 SER SER C . n C 1 509 GLN 509 508 508 GLN GLN C . n C 1 510 VAL 510 509 509 VAL VAL C . n C 1 511 MET 511 510 510 MET MET C . n C 1 512 GLN 512 511 511 GLN GLN C . n C 1 513 ASN 513 512 512 ASN ASN C . n C 1 514 GLN 514 513 513 GLN GLN C . n C 1 515 TYR 515 514 514 TYR TYR C . n C 1 516 ILE 516 515 515 ILE ILE C . n C 1 517 VAL 517 516 516 VAL VAL C . n C 1 518 PRO 518 517 517 PRO PRO C . n C 1 519 VAL 519 518 518 VAL VAL C . n C 1 520 GLU 520 519 519 GLU GLU C . n C 1 521 THR 521 520 520 THR THR C . n C 1 522 GLU 522 521 521 GLU GLU C . n C 1 523 THR 523 522 522 THR THR C . n C 1 524 LEU 524 523 523 LEU LEU C . n C 1 525 ASP 525 524 524 ASP ASP C . n C 1 526 THR 526 525 525 THR THR C . n C 1 527 VAL 527 526 526 VAL VAL C . n C 1 528 ARG 528 527 527 ARG ARG C . n C 1 529 VAL 529 528 528 VAL VAL C . n C 1 530 LYS 530 529 529 LYS LYS C . n C 1 531 ALA 531 530 530 ALA ALA C . n C 1 532 HIS 532 531 531 HIS HIS C . n C 1 533 GLY 533 532 532 GLY GLY C . n C 1 534 ILE 534 533 533 ILE ILE C . n C 1 535 GLU 535 534 534 GLU GLU C . n C 1 536 LEU 536 535 535 LEU LEU C . n C 1 537 TYR 537 536 536 TYR TYR C . n C 1 538 ALA 538 537 537 ALA ALA C . n C 1 539 GLN 539 538 538 GLN GLN C . n C 1 540 TYR 540 539 539 TYR TYR C . n C 1 541 ARG 541 540 540 ARG ARG C . n C 1 542 ALA 542 541 541 ALA ALA C . n C 1 543 GLN 543 542 542 GLN GLN C . n C 1 544 PHE 544 543 543 PHE PHE C . n C 1 545 TYR 545 544 544 TYR TYR C . n C 1 546 ARG 546 545 545 ARG ARG C . n C 1 547 ASP 547 546 546 ASP ASP C . n C 1 548 TYR 548 547 547 TYR TYR C . n C 1 549 ILE 549 548 548 ILE ILE C . n C 1 550 PRO 550 549 549 PRO PRO C . n C 1 551 TRP 551 550 550 TRP TRP C . n C 1 552 ASN 552 551 551 ASN ASN C . n C 1 553 TYR 553 552 552 TYR TYR C . n C 1 554 GLY 554 553 553 GLY GLY C . n C 1 555 SER 555 554 554 SER SER C . n C 1 556 PHE 556 555 555 PHE PHE C . n C 1 557 ASN 557 556 556 ASN ASN C . n C 1 558 LEU 558 557 557 LEU LEU C . n C 1 559 VAL 559 558 558 VAL VAL C . n C 1 560 THR 560 559 559 THR THR C . n C 1 561 PRO 561 560 560 PRO PRO C . n C 1 562 GLN 562 561 561 GLN GLN C . n C 1 563 ASP 563 562 562 ASP ASP C . n C 1 564 LYS 564 563 563 LYS LYS C . n C 1 565 GLY 565 564 564 GLY GLY C . n C 1 566 ALA 566 565 565 ALA ALA C . n C 1 567 LEU 567 566 566 LEU LEU C . n C 1 568 PHE 568 567 567 PHE PHE C . n C 1 569 LEU 569 568 568 LEU LEU C . n C 1 570 ASN 570 569 569 ASN ASN C . n C 1 571 PHE 571 570 570 PHE PHE C . n C 1 572 CYS 572 571 571 CYS CYS C . n C 1 573 LEU 573 572 572 LEU LEU C . n C 1 574 TYR 574 573 573 TYR TYR C . n C 1 575 PRO 575 574 574 PRO PRO C . n C 1 576 GLY 576 575 575 GLY GLY C . n C 1 577 THR 577 576 576 THR THR C . n C 1 578 TYR 578 577 577 TYR TYR C . n C 1 579 GLN 579 578 578 GLN GLN C . n C 1 580 PRO 580 579 579 PRO PRO C . n C 1 581 SER 581 580 580 SER SER C . n C 1 582 GLY 582 581 581 GLY GLY C . n C 1 583 HIS 583 582 582 HIS HIS C . n C 1 584 VAL 584 583 583 VAL VAL C . n C 1 585 ASN 585 584 584 ASN ASN C . n C 1 586 ILE 586 585 585 ILE ILE C . n C 1 587 SER 587 586 586 SER SER C . n C 1 588 ARG 588 587 587 ARG ARG C . n C 1 589 ALA 589 588 588 ALA ALA C . n C 1 590 ARG 590 589 589 ARG ARG C . n C 1 591 GLU 591 590 590 GLU GLU C . n C 1 592 PHE 592 591 591 PHE PHE C . n C 1 593 TYR 593 592 592 TYR TYR C . n C 1 594 ILE 594 593 593 ILE ILE C . n C 1 595 GLU 595 594 594 GLU GLU C . n C 1 596 TYR 596 595 595 TYR TYR C . n C 1 597 THR 597 596 596 THR THR C . n C 1 598 SER 598 597 597 SER SER C . n C 1 599 SER 599 598 598 SER SER C . n C 1 600 PHE 600 599 599 PHE PHE C . n C 1 601 CYS 601 600 600 CYS CYS C . n C 1 602 ASP 602 601 601 ASP ASP C . n C 1 603 SER 603 602 602 SER SER C . n C 1 604 SER 604 603 603 SER SER C . n C 1 605 ASN 605 604 604 ASN ASN C . n C 1 606 PRO 606 605 605 PRO PRO C . n C 1 607 CYS 607 606 606 CYS CYS C . n C 1 608 ASP 608 607 607 ASP ASP C . n C 1 609 LEU 609 608 608 LEU LEU C . n C 1 610 ILE 610 609 609 ILE ILE C . n C 1 611 SER 611 610 610 SER SER C . n C 1 612 ILE 612 611 611 ILE ILE C . n C 1 613 ALA 613 612 612 ALA ALA C . n C 1 614 LYS 614 613 613 LYS LYS C . n C 1 615 CYS 615 614 614 CYS CYS C . n C 1 616 ILE 616 615 615 ILE ILE C . n C 1 617 ASN 617 616 616 ASN ASN C . n C 1 618 PHE 618 617 617 PHE PHE C . n C 1 619 LEU 619 618 618 LEU LEU C . n C 1 620 LEU 620 619 619 LEU LEU C . n C 1 621 ILE 621 620 620 ILE ILE C . n C 1 622 SER 622 621 ? ? ? C . n C 1 623 ASP 623 622 ? ? ? C . n C 1 624 GLY 624 623 ? ? ? C . n C 1 625 SER 625 624 ? ? ? C . n C 1 626 ALA 626 625 ? ? ? C . n C 1 627 VAL 627 626 ? ? ? C . n C 1 628 LEU 628 627 ? ? ? C . n C 1 629 ARG 629 628 ? ? ? C . n C 1 630 TYR 630 629 ? ? ? C . n C 1 631 SER 631 630 ? ? ? C . n C 1 632 THR 632 631 ? ? ? C . n C 1 633 LYS 633 632 ? ? ? C . n C 1 634 GLU 634 633 ? ? ? C . n C 1 635 PHE 635 634 ? ? ? C . n C 1 636 TYR 636 635 ? ? ? C . n C 1 637 LEU 637 636 ? ? ? C . n C 1 638 GLN 638 637 ? ? ? C . n C 1 639 CYS 639 638 ? ? ? C . n C 1 640 LEU 640 639 ? ? ? C . n C 1 641 ILE 641 640 ? ? ? C . n C 1 642 LEU 642 641 ? ? ? C . n C 1 643 ARG 643 642 ? ? ? C . n C 1 644 CYS 644 643 ? ? ? C . n C 1 645 ILE 645 644 ? ? ? C . n # _cell.angle_alpha 90 _cell.angle_alpha_esd ? _cell.angle_beta 90 _cell.angle_beta_esd ? _cell.angle_gamma 90 _cell.angle_gamma_esd ? _cell.entry_id 5J7V _cell.details ? _cell.formula_units_Z ? _cell.length_a 1 _cell.length_a_esd ? _cell.length_b 1 _cell.length_b_esd ? _cell.length_c 1 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5J7V _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5J7V _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _struct.entry_id 5J7V _struct.title 'Faustovirus major capsid protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5J7V _struct_keywords.text 'virus, double jelly-roll' _struct_keywords.pdbx_keywords VIRUS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5J7V _struct_ref.pdbx_db_accession 5J7V _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5J7V A 1 ? 645 ? 5J7V 0 ? 644 ? 0 644 2 1 5J7V B 1 ? 645 ? 5J7V 0 ? 644 ? 0 644 3 1 5J7V C 1 ? 645 ? 5J7V 0 ? 644 ? 0 644 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 'complete icosahedral assembly' ? 8280-meric 8280 2 'icosahedral asymmetric unit' ? 138-meric 138 3 'icosahedral pentamer' ? 690-meric 690 4 'icosahedral asymmetric unit, std point frame' ? 141-meric 141 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 '(1-2760)' A,B,C 2 '(1-46)' A,B,C 3 '(1-230)' A,B,C 4 '(P)(1-46)' A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] P 'transform to point frame' ? ? -0.58778525 -0.80901699 0.00000025 0.00000 0.68819118 -0.50000000 0.52573082 0.00000 -0.42532504 0.30901699 0.85065099 0.00000 1 'identity operation' 1_555 x,y,z 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 2 'point symmetry operation' ? ? 0.59286000 -0.78913100 -0.16058700 -47.33812 0.78567600 0.52303300 0.33037800 -221.35576 -0.17672000 -0.32203800 0.93008700 -51.25060 3 'point symmetry operation' ? ? 0.66292200 -0.74754500 -0.04136700 -216.10415 0.64525400 0.54244100 0.53796400 -259.57658 -0.37971300 -0.38332000 0.84195200 -57.54576 4 'point symmetry operation' ? ? 0.60526900 -0.79207500 -0.07916200 -28.69671 0.73866900 0.52181100 0.42671000 -283.55186 -0.29667900 -0.31674900 0.90091700 19.52349 5 'point symmetry operation' ? ? 0.61338500 -0.77935900 -0.12789900 -37.46035 0.74670100 0.51951400 0.41538300 -258.60754 -0.25728700 -0.35029200 0.90061000 -10.70583 6 'point symmetry operation' ? ? 0.49831000 -0.85154500 -0.16296800 -35.25196 0.85905900 0.45956500 0.22542600 -163.54078 -0.11706600 -0.25233100 0.96053300 -61.87549 7 'point symmetry operation' ? ? 0.98666900 -0.16251800 -0.00845600 -64.97692 0.15444200 0.95148800 -0.26611800 195.66587 0.05129400 0.26126400 0.96390300 -13.03648 8 'point symmetry operation' ? ? 0.57261300 -0.79679400 -0.19296000 -115.75620 0.80393700 0.49962500 0.32258400 -256.38165 -0.16062500 -0.33984300 0.92666400 -112.26368 9 'point symmetry operation' ? ? 0.98130200 -0.18150600 0.06404500 -76.16157 0.19247300 0.92426700 -0.32967400 261.01676 0.00064400 0.33583700 0.94192000 33.15136 10 'point symmetry operation' ? ? 0.65600700 -0.75178600 -0.06687400 -252.60176 0.66729900 0.53631300 0.51679800 -221.83254 -0.35265600 -0.38364800 0.85349100 -104.03287 11 'point symmetry operation' ? ? 0.51532500 -0.83995500 -0.17004600 -122.71690 0.84883200 0.47294600 0.23623300 -225.33790 -0.11800300 -0.26607700 0.95670200 -127.37012 12 'point symmetry operation' ? ? 0.66706200 -0.74478200 -0.01809700 -177.33975 0.62465200 0.54590000 0.55839300 -296.60313 -0.40600200 -0.38378700 0.82937900 -10.37461 13 'point symmetry operation' ? ? 0.97394900 -0.21981400 0.05572300 -230.22272 0.22433500 0.89807400 -0.37833300 157.00180 0.03312000 0.38097800 0.92399100 -82.65436 14 'point symmetry operation' ? ? 0.54055400 -0.82262800 -0.17631100 -76.84247 0.83000500 0.48720900 0.27151400 -207.69067 -0.13745500 -0.29310700 0.94614700 -88.65567 15 'point symmetry operation' ? ? 0.42932100 -0.89778500 -0.09831000 -215.08962 0.90074600 0.41769300 0.11912200 -216.35007 -0.06588300 -0.13969400 0.98800100 -184.68170 16 'point symmetry operation' ? ? 0.47443900 -0.86906200 -0.14013600 -97.51309 0.87517100 0.44852700 0.18138100 -172.23893 -0.09477600 -0.20869700 0.97337700 -104.65938 17 'point symmetry operation' ? ? 0.62130100 -0.75762700 -0.19996500 -182.74007 0.76851800 0.53940600 0.34412300 -206.71822 -0.15285500 -0.36748100 0.91738400 -158.24881 18 'point symmetry operation' ? ? 0.60716800 -0.76471600 -0.21576800 -206.13762 0.78191800 0.52677400 0.33333600 -249.95623 -0.14124600 -0.37110400 0.91778600 -183.36459 19 'point symmetry operation' ? ? 0.49327800 -0.85579700 -0.15584800 -175.79345 0.86392300 0.46106000 0.20263500 -244.84668 -0.10156000 -0.23459600 0.96677300 -167.52796 20 'point symmetry operation' ? ? 0.44105500 -0.89512200 -0.06501300 81.86982 0.88120100 0.41818200 0.22047400 -130.70571 -0.17016400 -0.15453000 0.97322400 52.09973 21 'point symmetry operation' ? ? 0.97467700 -0.20651500 0.08576300 -132.29823 0.22361500 0.90121400 -0.37122700 254.02574 -0.00062700 0.38100400 0.92457300 15.23106 22 'point symmetry operation' ? ? 0.54716200 -0.82429900 -0.14541300 -9.21704 0.81725900 0.48858400 0.30557100 -198.66828 -0.18083600 -0.28603700 0.94100000 -23.59269 23 'point symmetry operation' ? ? 0.45187800 -0.88423200 -0.11806600 -157.92820 0.88854200 0.43435000 0.14776100 -191.84208 -0.07937300 -0.17167700 0.98195100 -145.54119 24 'point symmetry operation' ? ? 0.65493500 -0.74975000 -0.09453000 -145.45132 0.68987000 0.54214000 0.47975300 -258.38872 -0.30844700 -0.37942000 0.87229600 -51.24377 25 'point symmetry operation' ? ? 0.56248600 -0.81368400 -0.14672600 160.04293 0.79908100 0.48942400 0.34918900 -215.25412 -0.21231900 -0.31366000 0.92549400 92.27224 26 'point symmetry operation' ? ? 0.64319300 -0.76243300 -0.07070000 -110.66813 0.68110100 0.52749300 0.50779300 -300.74756 -0.34986400 -0.37476300 0.85857300 -5.57397 27 'point symmetry operation' ? ? 0.98988100 -0.13986400 -0.02393400 -14.12662 0.13246000 0.97129500 -0.19758500 177.42246 0.05088200 0.19241600 0.97999300 2.22517 28 'point symmetry operation' ? ? 0.62417500 -0.76717300 -0.14782000 -76.33384 0.74252700 0.52364600 0.41767000 -252.36344 -0.24302000 -0.37046000 0.89649400 -42.65359 29 'point symmetry operation' ? ? 0.97826100 -0.20563200 0.02684500 -167.77101 0.20169600 0.91336500 -0.35367000 183.36728 0.04820700 0.35139600 0.93498500 -54.27231 30 'point symmetry operation' ? ? 0.63575300 -0.77187400 -0.00532000 -55.08014 0.65762400 0.53801700 0.52732100 -348.75194 -0.40416400 -0.33874400 0.84964900 70.68396 31 'point symmetry operation' ? ? 0.67185400 -0.74059400 0.01153100 -284.17559 0.59234500 0.54658100 0.59192700 -258.88400 -0.44468000 -0.39085800 0.80590900 -59.97249 32 'point symmetry operation' ? ? 0.66777000 -0.74425700 0.01283300 -146.77632 0.60062400 0.54892100 0.58132400 -337.32490 -0.43969900 -0.38048300 0.81357100 38.01275 33 'point symmetry operation' ? ? 0.52024700 -0.83108900 -0.19655500 170.14487 0.84966000 0.48048200 0.21729100 -124.03998 -0.08614700 -0.28005000 0.95611200 53.24935 34 'point symmetry operation' ? ? 0.54921600 -0.82992800 -0.09788200 169.39872 0.80340600 0.49213300 0.33517800 -208.79923 -0.23000300 -0.26272400 0.93705600 113.24870 35 'point symmetry operation' ? ? 0.58769100 -0.78555100 -0.19372500 -209.27279 0.79740900 0.52183000 0.30303800 -284.69677 -0.13696000 -0.33257000 0.93308000 -186.75245 36 'point symmetry operation' ? ? 0.98147800 -0.19153200 0.00407900 -111.55282 0.18259300 0.92880400 -0.32246400 203.75258 0.05797300 0.31723600 0.94657300 -28.23210 37 'point symmetry operation' ? ? 0.60838400 -0.77074200 -0.18927600 -136.43169 0.77643200 0.52862100 0.34309300 -214.47095 -0.16438100 -0.35569300 0.92003400 -120.24871 38 'point symmetry operation' ? ? 0.61714400 -0.76388700 -0.18870600 -173.13596 0.77410300 0.54643400 0.31964700 -249.68479 -0.14105900 -0.34334600 0.92855600 -153.02216 39 'point symmetry operation' ? ? 0.58096900 -0.79079500 -0.19266100 -76.52295 0.79340300 0.49740700 0.35085200 -229.77154 -0.18162100 -0.35669200 0.91639700 -77.53528 40 'point symmetry operation' ? ? 0.63569200 -0.76385800 -0.11142800 -192.15727 0.71583000 0.52928200 0.45546500 -216.25589 -0.28893400 -0.36929900 0.88325300 -100.61686 41 'point symmetry operation' ? ? 0.65241400 -0.75687800 -0.03863500 -80.86054 0.66258800 0.54490700 0.51386100 -322.30006 -0.36787800 -0.36084900 0.85700300 33.04309 42 'point symmetry operation' ? ? 0.62987700 -0.76054000 -0.15759000 -126.15018 0.74617400 0.53621900 0.39458000 -215.90059 -0.21559100 -0.36612700 0.90524700 -89.07097 43 'point symmetry operation' ? ? 0.62852200 -0.75670400 -0.17988700 -163.29127 0.75096200 0.53016600 0.39367600 -203.47013 -0.20252600 -0.38252200 0.90147700 -124.62050 44 'point symmetry operation' ? ? 0.99735400 0.05110700 0.05170400 -9.44982 -0.05553900 0.99454800 0.08826400 -46.87509 -0.04691100 -0.09090200 0.99475400 12.63980 45 'point symmetry operation' ? ? 0.55383000 -0.80979000 -0.19368200 -153.94484 0.82179200 0.49421800 0.28355800 -270.28221 -0.13390100 -0.31621000 0.93919200 -150.29542 46 'point symmetry operation' ? ? 0.63485000 -0.75959900 -0.14133200 -222.24783 0.72898300 0.52826200 0.43534200 -181.60213 -0.25602500 -0.37940500 0.88910200 -140.98210 47 'point symmetry operation' ? ? 0.30901700 -0.95105700 0.00000000 0.00000 0.95105700 0.30901700 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 48 'point symmetry operation' ? ? -0.56401900 -0.74128900 -0.36383300 195.89366 0.80663100 -0.58888300 -0.05063500 -113.42394 -0.17672000 -0.32203800 0.93008700 -51.25060 49 'point symmetry operation' ? ? -0.40881900 -0.74689600 -0.52441700 180.09227 0.82987100 -0.54333400 0.12689800 -285.74094 -0.37971300 -0.38332000 0.84195200 -57.54576 50 'point symmetry operation' ? ? -0.51547800 -0.74103700 -0.43028800 260.80621 0.80390600 -0.59206000 0.05657300 -114.91455 -0.29667900 -0.31674900 0.90091700 19.52349 51 'point symmetry operation' ? ? -0.52060900 -0.73492200 -0.43457600 234.37463 0.81410700 -0.58067600 0.00672100 -115.54105 -0.25728700 -0.35029200 0.90061000 -10.70583 52 'point symmetry operation' ? ? -0.66302800 -0.70021500 -0.26475300 144.64315 0.73938500 -0.66785400 -0.08533100 -84.06350 -0.11706600 -0.25233100 0.96053300 -61.87549 53 'point symmetry operation' ? ? 0.15801400 -0.95514000 0.25048000 -206.16837 0.98610400 0.13946200 -0.09027700 -1.33267 0.05129400 0.26126400 0.96390300 -13.03648 54 'point symmetry operation' ? ? -0.58764300 -0.72139500 -0.36642400 208.06293 0.79301700 -0.60340400 -0.08383200 -189.31703 -0.16062500 -0.33984300 0.92666400 -112.26368 55 'point symmetry operation' ? ? 0.12018600 -0.93511900 0.33333000 -271.77704 0.99275200 0.11299200 -0.04096500 8.22462 0.00064400 0.33583700 0.94192000 33.15136 56 'point symmetry operation' ? ? -0.43192300 -0.74237900 -0.51217000 132.91715 0.83010700 -0.54926200 0.09609800 -308.78870 -0.35265600 -0.38364800 0.85349100 -104.03287 57 'point symmetry operation' ? ? -0.64804400 -0.70935900 -0.27721800 176.38758 0.75240700 -0.65269700 -0.08872300 -186.34401 -0.11800300 -0.26607700 0.95670200 -127.37012 58 'point symmetry operation' ? ? -0.38794600 -0.74933300 -0.53665500 227.28549 0.82744200 -0.53963800 0.15534200 -260.31562 -0.40600200 -0.38378700 0.82937900 -10.37461 59 'point symmetry operation' ? ? 0.08761100 -0.92204600 0.37703600 -220.46040 0.99560400 0.06846500 -0.06391600 -170.43870 0.03312000 0.38097800 0.92399100 -82.65436 60 'point symmetry operation' ? ? -0.62234200 -0.71756900 -0.31270900 173.78004 0.77058300 -0.63181000 -0.08377900 -137.26152 -0.13745500 -0.29310700 0.94614700 -88.65567 61 'point symmetry operation' ? ? -0.72399300 -0.67468000 -0.14367100 139.29490 0.68665500 -0.72477100 -0.05668800 -271.41834 -0.06588300 -0.13969400 0.98800100 -184.68170 62 'point symmetry operation' ? ? -0.68572800 -0.69513000 -0.21580800 133.67584 0.72166200 -0.68792500 -0.07722800 -145.96526 -0.09477600 -0.20869700 0.97337700 -104.65938 63 'point symmetry operation' ? ? -0.53891200 -0.74712600 -0.38907300 140.13102 0.82837800 -0.55386100 -0.08383800 -237.67567 -0.15285500 -0.36748100 0.91738400 -158.24881 64 'point symmetry operation' ? ? -0.55602400 -0.73730300 -0.38369700 174.02259 0.81907800 -0.56450600 -0.10220100 -273.28935 -0.14124600 -0.37110400 0.91778600 -183.36459 65 'point symmetry operation' ? ? -0.66920900 -0.70295000 -0.24087700 178.53998 0.73610200 -0.67143700 -0.08560200 -242.85138 -0.10156000 -0.23459600 0.96677300 -167.52796 66 'point symmetry operation' ? ? -0.70177900 -0.67432300 -0.22977300 149.60775 0.69177400 -0.72208700 0.00629900 37.47258 -0.17016400 -0.15453000 0.97322400 52.09973 67 'point symmetry operation' ? ? 0.08852200 -0.92092300 0.37956000 -282.47536 0.99607500 0.08208300 -0.03315000 -47.32489 -0.00062700 0.38100400 0.92457300 15.23106 68 'point symmetry operation' ? ? -0.60817700 -0.71939400 -0.33555100 186.09664 0.77292900 -0.63297400 -0.04386900 -70.15781 -0.18083600 -0.28603700 0.94100000 -23.59269 69 'point symmetry operation' ? ? -0.70541600 -0.68633500 -0.17701400 133.65025 0.70433600 -0.70673400 -0.06662700 -209.48118 -0.07937300 -0.17167700 0.98195100 -145.54119 70 'point symmetry operation' ? ? -0.45372000 -0.74729100 -0.48548400 200.79547 0.83606200 -0.54552400 0.05834900 -218.17900 -0.30844700 -0.37942000 0.87229600 -51.24377 71 'point symmetry operation' ? ? -0.58615400 -0.71691300 -0.37744000 254.17492 0.78188600 -0.62261900 -0.03163900 85.69277 -0.21231900 -0.31366000 0.92549400 92.27224 72 'point symmetry operation' ? ? -0.44900800 -0.73728000 -0.50478700 251.82974 0.82218500 -0.56211300 0.08967700 -198.18781 -0.34986400 -0.37476300 0.85857300 -5.57397 73 'point symmetry operation' ? ? 0.17991300 -0.96697700 0.18051900 -173.10424 0.98236600 0.16712800 -0.08382000 41.39134 0.05088200 0.19241600 0.97999300 2.22517 74 'point symmetry operation' ? ? -0.51330500 -0.73508700 -0.44290700 216.42356 0.82308000 -0.56781000 -0.01151800 -150.58243 -0.24302000 -0.37046000 0.89649400 -42.65359 75 'point symmetry operation' ? ? 0.11047500 -0.93220600 0.34465600 -226.23683 0.99271000 0.08667700 -0.08375900 -102.89619 0.04820700 0.35139600 0.93498500 -54.27231 76 'point symmetry operation' ? ? -0.42898000 -0.75020700 -0.50315700 314.66227 0.80785400 -0.56784000 0.15789200 -160.15463 -0.40416400 -0.33874400 0.84964900 70.68396 77 'point symmetry operation' ? ? -0.35573900 -0.74868500 -0.55939300 158.39835 0.82201600 -0.53544500 0.19388200 -350.26674 -0.44468000 -0.39085800 0.80590900 -59.97249 78 'point symmetry operation' ? ? -0.36487500 -0.75204300 -0.54890600 275.45883 0.82069000 -0.53820500 0.19184400 -243.83178 -0.43969900 -0.38048300 0.81357100 38.01275 79 'point symmetry operation' ? ? -0.64731000 -0.71378600 -0.26739500 170.54675 0.75734400 -0.64193600 -0.11978900 123.48701 -0.08614700 -0.28005000 0.95611200 53.24935 80 'point symmetry operation' ? ? -0.59436800 -0.72450900 -0.34902100 250.92705 0.77060200 -0.63723200 0.01048400 96.58533 -0.23000300 -0.26272400 0.93705600 113.24870 81 'point symmetry operation' ? ? -0.57677500 -0.73903900 -0.34807000 206.09401 0.80534100 -0.58584900 -0.09060000 -287.00649 -0.13696000 -0.33257000 0.93308000 -186.75245 82 'point symmetry operation' ? ? 0.12963700 -0.94253200 0.30794200 -228.25204 0.98986600 0.10485900 -0.09576700 -43.13008 0.05797300 0.31723600 0.94657300 -28.23210 83 'point symmetry operation' ? ? -0.55043000 -0.74092100 -0.38479100 161.81439 0.81853900 -0.56966600 -0.07399100 -196.02948 -0.16438100 -0.35569300 0.92003400 -120.24871 84 'point symmetry operation' ? ? -0.54550900 -0.75574400 -0.36231500 183.96251 0.82615000 -0.55764300 -0.08069400 -241.81901 -0.14105900 -0.34334600 0.92855600 -153.02216 85 'point symmetry operation' ? ? -0.57504200 -0.71743200 -0.39321600 194.87894 0.79771000 -0.59838400 -0.07481200 -143.78100 -0.18162100 -0.35669200 0.91639700 -77.53528 86 'point symmetry operation' ? ? -0.48435500 -0.73942200 -0.46760600 146.29181 0.82578300 -0.56291500 0.03477200 -249.57926 -0.28893400 -0.36929900 0.88325300 -100.61686 87 'point symmetry operation' ? ? -0.42855200 -0.75212600 -0.50065000 281.53845 0.82523300 -0.55144800 0.12204800 -176.49918 -0.36787800 -0.36084900 0.85700300 33.04309 88 'point symmetry operation' ? ? -0.51501100 -0.74499400 -0.42396600 166.35122 0.82962900 -0.55761600 -0.02794500 -186.69296 -0.21559100 -0.36612700 0.90524700 -89.07097 89 'point symmetry operation' ? ? -0.51998400 -0.73805200 -0.42999600 143.05191 0.82982000 -0.55583900 -0.04943100 -218.17503 -0.20252600 -0.38252200 0.90147700 -124.62050 90 'point symmetry operation' ? ? 0.36102000 -0.93007900 -0.06796600 41.66073 0.93137800 0.35593700 0.07644800 -23.47252 -0.04691100 -0.09090200 0.99475400 12.63980 91 'point symmetry operation' ? ? -0.61042900 -0.72026900 -0.32953100 209.48222 0.78067200 -0.61743400 -0.09657800 -229.93212 -0.13390100 -0.31621000 0.93919200 -150.29542 92 'point symmetry operation' ? ? -0.49712500 -0.73713600 -0.45770900 104.03562 0.82904700 -0.55918000 0.00011300 -267.48850 -0.25602500 -0.37940500 0.88910200 -140.98210 93 'point symmetry operation' ? ? -0.80901700 -0.58778500 0.00000100 0.00000 0.58778500 -0.80901700 0.00000000 0.00000 0.00000100 0.00000000 1.00000000 0.00000 94 'point symmetry operation' ? ? -0.94144300 0.33099000 -0.06427300 168.40689 -0.28715100 -0.88698200 -0.36167300 151.25594 -0.17671900 -0.32203900 0.93008700 -51.25065 95 'point symmetry operation' ? ? -0.91558600 0.28593800 -0.28274000 327.40709 -0.13236600 -0.87824000 -0.45953700 82.97909 -0.37971200 -0.38332100 0.84195200 -57.54598 96 'point symmetry operation' ? ? -0.92385100 0.33408900 -0.18677000 189.88368 -0.24182800 -0.88772400 -0.39174600 212.53078 -0.29667800 -0.31674900 0.90091700 19.52346 97 'point symmetry operation' ? ? -0.93513900 0.32515200 -0.14068300 182.31168 -0.24355500 -0.87839100 -0.41122900 187.19926 -0.25728700 -0.35029300 0.90061000 -10.70587 98 'point symmetry operation' ? ? -0.90808300 0.41878800 -0.00065800 124.64619 -0.40209400 -0.87232200 -0.27816400 111.58670 -0.11706600 -0.25233200 0.96053300 -61.87553 99 'point symmetry operation' ? ? -0.88901100 -0.42779000 0.16326200 -62.44204 0.45500300 -0.86529500 0.21032400 -196.48947 0.05129500 0.26126400 0.96390300 -13.03654 100 'point symmetry operation' ? ? -0.93579500 0.35094800 -0.03350100 244.34591 -0.31382500 -0.87254900 -0.37439500 139.37736 -0.16062500 -0.33984400 0.92666400 -112.26380 101 'point symmetry operation' ? ? -0.90702300 -0.39642800 0.14196500 -91.80570 0.42108100 -0.85443400 0.30435700 -255.93362 0.00064500 0.33583700 0.94192000 33.15128 102 'point symmetry operation' ? ? -0.92295000 0.29297100 -0.24966300 334.74885 -0.15426600 -0.87577500 -0.45740600 30.99077 -0.35265600 -0.38364900 0.85349100 -104.03312 103 'point symmetry operation' ? ? -0.91583700 0.40154700 -0.00128300 231.73017 -0.38382000 -0.87633500 -0.29106700 110.17104 -0.11800200 -0.26607800 0.95670200 -127.37024 104 'point symmetry operation' ? ? -0.90682600 0.28166900 -0.31357300 317.80973 -0.11326500 -0.87941400 -0.46238600 135.71933 -0.40600100 -0.38378800 0.82937900 -10.37479 105 'point symmetry operation' ? ? -0.91980200 -0.35004100 0.17729900 93.97071 0.39098200 -0.85576100 0.33883100 -262.33859 0.03312100 0.38097800 0.92399100 -82.65459 106 'point symmetry operation' ? ? -0.92518200 0.37914600 -0.01695300 184.24424 -0.35375900 -0.87768800 -0.32329300 122.85843 -0.13745500 -0.29310800 0.94614700 -88.65575 107 'point symmetry operation' ? ? -0.87677300 0.48081000 0.00951700 301.17830 -0.47637000 -0.86562500 -0.15415700 48.60443 -0.06588200 -0.13969500 0.98800000 -184.68192 108 'point symmetry operation' ? ? -0.89824200 0.43944800 0.00676000 180.12910 -0.42916000 -0.87368800 -0.22911000 82.02749 -0.09477600 -0.20869800 0.97337700 -104.65948 109 'point symmetry operation' ? ? -0.95436700 0.29587800 -0.04049400 269.34553 -0.25655300 -0.88171100 -0.39593800 59.82668 -0.15285400 -0.36748100 0.91738400 -158.24899 110 'point symmetry operation' ? ? -0.95080900 0.30903800 -0.02136900 313.68918 -0.27570100 -0.87565800 -0.39650000 81.05424 -0.14124500 -0.37110500 0.91778600 -183.36480 111 'point symmetry operation' ? ? -0.90687100 0.42135000 0.00697800 286.13693 -0.40898700 -0.87603000 -0.25554100 94.75637 -0.10155900 -0.23459700 0.96677300 -167.52814 112 'point symmetry operation' ? ? -0.87477800 0.47836800 -0.07699400 10.59283 -0.45366100 -0.86445600 -0.21658000 153.86499 -0.17016300 -0.15453100 0.97322400 52.09981 113 'point symmetry operation' ? ? -0.91996800 -0.36264500 0.14881900 -42.28099 0.39199300 -0.85048400 0.35073900 -283.27406 -0.00062600 0.38100400 0.92457300 15.23093 114 'point symmetry operation' ? ? -0.92303600 0.37968900 -0.06196800 124.23095 -0.33956200 -0.87978300 -0.33268400 155.30838 -0.18083500 -0.28603800 0.94100000 -23.59270 115 'point symmetry operation' ? ? -0.88784800 0.46005400 0.00866700 240.52835 -0.45323900 -0.87113500 -0.18893900 62.37568 -0.07937300 -0.17167700 0.98195100 -145.54135 116 'point symmetry operation' ? ? -0.93534900 0.28789800 -0.20551500 269.54955 -0.17315600 -0.87929200 -0.44369200 123.54676 -0.30844600 -0.37942100 0.87229600 -51.24392 117 'point symmetry operation' ? ? -0.92474900 0.37060700 -0.08654400 -2.95422 -0.31585000 -0.87422400 -0.36874300 268.21508 -0.21231800 -0.31366100 0.92549300 92.27240 118 'point symmetry operation' ? ? -0.92069500 0.30676900 -0.24127400 266.30730 -0.17296300 -0.87489700 -0.45236900 178.26082 -0.34986400 -0.37476300 0.85857300 -5.57408 119 'point symmetry operation' ? ? -0.87868900 -0.45776000 0.13550200 -92.85758 0.47467500 -0.86800400 0.14578200 -151.84120 0.05088300 0.19241600 0.97999300 2.22516 120 'point symmetry operation' ? ? -0.94141500 0.31286400 -0.12591000 210.09078 -0.23383600 -0.87457100 -0.42478900 159.29843 -0.24301900 -0.37046100 0.89649400 -42.65367 121 'point symmetry operation' ? ? -0.90998400 -0.37050200 0.18616500 27.94901 0.41183100 -0.85979600 0.30190400 -246.96053 0.04820800 0.35139600 0.93498500 -54.27248 122 'point symmetry operation' ? ? -0.90087700 0.30822100 -0.30564700 249.55200 -0.15834300 -0.88896100 -0.42973900 249.77097 -0.40416300 -0.33874500 0.84964900 70.68390 123 'point symmetry operation' ? ? -0.89171300 0.27788100 -0.35725300 382.07096 -0.08431100 -0.87750300 -0.47210100 42.40741 -0.44467900 -0.39085900 0.80590900 -59.97277 124 'point symmetry operation' ? ? -0.89327500 0.27946900 -0.35207400 317.01909 -0.09341000 -0.88155000 -0.46275800 186.62866 -0.43969800 -0.38048300 0.81357100 38.01260 125 'point symmetry operation' ? ? -0.92030600 0.38994500 0.03129700 -64.74120 -0.38159600 -0.87722000 -0.29132400 200.35905 -0.08614600 -0.28005100 0.95611200 53.24952 126 'point symmetry operation' ? ? -0.91655500 0.38215700 -0.11782300 -14.31728 -0.32714800 -0.88596300 -0.32869800 268.49215 -0.23000200 -0.26272500 0.93705600 113.24887 127 'point symmetry operation' ? ? -0.94415700 0.32879900 -0.02139300 336.64555 -0.29968100 -0.88390500 -0.35903100 107.31712 -0.13695900 -0.33257100 0.93308000 -186.75266 128 'point symmetry operation' ? ? -0.90135800 -0.39098400 0.18624000 -29.51461 0.42917700 -0.86399800 0.26327700 -230.40838 0.05797400 0.31723600 0.94657300 -28.23221 129 'point symmetry operation' ? ? -0.94856900 0.31282700 -0.04853600 236.43824 -0.27054800 -0.88069400 -0.38882200 93.31814 -0.16438000 -0.35569400 0.92003300 -120.24885 130 'point symmetry operation' ? ? -0.95428600 0.29681200 -0.03521700 286.83076 -0.26351500 -0.89107600 -0.36951800 100.23252 -0.14105800 -0.34334600 0.92855600 -153.02233 131 'point symmetry operation' ? ? -0.93636500 0.34739800 -0.05035900 196.96455 -0.30039200 -0.86722800 -0.39708900 140.91004 -0.18162100 -0.35669300 0.91639700 -77.53536 132 'point symmetry operation' ? ? -0.93504000 0.30687000 -0.17756800 282.57037 -0.20546800 -0.87718200 -0.43397400 62.00753 -0.28893300 -0.36930000 0.88325300 -100.61705 133 'point symmetry operation' ? ? -0.91727300 0.29203800 -0.27078300 254.86073 -0.15256600 -0.88572100 -0.43843200 213.21762 -0.36787700 -0.36085000 0.85700300 33.04301 134 'point symmetry operation' ? ? -0.94817100 0.30010800 -0.10443400 228.96068 -0.23343500 -0.88084400 -0.41185100 100.51806 -0.21559100 -0.36612700 0.90524700 -89.07110 135 'point symmetry operation' ? ? -0.94988900 0.30056300 -0.08586400 251.70198 -0.23810500 -0.87369200 -0.42422500 68.63064 -0.20252500 -0.38252300 0.90147600 -124.62066 136 'point symmetry operation' ? ? -0.77423200 -0.62592600 -0.09370800 35.19755 0.63116100 -0.77456600 -0.04101600 32.36828 -0.04691000 -0.09090200 0.99475400 12.63979 137 'point symmetry operation' ? ? -0.93109500 0.36463900 -0.00997800 283.41167 -0.33931100 -0.87581300 -0.34324700 128.17643 -0.13390100 -0.31621000 0.93919200 -150.29557 138 'point symmetry operation' ? ? -0.94209000 0.30402400 -0.14154700 286.54514 -0.21660500 -0.87385400 -0.43527200 16.28527 -0.25602500 -0.37940600 0.88910200 -140.98232 139 'point symmetry operation' ? ? -0.80901700 0.58778500 0.00000100 0.00000 -0.58778500 -0.80901700 0.00000000 0.00000 0.00000100 0.00000000 1.00000000 0.00000 140 'point symmetry operation' ? ? -0.01782600 0.94585100 0.32411000 -91.81230 -0.98410000 0.04069700 -0.17289100 206.90521 -0.17671900 -0.32203900 0.93008700 -51.25065 141 'point symmetry operation' ? ? -0.15704500 0.92361500 0.34967400 22.25665 -0.91167700 0.00055200 -0.41090700 337.02464 -0.37971200 -0.38332100 0.84195200 -57.54598 142 'point symmetry operation' ? ? -0.05549500 0.94751500 0.31485800 -143.45138 -0.95336300 0.04341600 -0.29868600 246.26577 -0.29667800 -0.31674900 0.90091700 19.52346 143 'point symmetry operation' ? ? -0.05734000 0.93587700 0.34763000 -121.69958 -0.96463200 0.03780000 -0.26087500 231.23653 -0.25728700 -0.35029300 0.90061000 -10.70587 144 'point symmetry operation' ? ? 0.10180100 0.95904000 0.26434700 -67.60744 -0.98789300 0.12872900 -0.08658400 153.02784 -0.11706600 -0.25233200 0.96053300 -61.87553 145 'point symmetry operation' ? ? -0.70745300 0.69075000 -0.14957800 167.57688 -0.70489600 -0.67424400 0.22026400 -120.10456 0.05129500 0.26126400 0.96390300 -13.03654 146 'point symmetry operation' ? ? 0.00928800 0.93829200 0.34571900 -57.04867 -0.98697200 0.06413900 -0.14755700 275.45687 -0.16062500 -0.33984400 0.92666400 -112.26380 147 'point symmetry operation' ? ? -0.68075700 0.69011200 -0.24559000 215.03777 -0.73250800 -0.64106100 0.22906800 -166.40037 0.00064500 0.33583700 0.94192000 33.15128 148 'point symmetry operation' ? ? -0.13849200 0.92344400 0.35786900 73.96917 -0.92544800 0.00800300 -0.37879100 327.94182 -0.35265600 -0.38364900 0.85349100 -104.03312 149 'point symmetry operation' ? ? 0.08202400 0.95752800 0.27642500 -33.17031 -0.98962000 0.11109200 -0.09116600 254.43334 -0.11800200 -0.26607800 0.95670200 -127.37024 150 'point symmetry operation' ? ? -0.17250400 0.92341300 0.34285600 -30.86801 -0.89744400 -0.00387100 -0.44111200 344.19462 -0.40600100 -0.38378800 0.82937900 -10.37479 151 'point symmetry operation' ? ? -0.65608000 0.70570800 -0.26745800 278.53731 -0.75396400 -0.59735400 0.27332500 8.30434 0.03312100 0.38097800 0.92399100 -82.65459 152 'point symmetry operation' ? ? 0.05054700 0.95189300 0.30223100 -59.91068 -0.98921700 0.08936800 -0.11602700 213.19213 -0.13745500 -0.29310800 0.94614700 -88.65575 153 'point symmetry operation' ? ? 0.18211700 0.97183700 0.14955300 46.84365 -0.98106700 0.18978400 -0.03858700 301.45734 -0.06588200 -0.13969500 0.98800000 -184.68192 154 'point symmetry operation' ? ? 0.13058300 0.96672300 0.21998600 -22.34982 -0.98689700 0.14795600 -0.06437000 196.66095 -0.09477600 -0.20869800 0.97337700 -104.65948 155 'point symmetry operation' ? ? -0.05092000 0.92998800 0.36404600 26.33380 -0.98693600 0.00893300 -0.16086500 274.65043 -0.15285400 -0.36748100 0.91738400 -158.24899 156 'point symmetry operation' ? ? -0.03161000 0.92829800 0.37049100 19.84813 -0.98947000 0.02331900 -0.14284900 323.38344 -0.14124500 -0.37110500 0.91778600 -183.36480 157 'point symmetry operation' ? ? 0.10873100 0.96335800 0.24519100 -1.69748 -0.98887000 0.13002000 -0.07233100 301.41388 -0.10155900 -0.23459700 0.96677300 -167.52814 158 'point symmetry operation' ? ? 0.16113600 0.96997000 0.18218800 -143.06088 -0.97215200 0.18782300 -0.14015300 57.62129 -0.17016300 -0.15453100 0.97322400 52.09981 159 'point symmetry operation' ? ? -0.65709300 0.69679500 -0.28758400 256.34405 -0.75380900 -0.60771100 0.24991900 -127.74823 -0.00062600 0.38100400 0.92457300 15.23093 160 'point symmetry operation' ? ? 0.03770900 0.95405400 0.29725200 -109.31752 -0.98279000 0.08923800 -0.16174100 166.14365 -0.18083500 -0.28603800 0.94100000 -23.59270 161 'point symmetry operation' ? ? 0.15669500 0.97066300 0.18237000 15.00456 -0.98445200 0.16834200 -0.05014400 248.03133 -0.07937300 -0.17167700 0.98195100 -145.54135 162 'point symmetry operation' ? ? -0.12435800 0.92522200 0.35846900 -34.20447 -0.94307800 0.00209100 -0.33256600 294.53497 -0.30844600 -0.37942100 0.87229600 -51.24392 163 'point symmetry operation' ? ? 0.01462700 0.94596000 0.32395300 -256.00050 -0.97709100 0.08231900 -0.19625700 80.07341 -0.21231800 -0.31366100 0.92549300 92.27240 164 'point symmetry operation' ? ? -0.12001300 0.92687300 0.35567200 -87.24251 -0.92908100 0.02139600 -0.36925600 308.35896 -0.34986400 -0.37476300 0.85857300 -5.57408 165 'point symmetry operation' ? ? -0.72297300 0.68406500 -0.09677400 115.71494 -0.68900000 -0.70358500 0.17391800 -135.23437 0.05088300 0.19241600 0.97999300 2.22516 166 'point symmetry operation' ? ? -0.06852200 0.92844700 0.36509000 -86.58011 -0.96759800 0.02729400 -0.25101600 249.03420 -0.24301900 -0.37046100 0.89649400 -42.65367 167 'point symmetry operation' ? ? -0.67287600 0.70322300 -0.22959900 243.51008 -0.73818300 -0.61806000 0.27034600 -49.73396 0.04820800 0.35139600 0.93498500 -54.27248 168 'point symmetry operation' ? ? -0.12779300 0.94069700 0.31425600 -160.43032 -0.90571500 0.01843100 -0.42348500 314.52153 -0.40416300 -0.33874500 0.84964900 70.68390 169 'point symmetry operation' ? ? -0.19537000 0.92042500 0.33859800 77.73469 -0.87412300 -0.00688300 -0.48565600 376.47571 -0.44467900 -0.39085900 0.80590900 -59.97277 170 'point symmetry operation' ? ? -0.18720000 0.92476400 0.33131200 -79.52994 -0.87842000 -0.00662300 -0.47784400 359.17450 -0.43969800 -0.38048300 0.81357100 38.01260 171 'point symmetry operation' ? ? 0.07852800 0.95478500 0.28673800 -210.55888 -0.99318300 0.09978400 -0.06026000 0.34185 -0.08614600 -0.28005100 0.95611200 53.24952 172 'point symmetry operation' ? ? 0.02790500 0.96069400 0.27620200 -259.77539 -0.97279000 0.08967500 -0.21363100 69.35210 -0.23000200 -0.26272500 0.93705600 113.24887 173 'point symmetry operation' ? ? -0.00674700 0.94224800 0.33484900 1.96457 -0.99055300 0.03956500 -0.13129400 353.33193 -0.13695900 -0.33257100 0.93308000 -186.75266 174 'point symmetry operation' ? ? -0.68670700 0.70089000 -0.19283900 210.01081 -0.72461900 -0.63883900 0.25848100 -99.27023 0.05797400 0.31723600 0.94657300 -28.23221 175 'point symmetry operation' ? ? -0.03581800 0.93425800 0.35479400 -15.68737 -0.98574600 0.02536700 -0.16631400 253.70315 -0.16438000 -0.35569400 0.92003300 -120.24885 176 'point symmetry operation' ? ? -0.04427300 0.93918300 0.34055100 -6.69119 -0.98901100 0.00692700 -0.14768100 303.76596 -0.14105800 -0.34334600 0.92855600 -153.02233 177 'point symmetry operation' ? ? -0.00366400 0.93213500 0.36209300 -73.14797 -0.98336200 0.06240600 -0.17060200 230.86812 -0.18162100 -0.35669300 0.91639700 -77.53536 178 'point symmetry operation' ? ? -0.09353200 0.92907800 0.35786300 28.34643 -0.95276900 0.02078600 -0.30298300 287.90185 -0.28893300 -0.36930000 0.88325300 -100.61705 179 'point symmetry operation' ? ? -0.13835500 0.93261500 0.33329700 -124.02556 -0.91952400 0.00404200 -0.39301300 308.27484 -0.36787700 -0.36085000 0.85700300 33.04301 180 'point symmetry operation' ? ? -0.07099100 0.93047100 0.35942200 -24.84558 -0.97390000 0.01322400 -0.22659300 248.81643 -0.21559100 -0.36612700 0.90524700 -89.07110 181 'point symmetry operation' ? ? -0.06708100 0.92381000 0.37692900 12.50860 -0.97697700 0.01586600 -0.21275500 260.59095 -0.20252500 -0.38252300 0.90147600 -124.62066 182 'point symmetry operation' ? ? -0.83952100 0.54323400 0.01005200 -19.90740 -0.54129800 -0.83464600 -0.10179800 43.47721 -0.04691000 -0.09090200 0.99475400 12.63979 183 'point symmetry operation' ? ? 0.03497900 0.94562800 0.32336400 -34.32399 -0.99037700 0.07615100 -0.11556000 309.14937 -0.13390100 -0.31621000 0.93919200 -150.29557 184 'point symmetry operation' ? ? -0.08511900 0.92503300 0.37022800 73.05912 -0.96291500 0.01910800 -0.26912600 277.55315 -0.25602500 -0.37940600 0.88910200 -140.98232 185 'point symmetry operation' ? ? 0.30901700 0.95105700 0.00000000 0.00000 -0.95105700 0.30901700 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 186 'point symmetry operation' ? ? 0.93042700 0.25357900 0.26458400 -225.15023 -0.32105700 0.91213500 0.25482000 -23.38144 -0.17672000 -0.32203800 0.93008700 -51.25060 187 'point symmetry operation' ? ? 0.81852700 0.28488800 0.49885100 -313.65198 -0.43108200 0.87858100 0.20558200 125.31379 -0.37971300 -0.38332000 0.84195200 -57.54576 188 'point symmetry operation' ? ? 0.88955400 0.25150800 0.38136300 -278.54175 -0.34738400 0.91455700 0.20714800 -60.33014 -0.29667900 -0.31674900 0.90091700 19.52349 189 'point symmetry operation' ? ? 0.89970100 0.25325200 0.35553000 -257.52640 -0.35262100 0.90175400 0.25000000 -44.28720 -0.25728700 -0.35029200 0.90061000 -10.70583 190 'point symmetry operation' ? ? 0.97100000 0.17393100 0.16403400 -166.43006 -0.20845700 0.95188100 0.22465200 -17.01026 -0.11706600 -0.25233100 0.96053300 -61.87549 191 'point symmetry operation' ? ? 0.45178100 0.85469800 -0.25570600 166.01042 -0.89065400 0.44858900 -0.07419300 122.26083 0.05129400 0.26126400 0.96390300 -13.03648 192 'point symmetry operation' ? ? 0.94153700 0.22894900 0.24716800 -279.60420 -0.29615700 0.91218900 0.28320000 30.86446 -0.16062500 -0.33984300 0.92666400 -112.26368 193 'point symmetry operation' ? ? 0.48629200 0.82294200 -0.29374800 224.70660 -0.87379700 0.45823700 -0.16278500 153.09261 0.00064400 0.33583700 0.94192000 33.15136 194 'point symmetry operation' ? ? 0.83735700 0.27774900 0.47083900 -289.03363 -0.41769300 0.88072100 0.22330100 171.68865 -0.35265600 -0.38364800 0.85349100 -104.03287 195 'point symmetry operation' ? ? 0.96653200 0.19023800 0.17212400 -252.23080 -0.22779900 0.94499400 0.23472300 47.07752 -0.11800300 -0.26607700 0.95670200 -127.37012 196 'point symmetry operation' ? ? 0.80021400 0.28903200 0.52547100 -336.88748 -0.44138600 0.87702300 0.18976400 77.00480 -0.40600200 -0.38378700 0.82937900 -10.37461 197 'point symmetry operation' ? ? 0.51432200 0.78619400 -0.34259700 78.17493 -0.85695800 0.48657600 -0.16990700 267.47115 0.03312000 0.38097800 0.92399100 -82.65436 198 'point symmetry operation' ? ? 0.95642200 0.20915700 0.20374300 -221.27130 -0.25761200 0.93292100 0.25158400 8.90162 -0.13745500 -0.29310700 0.94614700 -88.65567 199 'point symmetry operation' ? ? 0.98932800 0.11981800 0.08291200 -272.22760 -0.12996300 0.98291900 0.13030900 137.70664 -0.06588300 -0.13969400 0.98800100 -184.68170 200 'point symmetry operation' ? ? 0.97894800 0.15802000 0.12919900 -193.94224 -0.18077600 0.96513000 0.18932700 39.51575 -0.09477600 -0.20869700 0.97337700 -104.65938 201 'point symmetry operation' ? ? 0.92289700 0.27888600 0.26548800 -253.07060 -0.35340700 0.88723200 0.29651800 109.91678 -0.15285500 -0.36748100 0.91738400 -158.24881 202 'point symmetry operation' ? ? 0.93127400 0.26468200 0.25034500 -301.42265 -0.33582600 0.89007100 0.30821400 118.80790 -0.14124600 -0.37110400 0.91778600 -183.36459 203 'point symmetry operation' ? ? 0.97407100 0.17403800 0.14455800 -287.18631 -0.20216800 0.95638700 0.21083800 91.52780 -0.10156000 -0.23459600 0.96677300 -167.52796 204 'point symmetry operation' ? ? 0.97436600 0.12110700 0.18959300 -99.00941 -0.14716200 0.98053800 0.12996100 -118.25315 -0.17016400 -0.15453000 0.97322400 52.09973 205 'point symmetry operation' ? ? 0.51386200 0.79328900 -0.32655600 200.71056 -0.85787300 0.47489800 -0.19628100 204.32143 -0.00062700 0.38100400 0.92457300 15.23106 206 'point symmetry operation' ? ? 0.94634200 0.20994900 0.24568100 -191.79308 -0.26783600 0.93493600 0.23272300 -52.62595 -0.18083600 -0.28603700 0.94100000 -23.59269 207 'point symmetry operation' ? ? 0.98469200 0.13984900 0.10404500 -231.25525 -0.15518700 0.97517700 0.15794800 90.91626 -0.07937300 -0.17167700 0.98195100 -145.54119 208 'point symmetry operation' ? ? 0.85849200 0.28392000 0.42706200 -290.68933 -0.40969800 0.88058500 0.23815500 58.48599 -0.30844700 -0.37942000 0.87229600 -51.24377 209 'point symmetry operation' ? ? 0.93378900 0.21402800 0.28675800 -155.26295 -0.28802600 0.92510000 0.24745000 -218.72713 -0.21231900 -0.31366000 0.92549400 92.27224 210 'point symmetry operation' ? ? 0.84652300 0.26607100 0.46109200 -320.22641 -0.40124100 0.88812200 0.22415700 12.31559 -0.34986400 -0.37476300 0.85857300 -5.57397 211 'point symmetry operation' ? ? 0.43186700 0.88053700 -0.19531100 164.37351 -0.90050100 0.43316500 -0.03829500 68.26178 0.05088200 0.19241600 0.97999300 2.22517 212 'point symmetry operation' ? ? 0.89906600 0.26094800 0.35154900 -263.60047 -0.36417300 0.89144100 0.26965300 -5.38676 -0.24302000 -0.37046000 0.89649400 -42.65359 213 'point symmetry operation' ? ? 0.49412400 0.80511900 -0.32806500 122.54864 -0.86805400 0.47781300 -0.13482100 216.22340 0.04820700 0.35139600 0.93498500 -54.27231 214 'point symmetry operation' ? ? 0.82189700 0.27316200 0.49986900 -348.70367 -0.40142000 0.90035300 0.16801100 -55.38593 -0.40416400 -0.33874400 0.84964900 70.68396 215 'point symmetry operation' ? ? 0.77096800 0.29097300 0.56651900 -334.02853 -0.45592700 0.87325000 0.17194900 190.26763 -0.44468000 -0.39085800 0.80590900 -59.97249 216 'point symmetry operation' ? ? 0.77758000 0.29206700 0.55683700 -366.17159 -0.44948400 0.87745700 0.16743400 35.35352 -0.43969900 -0.38048300 0.81357100 38.01275 217 'point symmetry operation' ? ? 0.96884000 0.20014500 0.14591700 -65.39143 -0.23222500 0.93889000 0.25408200 -200.14793 -0.08614700 -0.28005000 0.95611200 53.24935 218 'point symmetry operation' ? ? 0.93380200 0.21158500 0.28852600 -146.23289 -0.27407000 0.94138700 0.19666700 -225.63035 -0.23000300 -0.26272400 0.93705600 113.24870 219 'point symmetry operation' ? ? 0.93998800 0.25354200 0.22834200 -335.43171 -0.31251500 0.90835800 0.27788700 111.05421 -0.13696000 -0.33257000 0.93308000 -186.75245 220 'point symmetry operation' ? ? 0.47694900 0.82415900 -0.30542100 159.30860 -0.87701700 0.46917400 -0.10352600 169.05610 0.05797300 0.31723600 0.94657300 -28.23210 221 'point symmetry operation' ? ? 0.92643300 0.26457600 0.26781100 -246.13381 -0.33867700 0.89637200 0.28603400 63.47914 -0.16438100 -0.35569300 0.92003400 -120.24871 222 'point symmetry operation' ? ? 0.92692400 0.28363500 0.24568900 -290.96642 -0.34772800 0.89535800 0.27824600 87.50532 -0.14105900 -0.34334600 0.92855600 -153.02216 223 'point symmetry operation' ? ? 0.93410100 0.22869400 0.27414500 -242.17272 -0.30736000 0.90579800 0.29165100 1.77438 -0.18162100 -0.35669200 0.91639700 -77.53528 224 'point symmetry operation' ? ? 0.87723500 0.26733200 0.39874000 -265.05154 -0.38337600 0.89003000 0.24672000 115.92577 -0.28893400 -0.36929900 0.88325300 -100.61686 225 'point symmetry operation' ? ? 0.83176600 0.28435000 0.47677300 -331.51301 -0.41573200 0.88821900 0.19553600 -22.69322 -0.36787800 -0.36084900 0.85700300 33.04309 226 'point symmetry operation' ? ? 0.90429700 0.27495500 0.32657000 -244.31632 -0.36846800 0.88901700 0.27180900 53.25906 -0.21559100 -0.36612700 0.90524700 -89.07097 227 'point symmetry operation' ? ? 0.90843200 0.27038300 0.31882000 -243.97147 -0.36570000 0.88349900 0.29273500 92.42358 -0.20252600 -0.38252200 0.90147700 -124.62050 228 'point symmetry operation' ? ? 0.25537900 0.96166400 0.09992100 -47.50104 -0.96570300 0.25872700 -0.02189800 -5.49788 -0.04691100 -0.09090200 0.99475400 12.63980 229 'point symmetry operation' ? ? 0.95271400 0.21979100 0.20982900 -304.62536 -0.27277600 0.92287800 0.27182700 62.88852 -0.13390100 -0.31621000 0.93919200 -150.29542 230 'point symmetry operation' ? ? 0.88948400 0.26767800 0.37036100 -241.39233 -0.37851000 0.88566400 0.26894300 155.25221 -0.25602500 -0.37940500 0.88910200 -140.98210 231 'point symmetry operation' ? ? -0.94721300 -0.16246000 0.27639400 0.00000 -0.16246000 -0.50000000 -0.85065100 0.00000 0.27639400 -0.85065100 0.44721300 0.00000 232 'point symmetry operation' ? ? -0.73805000 0.57349400 0.35550800 66.63538 -0.33882800 0.14062800 -0.93028000 161.96481 -0.58350400 -0.80704900 0.09052500 152.29259 233 'point symmetry operation' ? ? -0.83770600 0.51401200 0.18449600 230.96217 -0.10732200 0.17629700 -0.97846900 213.84793 -0.53547100 -0.83947100 -0.09252100 135.34397 234 'point symmetry operation' ? ? -0.77532300 0.57794300 0.25466800 78.64391 -0.21529600 0.13721700 -0.96686100 129.83032 -0.59373500 -0.80445800 0.01804100 242.00323 235 'point symmetry operation' ? ? -0.77342800 0.55700000 0.30258800 74.53728 -0.25413900 0.16483400 -0.95301800 144.49650 -0.58070800 -0.81399000 0.01406800 204.84316 236 'point symmetry operation' ? ? -0.64392500 0.66219100 0.38322800 42.85794 -0.41090200 0.12320500 -0.90331600 140.13187 -0.64538300 -0.73913700 0.19276100 101.70117 237 'point symmetry operation' ? ? -0.94549900 0.07157200 0.31766000 26.15590 -0.28114900 -0.67158600 -0.68551300 -76.18729 0.16427300 -0.73746200 0.65510600 -190.23268 238 'point symmetry operation' ? ? -0.71739000 0.57963400 0.38649200 120.26853 -0.35835900 0.16872300 -0.91821100 242.49379 -0.59743700 -0.79721800 0.08667700 135.89121 239 'point symmetry operation' ? ? -0.96059300 0.11459200 0.25323600 38.89928 -0.25620600 -0.71832600 -0.64681300 -146.33541 0.10778700 -0.68620500 0.71937800 -228.25905 240 'point symmetry operation' ? ? -0.82726000 0.51893400 0.21528500 246.55252 -0.14023700 0.18033000 -0.97355800 240.44962 -0.54403500 -0.83557700 -0.07640600 72.35961 241 'point symmetry operation' ? ? -0.65863900 0.64524000 0.38711800 117.64310 -0.40775700 0.12632500 -0.90431000 240.95306 -0.63240000 -0.75346400 0.17989800 100.80412 242 'point symmetry operation' ? ? -0.84554700 0.51070400 0.15566100 213.29718 -0.07533100 0.17451600 -0.98176900 185.93735 -0.52855800 -0.84185800 -0.10909000 198.65045 243 'point symmetry operation' ? ? -0.94982900 0.16761000 0.26406800 169.71827 -0.29856900 -0.73740500 -0.60588000 29.21110 0.09317400 -0.65432500 0.75045200 -234.15002 244 'point symmetry operation' ? ? -0.68485400 0.61903900 0.38440300 82.02372 -0.38589400 0.13937100 -0.91195500 191.74420 -0.61811000 -0.77289500 0.14343400 115.78551 245 'point symmetry operation' ? ? -0.57120300 0.74392500 0.34684500 187.83900 -0.46407700 0.05583900 -0.88403300 300.21817 -0.67702200 -0.66592600 0.31334300 41.99687 246 'point symmetry operation' ? ? -0.61777100 0.69263700 0.37230700 91.42038 -0.43404100 0.09445300 -0.89592800 190.99005 -0.65571800 -0.71507600 0.24228200 72.75815 247 'point symmetry operation' ? ? -0.75560600 0.52843300 0.38706300 162.93819 -0.35517000 0.16597900 -0.91994900 267.66157 -0.55037600 -0.83259200 0.06226800 54.56588 248 'point symmetry operation' ? ? -0.74118800 0.53619800 0.40389500 185.18325 -0.36944900 0.17652900 -0.91233000 314.44650 -0.56048900 -0.82542600 0.06725600 73.64729 249 'point symmetry operation' ? ? -0.63566200 0.67087700 0.38191100 159.98791 -0.42570700 0.10806200 -0.89838500 293.49057 -0.64397700 -0.73365200 0.21690600 84.77014 250 'point symmetry operation' ? ? -0.60796500 0.73722200 0.29475600 -41.91366 -0.36750400 0.06778200 -0.92754900 7.73360 -0.70378900 -0.67224200 0.22972300 157.11295 251 'point symmetry operation' ? ? -0.95972900 0.15451000 0.23462000 88.25536 -0.26962000 -0.74115800 -0.61480900 -118.47602 0.07889700 -0.65330800 0.75297000 -245.84216 252 'point symmetry operation' ? ? -0.70103300 0.62235200 0.34818100 34.48527 -0.34369300 0.13294100 -0.92962500 120.90069 -0.62484200 -0.77136500 0.12070200 155.89888 253 'point symmetry operation' ? ? -0.59431500 0.71954200 0.35923400 140.53160 -0.45016400 0.07251400 -0.88999700 245.38281 -0.66643900 -0.69065300 0.28081500 54.45234 254 'point symmetry operation' ? ? -0.81769200 0.51722700 0.25269600 165.58774 -0.18895500 0.17348900 -0.96653900 196.41495 -0.54376000 -0.83808000 -0.04412800 156.67987 255 'point symmetry operation' ? ? -0.72129600 0.60452600 0.33805200 -91.12107 -0.31031300 0.15429400 -0.93803000 3.13501 -0.61922300 -0.78149900 0.07630000 268.60638 256 'point symmetry operation' ? ? -0.81659200 0.53290800 0.22177700 152.14513 -0.14743100 0.17891100 -0.97275700 173.09443 -0.55806800 -0.82704300 -0.06753000 222.75045 257 'point symmetry operation' ? ? -0.94508500 0.02786700 0.32563500 -14.82811 -0.27032900 -0.62660400 -0.73095100 -88.30906 0.18367500 -0.77884000 0.59972700 -153.83398 258 'point symmetry operation' ? ? -0.77902700 0.53921200 0.31994800 101.51417 -0.26594200 0.17794400 -0.94742300 174.86623 -0.56779500 -0.82315700 0.00477600 174.49976 259 'point symmetry operation' ? ? -0.94606500 0.14351600 0.29045400 114.12449 -0.30078400 -0.72219100 -0.62287200 -18.26077 0.12037100 -0.67664200 0.72640700 -226.62374 260 'point symmetry operation' ? ? -0.82073900 0.55009600 0.15420800 128.36749 -0.08829400 0.14454300 -0.98555100 123.19691 -0.56443800 -0.82249700 -0.07006300 313.05315 261 'point symmetry operation' ? ? -0.85552800 0.50467200 0.11566200 294.65707 -0.02705400 0.17951100 -0.98338400 226.62482 -0.51704900 -0.84444200 -0.13992300 114.85503 262 'point symmetry operation' ? ? -0.85162700 0.51062900 0.11826900 204.33674 -0.03476800 0.17010900 -0.98481200 160.17215 -0.52299300 -0.84280500 -0.12711700 263.37747 263 'point symmetry operation' ? ? -0.65463100 0.63175500 0.41514200 -126.29410 -0.43606800 0.13300300 -0.89003100 -10.91836 -0.61749700 -0.76367300 0.18842000 176.35556 264 'point symmetry operation' ? ? -0.71431700 0.63355200 0.29725900 -95.23389 -0.29527600 0.11225000 -0.94879500 -19.45602 -0.63447800 -0.76551400 0.10689000 275.08235 265 'point symmetry operation' ? ? -0.72407100 0.56738700 0.39216500 192.86049 -0.37767600 0.14960700 -0.91377200 335.20800 -0.57713300 -0.80974700 0.10596200 100.81773 266 'point symmetry operation' ? ? -0.94330900 0.11821000 0.31015100 64.75945 -0.30006200 -0.70314300 -0.64463400 -59.73775 0.14187800 -0.70115400 0.69875200 -216.78063 267 'point symmetry operation' ? ? -0.74784300 0.54586500 0.37783800 130.83680 -0.34722400 0.16347500 -0.92342400 231.68985 -0.56583200 -0.82177100 0.06728400 90.95424 268 'point symmetry operation' ? ? -0.74931500 0.53989200 0.38346200 162.26602 -0.36732100 0.14295200 -0.91904300 283.13852 -0.55100000 -0.82950700 0.09119700 96.10738 269 'point symmetry operation' ? ? -0.72939700 0.56965500 0.37877800 88.38193 -0.33658900 0.18319000 -0.92366100 193.27315 -0.59555600 -0.80120800 0.05812200 139.63012 270 'point symmetry operation' ? ? -0.79828900 0.53547700 0.27567700 189.33690 -0.21540800 0.17360000 -0.96097000 224.93565 -0.56243500 -0.82651500 -0.02323700 85.85000 271 'point symmetry operation' ? ? -0.82729800 0.52866200 0.18998400 138.08593 -0.12434900 0.15746600 -0.97966400 146.17850 -0.54782700 -0.83409900 -0.06453300 266.59280 272 'point symmetry operation' ? ? -0.77743900 0.53208400 0.33537300 129.94762 -0.29202400 0.16689400 -0.94173700 204.21296 -0.55705500 -0.83008000 0.02563100 108.95520 273 'point symmetry operation' ? ? -0.77332200 0.52490300 0.35559800 153.28301 -0.30531200 0.18324400 -0.93445500 234.27192 -0.55565900 -0.83120300 0.01855200 72.21743 274 'point symmetry operation' ? ? -0.94865000 -0.23510800 0.21163000 20.05988 -0.09435600 -0.42825100 -0.89872000 14.22070 0.30192700 -0.87254000 0.38407600 42.91515 275 'point symmetry operation' ? ? -0.69511300 0.59935400 0.39697800 148.18785 -0.38696800 0.15343300 -0.90923800 287.99993 -0.60586600 -0.78564100 0.12527700 120.15234 276 'point symmetry operation' ? ? -0.79053300 0.52881500 0.30888800 201.05251 -0.24984100 0.18201500 -0.95102600 246.83401 -0.55914000 -0.82899000 -0.01176900 30.00304 277 'point symmetry operation' ? ? -0.44721400 0.85065100 0.27639400 0.00000 -0.52573200 0.00000000 -0.85065100 0.00000 -0.72360600 -0.52573200 0.44721400 0.00000 278 'point symmetry operation' ? ? 0.35435700 0.70882000 0.60992400 -181.29159 -0.16135900 0.68881300 -0.70675400 68.48354 -0.92108400 0.15202500 0.35845900 127.70797 279 'point symmetry operation' ? ? 0.14746800 0.68979300 0.70883000 -140.06958 -0.02551600 0.71908000 -0.69446000 162.56423 -0.98873800 0.08432300 0.12364100 267.10670 280 'point symmetry operation' ? ? 0.27566400 0.71055900 0.64739200 -222.97393 -0.06583900 0.68586200 -0.72474800 -1.52090 -0.95899700 0.15716300 0.23585000 178.56858 281 'point symmetry operation' ? ? 0.28975500 0.69364700 0.65946800 -206.19100 -0.10361400 0.70771100 -0.69886400 28.80103 -0.95147600 0.13416800 0.27693400 158.27700 282 'point symmetry operation' ? ? 0.47555200 0.70201000 0.53012600 -140.45297 -0.16239500 0.66233000 -0.73140100 71.16753 -0.86456900 0.26172900 0.42897400 83.81557 283 'point symmetry operation' ? ? -0.29569900 0.95427600 0.04382500 191.89875 -0.56235700 -0.13680400 -0.81550000 45.24994 -0.77221600 -0.26578800 0.57709600 -61.68022 284 'point symmetry operation' ? ? 0.38339300 0.68741300 0.61682500 -197.35252 -0.16440500 0.70798800 -0.68682200 156.35395 -0.90883500 0.16191400 0.38445100 168.34403 285 'point symmetry operation' ? ? -0.27494700 0.96022400 -0.04873800 265.25753 -0.51644900 -0.19025700 -0.83491500 11.84034 -0.81097700 -0.20438700 0.54821700 -67.28814 286 'point symmetry operation' ? ? 0.17679100 0.68638600 0.70542200 -104.48909 -0.04489600 0.72158900 -0.69086500 221.29649 -0.98322400 0.09046800 0.15838700 252.88366 287 'point symmetry operation' ? ? 0.45898400 0.70441000 0.54142600 -172.00753 -0.17054300 0.66793000 -0.72442100 172.86372 -0.87192300 0.24016000 0.42670100 150.30433 288 'point symmetry operation' ? ? 0.12082500 0.69137100 0.71232600 -175.86441 -0.00533000 0.71802400 -0.69599800 102.05835 -0.99266000 0.08029700 0.09044000 279.61819 289 'point symmetry operation' ? ? -0.23557900 0.96755200 -0.09136400 213.66739 -0.54021000 -0.20851600 -0.81528900 191.34547 -0.80788400 -0.14270900 0.57180200 47.08548 290 'point symmetry operation' ? ? 0.42630900 0.70132200 0.57132200 -166.81114 -0.16726000 0.68181300 -0.71214900 115.81358 -0.88898000 0.20803600 0.40796600 125.14525 291 'point symmetry operation' ? ? 0.55601200 0.71820200 0.41837400 -138.89223 -0.16966500 0.59082500 -0.78875900 270.17917 -0.81367400 0.36757600 0.45035900 186.79005 292 'point symmetry operation' ? ? 0.50609400 0.71251400 0.48599800 -131.83322 -0.16880600 0.63442200 -0.75433000 140.29436 -0.84579800 0.29972100 0.44135300 114.30743 293 'point symmetry operation' ? ? 0.33363800 0.69609800 0.63571500 -137.86016 -0.19661200 0.71090700 -0.67524600 230.68681 -0.92197100 0.10029800 0.37404600 170.13911 294 'point symmetry operation' ? ? 0.35456600 0.68752200 0.63371800 -171.11876 -0.19905700 0.71771600 -0.66727900 264.35242 -0.91359700 0.11044800 0.39133300 198.56920 295 'point symmetry operation' ? ? 0.48622600 0.71008400 0.50928000 -175.96550 -0.17294000 0.64947900 -0.74045200 234.92807 -0.85654900 0.27195200 0.43859500 181.00808 296 'point symmetry operation' ? ? 0.50531600 0.71332700 0.48561400 -133.39822 -0.08712700 0.60204600 -0.79369500 -87.36027 -0.85852500 0.35875600 0.36637300 32.77441 297 'point symmetry operation' ? ? -0.24584500 0.96428300 -0.09859300 279.46264 -0.51188600 -0.21553000 -0.83157700 56.59710 -0.82312400 -0.15397100 0.54658900 -31.00612 298 'point symmetry operation' ? ? 0.40052100 0.70519400 0.58505200 -171.39626 -0.13383300 0.67667800 -0.72401500 24.91484 -0.90646100 0.21168400 0.36540100 100.56480 299 'point symmetry operation' ? ? 0.53181500 0.71747100 0.44989900 -132.78967 -0.17004800 0.61090600 -0.77322600 206.83267 -0.82961300 0.33470800 0.44689300 150.04726 300 'point symmetry operation' ? ? 0.20869000 0.69160100 0.69147500 -168.91423 -0.08194000 0.71692200 -0.69232300 120.05898 -0.97454300 0.08782100 0.20628400 218.17574 301 'point symmetry operation' ? ? 0.36950400 0.69352600 0.61845700 -229.17608 -0.11510800 0.69459500 -0.71013400 -162.63116 -0.92207200 0.19120700 0.33648500 38.62339 302 'point symmetry operation' ? ? 0.19503400 0.68610100 0.70087700 -207.87949 -0.04053500 0.71962800 -0.69317700 62.92328 -0.97995900 0.10678300 0.16816200 235.69998 303 'point symmetry operation' ? ? -0.31594800 0.94196500 0.11349200 157.85724 -0.56369500 -0.09014800 -0.82104900 5.53397 -0.76316800 -0.32338400 0.55946300 -82.05943 304 'point symmetry operation' ? ? 0.28532200 0.68613800 0.66918400 -192.32485 -0.12142400 0.71845900 -0.68488900 76.41446 -0.95070900 0.11415900 0.28830600 168.83588 305 'point symmetry operation' ? ? -0.25259500 0.96604000 -0.05443100 216.01056 -0.55531000 -0.19080800 -0.80945900 134.36938 -0.79235500 -0.17423900 0.58464900 0.72673 306 'point symmetry operation' ? ? 0.16338300 0.70923100 0.68578300 -252.49695 0.00956700 0.69395200 -0.71995800 -31.16999 -0.98651700 0.12418900 0.10659500 254.81723 307 'point symmetry operation' ? ? 0.08050900 0.68812200 0.72111500 -109.70867 0.02505300 0.72183800 -0.69160900 200.41586 -0.99643900 0.07374600 0.04087500 314.91423 308 'point symmetry operation' ? ? 0.09075500 0.69461900 0.71363100 -210.79884 0.02296200 0.71493800 -0.69881200 44.82942 -0.99560900 0.07980700 0.04893400 300.55055 309 'point symmetry operation' ? ? 0.46629200 0.70299300 0.53700500 -166.88810 -0.20023000 0.67515500 -0.70998200 -134.74722 -0.86167300 0.22353400 0.45557900 -34.09221 310 'point symmetry operation' ? ? 0.37422900 0.71717400 0.58789100 -222.07149 -0.09308800 0.65980600 -0.74564800 -185.39345 -0.92265200 0.22431700 0.31367900 37.84091 311 'point symmetry operation' ? ? 0.37763800 0.70328400 0.60231400 -200.20513 -0.19246300 0.69589100 -0.69187800 268.88256 -0.90573100 0.14535600 0.39815000 217.58694 312 'point symmetry operation' ? ? -0.26758500 0.96342600 -0.01450200 215.40714 -0.56531000 -0.16916300 -0.80734800 82.66255 -0.78027200 -0.20783600 0.58989900 -39.02475 313 'point symmetry operation' ? ? 0.34296100 0.69604700 0.63079100 -154.66179 -0.18001700 0.70777400 -0.68311900 174.01619 -0.92193900 0.12073000 0.36803900 157.70012 314 'point symmetry operation' ? ? 0.34350900 0.71154700 0.61294700 -177.26020 -0.20446000 0.69366700 -0.69066800 221.19157 -0.91662300 0.11192700 0.38376300 188.11585 315 'point symmetry operation' ? ? 0.36489300 0.67818700 0.63790000 -182.66354 -0.15093800 0.71916700 -0.67824600 106.18603 -0.91873400 0.15120300 0.36478200 141.49585 316 'point symmetry operation' ? ? 0.24477100 0.68977000 0.68139900 -125.83276 -0.08842200 0.71572900 -0.69275900 186.61306 -0.96554100 0.10931600 0.23618000 207.74153 317 'point symmetry operation' ? ? 0.17018300 0.70227600 0.69126500 -228.86999 -0.03005900 0.70487200 -0.70869900 14.40284 -0.98495400 0.09982900 0.14106700 242.73196 318 'point symmetry operation' ? ? 0.29345600 0.69506400 0.65633100 -151.85861 -0.14775300 0.71128600 -0.68719900 142.08950 -0.94448600 0.10468700 0.31142900 164.95509 319 'point symmetry operation' ? ? 0.30174600 0.68366800 0.66449100 -134.50029 -0.15815500 0.72321600 -0.67227000 191.85600 -0.94017900 0.09776100 0.32635300 169.39727 320 'point symmetry operation' ? ? -0.50624100 0.79803300 0.32690300 -32.15469 -0.48443600 0.05045700 -0.87337100 -5.78399 -0.71347200 -0.60049900 0.36105200 37.13438 321 'point symmetry operation' ? ? 0.41436900 0.69515800 0.58741300 -202.61030 -0.17726300 0.69471600 -0.69710000 208.78268 -0.89268000 0.18472900 0.41109400 186.27720 322 'point symmetry operation' ? ? 0.26543300 0.68420500 0.67927200 -94.05430 -0.11597300 0.72208700 -0.68201300 236.76936 -0.95712900 0.10225100 0.27101400 193.24475 323 'point symmetry operation' ? ? 0.67082000 0.68819100 0.27639300 0.00000 -0.16246000 0.50000000 -0.85065100 0.00000 -0.72360700 0.52573100 0.44721400 0.00000 324 'point symmetry operation' ? ? 0.88955400 -0.25842800 0.37670800 -198.25571 0.44684900 0.66366000 -0.59990100 -59.39095 -0.09497500 0.70197600 0.70584000 -105.03938 325 'point symmetry operation' ? ? 0.78380900 -0.23411200 0.57518200 -339.51050 0.53793200 0.71873800 -0.44050500 -45.72865 -0.31027800 0.65468100 0.68929100 -5.82825 326 'point symmetry operation' ? ? 0.83237100 -0.25978100 0.48956200 -208.99201 0.52337300 0.65902900 -0.54015000 -153.72154 -0.18231500 0.70582900 0.68452000 -119.57568 327 'point symmetry operation' ? ? 0.85423100 -0.26210300 0.44898800 -206.05955 0.49256200 0.68434800 -0.53763500 -114.11104 -0.16634800 0.68041900 0.71369400 -113.63923 328 'point symmetry operation' ? ? 0.89311700 -0.32470700 0.31129900 -153.29697 0.44815700 0.58277000 -0.67789000 -23.40891 0.03870000 0.74494600 0.66600200 -88.14148 329 'point symmetry operation' ? ? 0.78234100 0.61799700 0.07760400 87.46448 -0.12670700 0.27990200 -0.95163100 119.47858 -0.60982600 0.73466700 0.29728300 144.05527 330 'point symmetry operation' ? ? 0.89298600 -0.28459800 0.34868100 -285.12001 0.44557800 0.66834800 -0.59562700 -13.88786 -0.06352600 0.68725200 0.72363700 -101.23167 331 'point symmetry operation' ? ? 0.79091300 0.60713700 0.07642400 137.70148 -0.06373300 0.20594100 -0.97648700 114.68135 -0.60860000 0.76744600 0.20157700 207.16140 332 'point symmetry operation' ? ? 0.80182000 -0.24126600 0.54669400 -350.86743 0.52706200 0.71664200 -0.45676000 18.61708 -0.28158400 0.65438100 0.70178100 19.63520 333 'point symmetry operation' ? ? 0.89723400 -0.31152400 0.31292900 -272.60068 0.44107600 0.59927100 -0.66807700 15.61516 0.02059200 0.73744700 0.67509200 -86.63001 334 'point symmetry operation' ? ? 0.76514300 -0.23000700 0.60137600 -325.95013 0.54932100 0.72041600 -0.42337600 -110.66578 -0.33586100 0.65429100 0.67756900 -32.24885 335 'point symmetry operation' ? ? 0.81688400 0.57589100 0.03239900 -69.23587 -0.07423400 0.16066900 -0.98421300 186.21290 -0.57200500 0.80158300 0.17399900 212.16730 336 'point symmetry operation' ? ? 0.89582400 -0.29755500 0.33008900 -218.98212 0.44411000 0.62658000 -0.64044000 -15.94647 -0.01626100 0.72031800 0.69345300 -93.23373 337 'point symmetry operation' ? ? 0.88967300 -0.35341100 0.28910700 -344.22132 0.43666800 0.47353100 -0.76491100 83.86810 0.13342700 0.80676500 0.57561100 -40.69383 338 'point symmetry operation' ? ? 0.89435300 -0.33199500 0.29985300 -212.87413 0.44113000 0.54298000 -0.71454700 18.75112 0.07441200 0.77133200 0.63206900 -66.79533 339 'point symmetry operation' ? ? 0.90342100 -0.23858600 0.35624000 -308.58618 0.41334900 0.70538500 -0.57582600 60.94335 -0.11390200 0.66746400 0.73587900 -47.21727 340 'point symmetry operation' ? ? 0.90637000 -0.25303600 0.33832700 -360.97956 0.41247000 0.70330300 -0.57899400 64.49027 -0.09144000 0.66433300 0.74182300 -64.25033 341 'point symmetry operation' ? ? 0.89737400 -0.32162900 0.30211500 -332.73060 0.43821600 0.56912200 -0.69575000 48.64389 0.05183300 0.75674000 0.65165900 -76.43897 342 'point symmetry operation' ? ? 0.85527100 -0.35538800 0.37710800 -20.63058 0.51369700 0.48596400 -0.70707500 -122.97211 0.06802500 0.79846000 0.59819300 -104.65789 343 'point symmetry operation' ? ? 0.80754900 0.58698000 0.05760200 90.27969 -0.04600600 0.16005600 -0.98603500 135.54972 -0.58800300 0.79362300 0.15625800 236.09267 344 'point symmetry operation' ? ? 0.87949600 -0.29577600 0.37283100 -149.42555 0.47356500 0.62152500 -0.62405300 -77.76759 -0.04714400 0.72541200 0.68669800 -108.32754 345 'point symmetry operation' ? ? 0.89267700 -0.34169500 0.29389100 -278.19195 0.43837800 0.50686400 -0.74223600 53.54073 0.10465500 0.79141200 0.60225800 -51.66744 346 'point symmetry operation' ? ? 0.82885300 -0.23472100 0.50784600 -289.55587 0.50091500 0.71562800 -0.48678600 -61.97377 -0.24917100 0.65786200 0.71072700 -53.51030 347 'point symmetry operation' ? ? 0.86856400 -0.29571100 0.39768200 -15.27255 0.48876800 0.64371800 -0.58884000 -212.11911 -0.08186900 0.70582000 0.70364500 -187.70851 348 'point symmetry operation' ? ? 0.80349400 -0.25202200 0.53933500 -282.75077 0.53367000 0.70640300 -0.46496400 -127.65313 -0.26380700 0.66142200 0.70208800 -80.52484 349 'point symmetry operation' ? ? 0.76925400 0.62779600 0.11883100 113.23914 -0.13786900 0.34469100 -0.92853700 89.11340 -0.62389200 0.69789700 0.35170900 104.49374 350 'point symmetry operation' ? ? 0.86254100 -0.25665900 0.43606100 -236.66967 0.47658500 0.70159000 -0.52975300 -77.49721 -0.16997000 0.66475400 0.72747000 -96.51487 351 'point symmetry operation' ? ? 0.80836700 0.58775100 0.03303900 -1.35292 -0.09908700 0.19117400 -0.97654200 165.10651 -0.58028000 0.78613100 0.21277800 193.53080 352 'point symmetry operation' ? ? 0.76733900 -0.24115700 0.59416600 -257.42025 0.56933000 0.68256000 -0.45823000 -225.55503 -0.29504900 0.68989500 0.66105400 -111.88247 353 'point symmetry operation' ? ? 0.73543300 -0.22868400 0.63784100 -385.36828 0.56529100 0.72609100 -0.39145700 -32.25918 -0.37361100 0.64845600 0.66326500 42.70756 354 'point symmetry operation' ? ? 0.73976700 -0.22666300 0.63353600 -320.09799 0.56585600 0.71903000 -0.40348800 -177.15275 -0.36407600 0.65697700 0.66017400 -54.13395 355 'point symmetry operation' ? ? 0.90991000 -0.30425200 0.28194700 43.49113 0.41359100 0.61348500 -0.67274000 -134.95834 0.03171200 0.72874400 0.68405200 -164.51583 356 'point symmetry operation' ? ? 0.85775000 -0.29066600 0.42400100 1.24345 0.50812900 0.60438300 -0.61361700 -228.25525 -0.07790200 0.74177800 0.66610600 -181.70392 357 'point symmetry operation' ? ? 0.90515000 -0.25976400 0.33649000 -387.92720 0.41973300 0.67143700 -0.61073400 50.51123 -0.06728500 0.69404200 0.71678300 -81.76097 358 'point symmetry operation' ? ? 0.80007700 0.59839300 0.04244600 57.58567 -0.11747000 0.22566100 -0.96709800 144.01483 -0.58828300 0.76876700 0.25084000 175.21366 359 'point symmetry operation' ? ? 0.89701700 -0.25154800 0.36343400 -272.35399 0.42920900 0.69209500 -0.58033100 17.21890 -0.10555000 0.67655600 0.72878800 -67.80801 360 'point symmetry operation' ? ? 0.90773600 -0.23127800 0.35003700 -330.26814 0.40678200 0.68938500 -0.59939700 33.45373 -0.10268300 0.68648200 0.71986000 -74.41829 361 'point symmetry operation' ? ? 0.88554000 -0.28675700 0.36549800 -230.89004 0.45681400 0.68059700 -0.57280800 -36.49839 -0.08450000 0.67420900 0.73369100 -100.10034 362 'point symmetry operation' ? ? 0.83920400 -0.25023600 0.48282400 -305.53809 0.50042200 0.70288200 -0.50550500 8.67976 -0.21287300 0.66583700 0.71508500 -19.64335 363 'point symmetry operation' ? ? 0.79196000 -0.23246500 0.56458700 -266.91399 0.53823800 0.70237300 -0.46580300 -176.12156 -0.28826800 0.67278000 0.68137300 -96.15455 364 'point symmetry operation' ? ? 0.87645600 -0.24235900 0.41603600 -257.82350 0.45415000 0.70311300 -0.54715700 -11.68763 -0.15991200 0.66850200 0.72631500 -62.05626 365 'point symmetry operation' ? ? 0.88245300 -0.24848400 0.39941400 -284.00960 0.44565000 0.71341000 -0.54078000 30.80179 -0.15057100 0.65521200 0.74028800 -44.54388 366 'point symmetry operation' ? ? 0.61785800 0.69359800 0.37036900 -35.10459 -0.14989400 0.56629700 -0.81045700 -32.65439 -0.77187000 0.44523100 0.45385800 -12.15304 367 'point symmetry operation' ? ? 0.90006100 -0.29050500 0.32480200 -330.81566 0.43482400 0.64765200 -0.62568000 17.71772 -0.02859600 0.70438200 0.70924500 -97.91439 368 'point symmetry operation' ? ? 0.85678600 -0.25087400 0.45053200 -313.03171 0.47914200 0.71027700 -0.51568400 65.23188 -0.19063100 0.65770000 0.72876000 2.29705 369 'point symmetry operation' ? ? 0.86180400 -0.42532500 0.27639300 0.00000 0.42532500 0.30901700 -0.85065100 0.00000 0.27639300 0.85065100 0.44721300 0.00000 370 'point symmetry operation' ? ? 0.12791800 -0.99154500 -0.02184300 39.18665 0.64527200 0.09993000 -0.75738900 -44.94040 0.75316700 0.08278800 0.65259800 -224.30036 371 'point symmetry operation' ? ? 0.19191600 -0.98089800 -0.03175000 -91.74026 0.80435500 0.17574500 -0.56756200 -123.17672 0.56230000 0.08338600 0.82271800 -306.27396 372 'point symmetry operation' ? ? 0.12544900 -0.99210000 -0.00070500 101.26691 0.73806700 0.09380200 -0.66817500 -116.43545 0.66296300 0.08330100 0.74400400 -240.40408 373 'point symmetry operation' ? ? 0.13991500 -0.98943500 -0.03797500 74.74976 0.71049300 0.12703400 -0.69214300 -86.74002 0.68965500 0.06986000 0.72076000 -235.12633 374 'point symmetry operation' ? ? 0.03171000 -0.99907200 0.02915900 22.07575 0.57699000 -0.00552400 -0.81673200 -12.89597 0.81613500 0.04272300 0.57627900 -176.53105 375 'point symmetry operation' ? ? 0.79880500 -0.47253800 0.37231600 -142.82215 0.42374700 0.00265800 -0.90577700 43.91727 0.42702400 0.88130600 0.20236000 142.65412 376 'point symmetry operation' ? ? 0.10715000 -0.99311400 -0.04737300 -21.74253 0.62861300 0.10458400 -0.77065400 -32.96308 0.77030200 0.05279600 0.63549000 -300.29129 377 'point symmetry operation' ? ? 0.76400400 -0.45671300 0.45575300 -167.49050 0.47630200 -0.07726500 -0.87588000 20.06496 0.43524000 0.88625200 0.15850200 215.80936 378 'point symmetry operation' ? ? 0.18405800 -0.98203700 -0.04154100 -152.09624 0.78521000 0.17232700 -0.59476700 -87.49220 0.59124200 0.07685400 0.80282400 -305.04428 379 'point symmetry operation' ? ? 0.05046400 -0.99857500 0.01740400 -45.12028 0.58186300 0.01523300 -0.81314400 -13.48029 0.81172000 0.05116100 0.58180200 -282.56358 380 'point symmetry operation' ? ? 0.19698100 -0.98011700 -0.02386000 -29.54685 0.82211200 0.17838700 -0.54065700 -158.25727 0.53416300 0.08688400 0.84090500 -305.96088 381 'point symmetry operation' ? ? 0.75309200 -0.46611000 0.46432100 -288.02874 0.45539500 -0.14005100 -0.87920500 20.90676 0.47483500 0.87357100 0.10679300 32.95769 382 'point symmetry operation' ? ? 0.07483800 -0.99717800 -0.00591900 -2.39092 0.60332300 0.05000300 -0.79592800 -21.44794 0.79397800 0.05599500 0.60536200 -237.55897 383 'point symmetry operation' ? ? -0.03132900 -0.98998000 0.13768700 -144.39073 0.51699000 -0.13394600 -0.84544700 -1.23917 0.85541800 0.04469600 0.51600600 -326.07973 384 'point symmetry operation' ? ? 0.01044600 -0.99741300 0.07111900 -39.70677 0.55285500 -0.05350300 -0.83155800 -5.67091 0.83321200 0.04800500 0.55086600 -220.27219 385 'point symmetry operation' ? ? 0.16632100 -0.98391800 -0.06513600 -113.30256 0.63176600 0.15704500 -0.75908400 -6.98886 0.75710600 0.08510100 0.64772600 -297.12406 386 'point symmetry operation' ? ? 0.15165100 -0.98565600 -0.07405600 -122.01828 0.62002100 0.15320900 -0.76948100 -8.93694 0.76979000 0.07077600 0.63436100 -351.60354 387 'point symmetry operation' ? ? 0.02959000 -0.99847000 0.04671300 -93.66364 0.56316200 -0.02195700 -0.82605500 -7.92331 0.82581700 0.05075000 0.56165000 -331.78783 388 'point symmetry operation' ? ? -0.04172600 -0.99199400 0.11919100 140.54815 0.60464800 -0.12004100 -0.78739500 -49.88769 0.79539900 0.03921400 0.60481500 -65.25702 389 'point symmetry operation' ? ? 0.74469900 -0.45597800 0.48734800 -217.84888 0.48418900 -0.13344700 -0.86472700 9.27221 0.45933200 0.87992900 0.12140100 186.33247 390 'point symmetry operation' ? ? 0.07396400 -0.99725000 0.00480200 70.03445 0.63909700 0.04370300 -0.76788400 -45.24297 0.76556200 0.05986500 0.64057100 -182.09585 391 'point symmetry operation' ? ? -0.01042700 -0.99422500 0.10680800 -94.73449 0.53428800 -0.09582800 -0.83985300 -2.64852 0.84523800 0.04830900 0.53220200 -271.92882 392 'point symmetry operation' ? ? 0.18575400 -0.98159200 -0.04442000 -29.61477 0.75412200 0.17139700 -0.63397400 -98.12003 0.62991700 0.08426400 0.77207800 -282.91723 393 'point symmetry operation' ? ? 0.08620000 -0.99609400 -0.01916800 254.98200 0.66677800 0.07197500 -0.74177300 -76.93840 0.74025500 0.05116000 0.67037700 -97.60604 394 'point symmetry operation' ? ? 0.16791700 -0.98500600 -0.03960300 31.00061 0.78165000 0.15751400 -0.60350000 -135.26453 0.60068900 0.07038200 0.79637800 -288.91186 395 'point symmetry operation' ? ? 0.81080900 -0.48046900 0.33427500 -87.02156 0.41867100 0.07698100 -0.90486900 46.92531 0.40902900 0.87362700 0.26357400 148.01522 396 'point symmetry operation' ? ? 0.15493300 -0.98626500 -0.05725300 29.76252 0.70165600 0.15065000 -0.69640800 -74.16796 0.69546800 0.06772400 0.71535900 -254.84659 397 'point symmetry operation' ? ? 0.77060700 -0.46856800 0.43198300 -237.57690 0.43739900 -0.10413100 -0.89321800 31.47320 0.46351600 0.87726900 0.12470700 85.33954 398 'point symmetry operation' ? ? 0.15648200 -0.98766300 0.00597000 120.40119 0.81742100 0.12611200 -0.56206600 -191.32462 0.55437900 0.09283300 0.82707000 -280.27917 399 'point symmetry operation' ? ? 0.20416100 -0.97875200 -0.01907600 -151.36980 0.84706800 0.18639300 -0.49772800 -149.85088 0.49070800 0.08545700 0.86712300 -325.58455 400 'point symmetry operation' ? ? 0.19849700 -0.98003600 -0.01132700 27.48675 0.84365200 0.17673200 -0.50696800 -199.00235 0.49884900 0.09107600 0.86189000 -310.51391 401 'point symmetry operation' ? ? 0.06315900 -0.99800100 0.00245100 214.10658 0.55711400 0.03321900 -0.82977100 -11.26021 0.82803100 0.05377300 0.55809800 -34.67408 402 'point symmetry operation' ? ? 0.06803700 -0.99716700 0.03208100 266.09717 0.67751300 0.02257500 -0.73516400 -88.80812 0.73235700 0.07175400 0.67712900 -80.14836 403 'point symmetry operation' ? ? 0.12946200 -0.99085800 -0.03794500 -110.88054 0.61287800 0.11004100 -0.78247800 -18.12393 0.77950000 0.07804500 0.62152100 -383.53725 404 'point symmetry operation' ? ? 0.78420400 -0.47242400 0.40229400 -190.60089 0.42455600 -0.06430400 -0.90311500 39.53247 0.45252300 0.87902200 0.15014300 129.86416 405 'point symmetry operation' ? ? 0.14863800 -0.98737500 -0.05475400 -59.59342 0.63852200 0.13810800 -0.75711000 -22.01329 0.75511300 0.07757400 0.65098900 -273.92548 406 'point symmetry operation' ? ? 0.16362400 -0.98563100 -0.04193500 -85.30633 0.62169000 0.13602400 -0.77136200 -20.62744 0.76598300 0.10014300 0.63501300 -328.68168 407 'point symmetry operation' ? ? 0.11302900 -0.99165700 -0.06197600 10.34959 0.64677200 0.12078300 -0.75305900 -37.59497 0.75426200 0.04503200 0.65502800 -251.28058 408 'point symmetry operation' ? ? 0.16352300 -0.98548400 -0.04562400 -101.43266 0.73736100 0.15281400 -0.65798600 -62.96620 0.65540700 0.07395400 0.75164600 -282.06638 409 'point symmetry operation' ? ? 0.17875900 -0.98377900 -0.01498500 76.52921 0.79517400 0.15342300 -0.58665100 -162.09634 0.57943400 0.09295400 0.80970100 -281.73686 410 'point symmetry operation' ? ? 0.16587600 -0.98469800 -0.05343300 -41.50740 0.68187600 0.15367000 -0.71514400 -44.60347 0.71241200 0.08219100 0.69693100 -258.35678 411 'point symmetry operation' ? ? 0.16628300 -0.98335000 -0.07330600 -88.62837 0.67166500 0.16737800 -0.72170000 -26.31904 0.72195300 0.07076900 0.68831300 -273.94654 412 'point symmetry operation' ? ? 0.87018000 -0.40408700 0.28196100 15.28681 0.44694200 0.40639500 -0.79692300 -29.25650 0.20743800 0.81948600 0.53423900 -36.83352 413 'point symmetry operation' ? ? 0.09075500 -0.99548200 -0.02793400 -59.25310 0.60340900 0.07728200 -0.79367800 -21.14944 0.79225100 0.05517400 0.60769600 -339.67917 414 'point symmetry operation' ? ? 0.16629800 -0.98417400 -0.06122100 -153.26061 0.71307400 0.16290700 -0.68190000 -30.71914 0.68108100 0.06974400 0.72887900 -278.95681 415 'point symmetry operation' ? ? -0.13819600 -0.95105700 0.27639300 0.00000 0.42532500 -0.30901700 -0.85065100 0.00000 0.89442700 0.00000000 0.44721300 0.00000 416 'point symmetry operation' ? ? -0.87799800 -0.47738800 -0.03494700 202.89858 0.15969800 -0.22332200 -0.96157400 91.86498 0.45123900 -0.84984000 0.27231300 -65.26043 417 'point symmetry operation' ? ? -0.81023700 -0.51853100 -0.27320800 260.83161 0.40556600 -0.15950100 -0.90004200 37.25044 0.42312200 -0.84005000 0.33953200 -219.02460 418 'point symmetry operation' ? ? -0.86816200 -0.47435800 -0.14587900 279.03591 0.28154500 -0.22869500 -0.93189600 58.80924 0.40869000 -0.85010800 0.33209700 -16.93595 419 'point symmetry operation' ? ? -0.86603500 -0.48320100 -0.12845600 248.16837 0.24900600 -0.19404300 -0.94886400 73.08823 0.43356600 -0.85373500 0.28836800 -38.29333 420 'point symmetry operation' ? ? -0.91823500 -0.38913500 0.07361300 143.30633 0.04606300 -0.28955100 -0.95605400 88.17779 0.39334800 -0.87449000 0.28380000 -59.20183 421 'point symmetry operation' ? ? -0.26906000 -0.81024800 0.52067800 -180.71304 0.32829600 -0.58539400 -0.74130700 -77.01089 0.90544300 -0.02851900 0.42350700 -63.94719 422 'point symmetry operation' ? ? -0.88811800 -0.45898800 -0.02400600 228.80171 0.13175300 -0.20420100 -0.97002200 125.48949 0.44032600 -0.86465700 0.24182700 -153.74125 423 'point symmetry operation' ? ? -0.31848700 -0.76112400 0.56502800 -228.55379 0.35734800 -0.64849300 -0.67213000 -141.25227 0.87799100 -0.01215300 0.47852200 -53.29525 424 'point symmetry operation' ? ? -0.82276900 -0.51220800 -0.24636400 217.12999 0.37279700 -0.15913300 -0.91416600 49.60785 0.42903800 -0.84399100 0.32187800 -272.45869 425 'point symmetry operation' ? ? -0.91111900 -0.40726200 0.06325400 196.06396 0.05725600 -0.27706400 -0.95914400 125.78620 0.40814800 -0.87027200 0.27575600 -166.72288 426 'point symmetry operation' ? ? -0.79848100 -0.52233200 -0.29932800 303.72666 0.43605600 -0.15899800 -0.88576200 25.05355 0.41506900 -0.83778800 0.35472300 -163.25712 427 'point symmetry operation' ? ? -0.33879700 -0.71844300 0.60750000 -140.34689 0.31674800 -0.69509200 -0.64538200 -76.12569 0.88593800 -0.02622900 0.46306100 -242.88152 428 'point symmetry operation' ? ? -0.90207600 -0.43069200 0.02764800 183.64118 0.09035200 -0.25110800 -0.96373300 106.91196 0.42201400 -0.86686200 0.26543200 -108.37795 429 'point symmetry operation' ? ? -0.93420100 -0.31178900 0.17337100 184.44104 -0.03970200 -0.39209400 -0.91906800 132.47253 0.35453300 -0.86547600 0.35391600 -274.97402 430 'point symmetry operation' ? ? -0.92409900 -0.36415600 0.11589700 148.35784 0.01197000 -0.33070800 -0.94365700 100.77861 0.38196600 -0.87064500 0.30996500 -134.02338 431 'point symmetry operation' ? ? -0.85901400 -0.50987400 -0.04608800 178.11589 0.15679600 -0.17632600 -0.97176400 120.77003 0.48735000 -0.84198400 0.23141200 -234.21858 432 'point symmetry operation' ? ? -0.86659700 -0.49788200 -0.03353300 215.52933 0.13676900 -0.17235500 -0.97549400 145.54451 0.47990100 -0.84994500 0.21745700 -266.37808 433 'point symmetry operation' ? ? -0.91787900 -0.38506700 0.09602900 210.85355 0.02922800 -0.30690800 -0.95129000 143.40026 0.39578200 -0.87036200 0.29295900 -232.15509 434 'point symmetry operation' ? ? -0.94605600 -0.31672400 0.06829400 127.39450 0.06003600 -0.37849200 -0.92365600 30.89288 0.31839200 -0.86973000 0.37708900 96.52625 435 'point symmetry operation' ? ? -0.34754000 -0.72326000 0.59675100 -219.10011 0.34598700 -0.69042800 -0.63529600 -147.72433 0.87149800 -0.01432300 0.49019000 -111.51958 436 'point symmetry operation' ? ? -0.90285700 -0.42981500 -0.01043400 183.69776 0.13400300 -0.25825800 -0.95673700 77.54078 0.40852500 -0.86519500 0.29076600 -18.79493 437 'point symmetry operation' ? ? -0.92944000 -0.33834500 0.14719100 164.05123 -0.01486100 -0.36427100 -0.93117400 115.91641 0.36867500 -0.86765700 0.33354000 -206.34316 438 'point symmetry operation' ? ? -0.83186800 -0.51686200 -0.20211300 251.67977 0.32775900 -0.16366400 -0.93047700 61.57299 0.44785000 -0.84027800 0.30555200 -153.01247 439 'point symmetry operation' ? ? -0.89638800 -0.43971600 -0.05602200 208.10505 0.17291900 -0.23050600 -0.95758400 56.09597 0.40815100 -0.86805400 0.28265700 184.41206 440 'point symmetry operation' ? ? -0.83335200 -0.49989200 -0.23586600 299.78136 0.36070700 -0.16849400 -0.91733300 50.60769 0.41882500 -0.84954000 0.32072900 -101.47732 441 'point symmetry operation' ? ? -0.24871100 -0.85124600 0.46208600 -166.17161 0.33680600 -0.52331300 -0.78275500 -62.72780 0.90813200 -0.03904700 0.41685900 -11.64011 442 'point symmetry operation' ? ? -0.85961300 -0.49439000 -0.12901500 238.77189 0.24274900 -0.17298100 -0.95454200 81.80122 0.44959800 -0.85185500 0.26870900 -87.35029 443 'point symmetry operation' ? ? -0.31369200 -0.74312100 0.59107400 -166.20794 0.31274400 -0.66862200 -0.67463800 -81.85402 0.89654200 -0.02677400 0.44214800 -174.33020 444 'point symmetry operation' ? ? -0.82500500 -0.49864100 -0.26594000 358.83138 0.41098700 -0.20640100 -0.88796900 24.21594 0.38788700 -0.84187600 0.37521600 -17.65438 445 'point symmetry operation' ? ? -0.77910800 -0.52551300 -0.34180200 268.90939 0.48097900 -0.15141200 -0.86355900 10.14823 0.40205700 -0.83720400 0.37072600 -280.99480 446 'point symmetry operation' ? ? -0.78504000 -0.52436400 -0.32978000 351.60557 0.47244600 -0.16251900 -0.86624600 9.47591 0.40063200 -0.83584100 0.37531800 -114.28091 447 'point symmetry operation' ? ? -0.90378100 -0.41951600 0.08477000 109.17350 0.03199600 -0.26373500 -0.96406400 65.40072 0.42679700 -0.86859000 0.25178200 175.99597 448 'point symmetry operation' ? ? -0.90355500 -0.42596900 -0.04625100 206.47089 0.18098100 -0.28158000 -0.94231500 40.23690 0.38837300 -0.85980400 0.33151500 202.16108 449 'point symmetry operation' ? ? -0.87745300 -0.47965100 -0.00353700 248.06645 0.12005200 -0.21246700 -0.96976500 157.82835 0.46439600 -0.85134800 0.24401300 -270.69736 450 'point symmetry operation' ? ? -0.29326900 -0.76919500 0.56774400 -186.16732 0.31170800 -0.63833700 -0.70382100 -86.39355 0.90378700 -0.02943900 0.42696800 -112.40162 451 'point symmetry operation' ? ? -0.86794100 -0.49454600 -0.04585300 189.59251 0.15866100 -0.18859800 -0.96915300 110.53705 0.47064200 -0.84844300 0.24215700 -175.80497 452 'point symmetry operation' ? ? -0.86049100 -0.50902200 -0.02127800 219.09691 0.14326700 -0.20169000 -0.96891500 133.68625 0.48890700 -0.83679000 0.24647900 -223.29098 453 'point symmetry operation' ? ? -0.88505800 -0.46236500 -0.05377000 207.67079 0.15642200 -0.18663100 -0.96989700 104.41165 0.43841100 -0.86682600 0.23750400 -103.11898 454 'point symmetry operation' ? ? -0.84850400 -0.49988700 -0.17364900 204.41725 0.29495400 -0.17430100 -0.93947900 70.68729 0.43936600 -0.84837000 0.29533800 -216.86782 455 'point symmetry operation' ? ? -0.82199900 -0.51337700 -0.24650300 326.83321 0.38567200 -0.18334800 -0.90423500 37.09605 0.41901700 -0.83834800 0.34870600 -57.54655 456 'point symmetry operation' ? ? -0.85628800 -0.50606600 -0.10328600 198.14863 0.22071500 -0.17773100 -0.95900800 88.83044 0.46696400 -0.84398400 0.26388500 -152.66582 457 'point symmetry operation' ? ? -0.85704400 -0.50537100 -0.10038600 181.63366 0.20754500 -0.16028300 -0.96500500 99.43242 0.47159400 -0.84788600 0.24225600 -201.78403 458 'point symmetry operation' ? ? -0.09797600 -0.97805900 0.18385400 49.38036 0.48126700 -0.20827000 -0.85147300 -0.28610 0.87108100 0.00505900 0.49111200 -2.79949 459 'point symmetry operation' ? ? -0.89511800 -0.44551800 0.01667200 236.78775 0.09551300 -0.22816200 -0.96892700 145.89416 0.43547800 -0.86571100 0.24678400 -204.90649 460 'point symmetry operation' ? ? -0.85180200 -0.50229900 -0.14876200 164.46127 0.26253700 -0.16357700 -0.95095600 81.51715 0.45332900 -0.84908100 0.27120700 -261.83349 461 'point symmetry operation' ? ? -0.86180400 -0.42532500 -0.27639300 0.00000 -0.42532500 0.30901700 0.85065100 0.00000 -0.27639300 0.85065100 -0.44721300 0.00000 462 'point symmetry operation' ? ? -0.79625300 0.54662700 -0.25919300 149.10963 -0.15969800 0.22332200 0.96157400 -91.86498 0.58350500 0.80704800 -0.09052500 -152.29264 463 'point symmetry operation' ? ? -0.74080100 0.51947100 -0.42586900 312.54908 -0.40556600 0.15950100 0.90004200 -37.25044 0.53547200 0.83947000 0.09252100 -135.34419 464 'point symmetry operation' ? ? -0.75379700 0.54822100 -0.36227600 139.93648 -0.28154500 0.22869500 0.93189600 -58.80924 0.59373600 0.80445800 -0.01804100 -242.00326 465 'point symmetry operation' ? ? -0.77509600 0.54751100 -0.31537100 145.23475 -0.24900600 0.19404300 0.94886400 -73.08823 0.58070900 0.81399000 -0.01406800 -204.84320 466 'point symmetry operation' ? ? -0.76246900 0.60814300 -0.22091800 117.04021 -0.04606300 0.28955100 0.95605400 -88.17779 0.64538400 0.73913700 -0.19276100 -101.70121 467 'point symmetry operation' ? ? -0.93018100 -0.33684500 -0.14594200 -23.62102 -0.32829600 0.58539400 0.74130700 77.01089 -0.16427200 0.73746200 -0.65510600 190.23262 468 'point symmetry operation' ? ? -0.79101800 0.56810800 -0.22703300 239.83358 -0.13175300 0.20420100 0.97002200 -125.48949 0.59743700 0.79721700 -0.08667700 -135.89133 469 'point symmetry operation' ? ? -0.92773100 -0.32951400 -0.17531500 -54.54341 -0.35734800 0.64849300 0.67213000 141.25227 -0.10778600 0.68620500 -0.71937800 228.25897 470 'point symmetry operation' ? ? -0.75169700 0.52582300 -0.39807400 340.79809 -0.37279700 0.15913300 0.91416600 -49.60785 0.54403600 0.83557600 0.07640600 -72.35986 471 'point symmetry operation' ? ? -0.77252300 0.59626300 -0.21835500 236.80397 -0.05725600 0.27706400 0.95914400 -125.78620 0.63240000 0.75346300 -0.17989800 -100.80424 472 'point symmetry operation' ? ? -0.72834100 0.51574700 -0.45113700 281.85230 -0.43605600 0.15899800 0.88576200 -25.05355 0.52855900 0.84185800 0.10909000 -198.65062 473 'point symmetry operation' ? ? -0.94392300 -0.29783700 -0.14249200 154.47516 -0.31674800 0.69509200 0.64538200 76.12569 -0.09317300 0.65432500 -0.75045200 234.14979 474 'point symmetry operation' ? ? -0.78088100 0.58273500 -0.22504500 179.06299 -0.09035200 0.25110800 0.96373300 -106.91196 0.61811100 0.77289400 -0.14343400 -115.78559 475 'point symmetry operation' ? ? -0.73489100 0.63467000 -0.23901800 328.42892 0.03970200 0.39209400 0.91906800 -132.47253 0.67702300 0.66592500 -0.31334300 -41.99708 476 'point symmetry operation' ? ? -0.75491000 0.61587400 -0.22541100 186.22181 -0.01197000 0.33070800 0.94365700 -100.77861 0.65571900 0.71507500 -0.24228300 -72.75825 477 'point symmetry operation' ? ? -0.82006200 0.52507300 -0.22759200 289.14741 -0.15679600 0.17632600 0.97176400 -120.77003 0.55037600 0.83259100 -0.06226900 -54.56606 478 'point symmetry operation' ? ? -0.81679000 0.53755600 -0.20949600 334.64355 -0.13676900 0.17235500 0.97549400 -145.54451 0.56049000 0.82542600 -0.06725700 -73.64749 479 'point symmetry operation' ? ? -0.76448600 0.60627000 -0.21908500 301.94247 -0.02922800 0.30690800 0.95129000 -143.40026 0.64397700 0.73365200 -0.21690600 -84.77031 480 'point symmetry operation' ? ? -0.70786700 0.63626800 -0.30673700 -29.36333 -0.06003600 0.37849200 0.92365600 -30.89288 0.70378900 0.67224100 -0.22972300 -157.11286 481 'point symmetry operation' ? ? -0.93491700 -0.31064000 -0.17156400 1.76189 -0.34598700 0.69042800 0.63529600 147.72433 -0.07889600 0.65330800 -0.75297000 245.84203 482 'point symmetry operation' ? ? -0.76916600 0.58163600 -0.26473600 98.96272 -0.13400300 0.25825800 0.95673700 -77.54078 0.62484200 0.77136400 -0.12070200 -155.89889 483 'point symmetry operation' ? ? -0.74541100 0.62474500 -0.23250100 257.92495 0.01486100 0.36427100 0.93117400 -115.91641 0.66644000 0.69065200 -0.28081500 -54.45250 484 'point symmetry operation' ? ? -0.77259200 0.52042100 -0.36368200 249.41313 -0.32775900 0.16366400 0.93047700 -61.57299 0.54376100 0.83807900 0.04412800 -156.68002 485 'point symmetry operation' ? ? -0.76593800 0.57976500 -0.27787000 -71.87608 -0.17291900 0.23050600 0.95758400 -56.09597 0.61922400 0.78149900 -0.07630000 -268.60622 486 'point symmetry operation' ? ? -0.74729500 0.53629400 -0.39235100 224.83030 -0.36070700 0.16849400 0.91733300 -50.60769 0.55806900 0.82704200 0.06753000 -222.75056 487 'point symmetry operation' ? ? -0.92348600 -0.34576300 -0.16619900 -63.90285 -0.33680600 0.52331300 0.78275500 62.72780 -0.18367400 0.77884000 -0.59972700 153.83397 488 'point symmetry operation' ? ? -0.78656300 0.54082500 -0.29803800 184.91044 -0.24274900 0.17298100 0.95454200 -81.80122 0.56779500 0.82315600 -0.00477600 -174.49983 489 'point symmetry operation' ? ? -0.94218000 -0.30838600 -0.13113400 81.59553 -0.31274400 0.66862200 0.67463800 81.85402 -0.12037000 0.67664100 -0.72640700 226.62358 490 'point symmetry operation' ? ? -0.71589000 0.52999900 -0.45453600 176.26465 -0.41098700 0.20640100 0.88796900 -24.21594 0.56443900 0.82249600 0.07006300 -313.05321 491 'point symmetry operation' ? ? -0.70803900 0.51380300 -0.48444600 371.58947 -0.48097900 0.15141200 0.86355900 -10.14823 0.51705000 0.84444100 0.13992300 -114.85531 492 'point symmetry operation' ? ? -0.70941700 0.51309700 -0.48317600 259.45867 -0.47244600 0.16251900 0.86624600 -9.47591 0.52299300 0.84280400 0.12711700 -263.37761 493 'point symmetry operation' ? ? -0.78592200 0.58927900 -0.18729000 -108.59197 -0.03199600 0.26373500 0.96406400 -65.40072 0.61749700 0.76367200 -0.18842100 -176.35539 494 'point symmetry operation' ? ? -0.75145400 0.57853400 -0.31720000 -88.48211 -0.18098100 0.28158000 0.94231500 -40.23690 0.63447900 0.76551400 -0.10689000 -275.08219 495 'point symmetry operation' ? ? -0.80777800 0.54696300 -0.21983400 353.05785 -0.12005200 0.21246700 0.96976500 -157.82835 0.57713300 0.80974600 -0.10596200 -100.81793 496 'point symmetry operation' ? ? -0.93952600 -0.31766300 -0.12798900 17.27876 -0.31170800 0.63833700 0.70382100 86.39355 -0.14187700 0.70115400 -0.69875200 216.78052 497 'point symmetry operation' ? ? -0.80911100 0.53770400 -0.23709800 242.03313 -0.15866100 0.18859800 0.96915300 -110.53705 0.56583300 0.82177000 -0.06728400 -90.95438 498 'point symmetry operation' ? ? -0.82211500 0.52080800 -0.22997300 297.70070 -0.14326700 0.20169000 0.96891500 -133.68625 0.55100100 0.82950600 -0.09119800 -96.10755 499 'point symmetry operation' ? ? -0.78793700 0.56853800 -0.23647600 185.10557 -0.15642200 0.18663100 0.96989700 -104.41165 0.59555700 0.80120800 -0.05812200 -139.63020 500 'point symmetry operation' ? ? -0.77244300 0.53525100 -0.34181700 285.39074 -0.29495400 0.17430100 0.93947900 -70.68729 0.56243500 0.82651400 0.02323700 -85.85020 501 'point symmetry operation' ? ? -0.74238900 0.52025400 -0.42213200 197.63533 -0.38567200 0.18334800 0.90423500 -37.09605 0.54782800 0.83409800 0.06453200 -266.59288 502 'point symmetry operation' ? ? -0.80060900 0.52856400 -0.28221700 225.16324 -0.22071500 0.17773100 0.95900800 -88.83044 0.55705500 0.83008000 -0.02563100 -108.95533 503 'point symmetry operation' ? ? -0.80508900 0.53236400 -0.26157400 261.71024 -0.20754500 0.16028300 0.96500500 -99.43242 0.55566000 0.83120300 -0.01855200 -72.21760 504 'point symmetry operation' ? ? -0.82293600 -0.44192500 -0.35704300 24.58749 -0.48126700 0.20827000 0.85147300 0.28610 -0.30192600 0.87254000 -0.38407600 -42.91516 505 'point symmetry operation' ? ? -0.78981200 0.57507500 -0.21327400 289.16866 -0.09551300 0.22816200 0.96892700 -145.89416 0.60586600 0.78564100 -0.12527800 -120.15249 506 'point symmetry operation' ? ? -0.78640700 0.53480800 -0.30910300 307.74046 -0.26253700 0.16357700 0.95095600 -81.51715 0.55914000 0.82898900 0.01176900 -30.00326 507 'point symmetry operation' ? ? -0.67082000 0.68819100 -0.27639300 0.00000 0.16246000 0.50000000 0.85065100 0.00000 0.72360700 0.52573100 -0.44721400 0.00000 508 'point symmetry operation' ? ? 0.19183700 0.97832100 0.07801900 -106.41438 0.33882800 -0.14062800 0.93028000 -161.96481 0.92108400 -0.15202700 -0.35846000 -127.70779 509 'point symmetry operation' ? ? 0.10430700 0.98071800 0.16526200 -17.76604 0.10732200 -0.17629700 0.97846900 -213.84793 0.98873800 -0.08432500 -0.12364200 -267.10666 510 'point symmetry operation' ? ? 0.18431900 0.97799300 0.09775400 -181.28367 0.21529600 -0.13721700 0.96686100 -129.83032 0.95899700 -0.15716400 -0.23585000 -178.56832 511 'point symmetry operation' ? ? 0.17351400 0.97715300 0.12273800 -149.88321 0.25413900 -0.16483400 0.95301800 -144.49650 0.95147600 -0.13417000 -0.27693400 -158.27678 512 'point symmetry operation' ? ? 0.28927700 0.95724500 -0.00102600 -71.79762 0.41090200 -0.12320500 0.90331600 -140.13187 0.86456800 -0.26173000 -0.42897500 -83.81544 513 'point symmetry operation' ? ? -0.56976900 0.69161400 -0.44388400 181.84650 0.28114900 0.67158600 0.68551300 76.18729 0.77221600 0.26578700 -0.57709600 61.67996 514 'point symmetry operation' ? ? 0.21353800 0.97227300 0.09531800 -67.75907 0.35835900 -0.16872300 0.91821100 -242.49379 0.90883500 -0.16191500 -0.38445200 -168.34389 515 'point symmetry operation' ? ? -0.52599700 0.66500700 -0.53018100 221.55729 0.25620600 0.71832600 0.64681300 146.33541 0.81097800 0.20438600 -0.54821700 67.28780 516 'point symmetry operation' ? ? 0.11663900 0.97943700 0.16461700 45.54111 0.14023700 -0.18033000 0.97355800 -240.44962 0.98322400 -0.09046900 -0.15838700 -252.88369 517 'point symmetry operation' ? ? 0.27108400 0.96247800 0.01221800 -37.55035 0.40775700 -0.12632500 0.90431000 -240.95306 0.87192200 -0.24016200 -0.42670200 -150.30423 518 'point symmetry operation' ? ? 0.09461700 0.98137400 0.16718600 -82.28908 0.07533100 -0.17451600 0.98176900 -185.93735 0.99266000 -0.08029800 -0.09044100 -279.61807 519 'point symmetry operation' ? ? -0.50811300 0.66020300 -0.55313000 285.33032 0.29856900 0.73740500 0.60588000 -29.21110 0.80788500 0.14270800 -0.57180200 -47.08587 520 'point symmetry operation' ? ? 0.24657900 0.96814000 0.04361800 -66.87958 0.38589400 -0.13937100 0.91195500 -191.74420 0.88897900 -0.20803700 -0.40796600 -125.14512 521 'point symmetry operation' ? ? 0.35009700 0.92831500 -0.12515000 46.44098 0.46407700 -0.05583900 0.88403300 -300.21817 0.81367300 -0.36757700 -0.45035900 -186.79005 522 'point symmetry operation' ? ? 0.31021700 0.94933900 -0.05020400 -24.19243 0.43404100 -0.09445300 0.89592800 -190.99005 0.84579800 -0.29972300 -0.44135400 -114.30736 523 'point symmetry operation' ? ? 0.15435400 0.98101500 0.11740400 24.06294 0.35517000 -0.16597900 0.91994900 -267.66157 0.92197000 -0.10030000 -0.37404700 -170.13909 524 'point symmetry operation' ? ? 0.16984800 0.97807900 0.12047100 16.94430 0.36944900 -0.17652900 0.91233000 -314.44650 0.91359700 -0.11045000 -0.39133300 -198.56915 525 'point symmetry operation' ? ? 0.29171400 0.95622400 -0.02321200 -4.27196 0.42570700 -0.10806200 0.89838500 -293.49057 0.85654900 -0.27195300 -0.43859500 -181.00801 526 'point symmetry operation' ? ? 0.35759800 0.93096600 -0.07365200 -159.27041 0.36750400 -0.06778200 0.92754900 -7.73360 0.85852500 -0.35875700 -0.36637300 -32.77420 527 'point symmetry operation' ? ? -0.49977000 0.65343500 -0.56855200 259.35677 0.26962000 0.74115800 0.61480900 118.47602 0.82312500 0.15397000 -0.54658900 31.00574 528 'point symmetry operation' ? ? 0.24536400 0.96825400 0.04775100 -124.01789 0.34369300 -0.13294100 0.92962500 -120.90069 0.90646100 -0.21168500 -0.36540200 -100.56461 529 'point symmetry operation' ? ? 0.33029600 0.93952700 -0.09051500 14.14397 0.45016400 -0.07251400 0.88999700 -245.38281 0.82961300 -0.33470900 -0.44689300 -150.04722 530 'point symmetry operation' ? ? 0.12067200 0.98091200 0.15247800 -66.08572 0.18895500 -0.17348900 0.96653900 -196.41495 0.97454300 -0.08782300 -0.20628400 -218.17562 531 'point symmetry operation' ? ? 0.23127700 0.96934600 0.08293600 -280.99935 0.31031300 -0.15429400 0.93803000 -3.13501 0.92207200 -0.19120900 -0.33648600 -38.62302 532 'point symmetry operation' ? ? 0.13396100 0.97805300 0.15958200 -131.19276 0.14743100 -0.17891100 0.97275700 -173.09443 0.97995900 -0.10678400 -0.16816300 -235.69979 533 'point symmetry operation' ? ? -0.58693800 0.70907800 -0.39078400 130.96194 0.27032900 0.62660400 0.73095100 88.30906 0.76316800 0.32338300 -0.55946200 82.05924 534 'point symmetry operation' ? ? 0.15946000 0.97739600 0.13881300 -110.67883 0.26594200 -0.17794400 0.94742300 -174.86623 0.95070900 -0.11416000 -0.28830600 -168.83570 535 'point symmetry operation' ? ? -0.53075600 0.66938800 -0.51982400 253.73635 0.30078400 0.72219100 0.62287200 18.26077 0.79235600 0.17423800 -0.58464900 -0.72708 536 'point symmetry operation' ? ? 0.13780400 0.98167400 0.13162900 -222.59564 0.08829400 -0.14454300 0.98555100 -123.19691 0.98651600 -0.12419000 -0.10659500 -254.81694 537 'point symmetry operation' ? ? 0.07986000 0.98098800 0.17687600 29.04501 0.02705400 -0.17951100 0.98338400 -226.62482 0.99643900 -0.07374800 -0.04087600 -314.91425 538 'point symmetry operation' ? ? 0.08692000 0.98218800 0.16658800 -144.18993 0.03476800 -0.17010900 0.98481200 -160.17215 0.99560900 -0.07980800 -0.04893500 -300.55036 539 'point symmetry operation' ? ? 0.25954600 0.96557800 0.01712800 -214.21753 0.43606800 -0.13300300 0.89003100 10.91836 0.86167300 -0.22353500 -0.45557900 34.09250 540 'point symmetry operation' ? ? 0.24804300 0.96802900 0.03733200 -288.63095 0.29527600 -0.11225000 0.94879500 19.45602 0.92265200 -0.22431800 -0.31367900 -37.84053 541 'point symmetry operation' ? ? 0.19239000 0.97800200 0.08060500 -3.92431 0.37767600 -0.14960700 0.91377200 -335.20800 0.90573000 -0.14535700 -0.39815100 -217.58686 542 'point symmetry operation' ? ? -0.54876000 0.67999600 -0.48627900 222.85571 0.30006200 0.70314300 0.64463400 59.73775 0.78027200 0.20783500 -0.58989800 39.02444 543 'point symmetry operation' ? ? 0.17165100 0.97913200 0.10879300 -22.83997 0.34722400 -0.16347500 0.92342400 -231.68985 0.92193900 -0.12073100 -0.36803900 -157.70005 544 'point symmetry operation' ? ? 0.15772600 0.98338000 0.08991900 -13.39351 0.36732100 -0.14295200 0.91904300 -283.13852 0.91662300 -0.11192800 -0.38376400 -188.11577 545 'point symmetry operation' ? ? 0.20648600 0.97138000 0.11740800 -85.36337 0.33658900 -0.18319000 0.92366100 -193.27315 0.91873400 -0.15120400 -0.36478300 -141.49570 546 'point symmetry operation' ? ? 0.14605200 0.97873000 0.14407000 7.88738 0.21540800 -0.17360000 0.96097000 -224.93565 0.96554100 -0.10931700 -0.23618100 -207.74150 547 'point symmetry operation' ? ? 0.12001400 0.98246500 0.14268300 -176.69401 0.12434900 -0.15746600 0.97966400 -146.17850 0.98495400 -0.09983100 -0.14106700 -242.73172 548 'point symmetry operation' ? ? 0.15056400 0.98040100 0.12705700 -39.33819 0.29202400 -0.16689400 0.94173700 -204.21296 0.94448500 -0.10468800 -0.31142900 -164.95500 549 'point symmetry operation' ? ? 0.15115700 0.97819400 0.14243400 3.95697 0.30531200 -0.18324400 0.93445500 -234.27192 0.94017900 -0.09776300 -0.32635300 -169.39723 550 'point symmetry operation' ? ? -0.69430000 0.67528000 -0.24888500 -29.41344 0.09435600 0.42825100 0.89872000 -14.22070 0.71347300 0.60049800 -0.36105200 -37.13434 551 'point symmetry operation' ? ? 0.23103900 0.97073800 0.06548200 -41.19590 0.38696800 -0.15343300 0.90923800 -287.99993 0.89267900 -0.18473000 -0.41109400 -186.27708 552 'point symmetry operation' ? ? 0.14657300 0.97796400 0.14866500 63.07780 0.24984100 -0.18201500 0.95102600 -246.83401 0.95712900 -0.10225200 -0.27101500 -193.24479 553 'point symmetry operation' ? ? 0.44721400 0.85065100 -0.27639400 0.00000 0.52573200 0.00000000 0.85065100 0.00000 0.72360600 -0.52573200 -0.44721400 0.00000 554 'point symmetry operation' ? ? 0.98231600 0.18101700 -0.04785100 -195.30141 0.16135900 -0.68881300 0.70675400 -68.48354 0.09497400 -0.70197500 -0.70584000 105.03964 555 'point symmetry operation' ? ? 0.95030400 0.23306300 0.20640900 -301.54858 0.02551600 -0.71908000 0.69446000 -162.56423 0.31027600 -0.65468100 -0.68929100 5.82872 556 'point symmetry operation' ? ? 0.98103400 0.17720000 0.07857100 -259.43342 0.06583900 -0.68586200 0.72474800 1.52090 0.18231300 -0.70582900 -0.68452000 119.57600 557 'point symmetry operation' ? ? 0.98060900 0.19020300 0.04722500 -233.77853 0.10361400 -0.70771100 0.69886400 -28.80103 0.16634700 -0.68041800 -0.71369400 113.63952 558 'point symmetry operation' ? ? 0.98596700 0.07985000 -0.14660800 -137.77928 0.16239500 -0.66233000 0.73140100 -71.16753 -0.03870100 -0.74494500 -0.66600200 88.14168 559 'point symmetry operation' ? ? 0.55845100 0.66449200 -0.49657200 140.98798 0.56235700 0.13680400 0.81550000 -45.24994 0.60982500 -0.73466700 -0.29728300 -144.05540 560 'point symmetry operation' ? ? 0.98434600 0.16260000 -0.06801200 -238.83009 0.16440500 -0.70798800 0.68682200 -156.35395 0.06352500 -0.68725100 -0.72363700 101.23205 561 'point symmetry operation' ? ? 0.60240100 0.61223300 -0.51213700 178.81081 0.51644900 0.19025700 0.83491500 -11.84034 0.60859900 -0.76744600 -0.20157600 -207.16158 562 'point symmetry operation' ? ? 0.95848600 0.22604400 0.17380800 -272.91505 0.04489600 -0.72158900 0.69086500 -221.29649 0.28158300 -0.65438100 -0.70178100 -19.63473 563 'point symmetry operation' ? ? 0.98513500 0.10021400 -0.13952200 -211.36029 0.17054300 -0.66793000 0.72442100 -172.86372 -0.02059400 -0.73744600 -0.67509200 86.63036 564 'point symmetry operation' ? ? 0.94189700 0.23737000 0.23766800 -328.74709 0.00533000 -0.71802400 0.69599800 -102.05835 0.33586000 -0.65429100 -0.67757000 32.24932 565 'point symmetry operation' ? ? 0.61724100 0.56034400 -0.55229500 53.44008 0.54021000 0.20851600 0.81528900 -191.34547 0.57200400 -0.80158400 -0.17399800 -212.16722 566 'point symmetry operation' ? ? 0.98577900 0.12756700 -0.10939400 -186.53341 0.16726000 -0.68181300 0.71214900 -115.81358 0.01626000 -0.72031800 -0.69345400 93.23402 567 'point symmetry operation' ? ? 0.97642800 -0.00758100 -0.21571200 -229.18458 0.16966500 -0.59082500 0.78875900 -270.17917 -0.13342800 -0.80676400 -0.57561100 40.69426 568 'point symmetry operation' ? ? 0.98283700 0.05056600 -0.17741500 -161.19721 0.16880600 -0.63442200 0.75433000 -140.29436 -0.07441300 -0.77133100 -0.63206900 66.79560 569 'point symmetry operation' ? ? 0.97384400 0.22159400 -0.05025800 -213.82996 0.19661200 -0.71090700 0.67524600 -230.68681 0.11390100 -0.66746400 -0.73587900 47.21766 570 'point symmetry operation' ? ? 0.97571300 0.20868000 -0.06661300 -254.13227 0.19905700 -0.71771600 0.66727900 -264.35242 0.09143800 -0.66433200 -0.74182300 64.25078 571 'point symmetry operation' ? ? 0.98356800 0.07431700 -0.16453600 -240.59264 0.17294000 -0.64947900 0.74045200 -234.92807 -0.05183400 -0.75673900 -0.65165900 76.43939 572 'point symmetry operation' ? ? 0.99387300 -0.00187300 -0.11052200 -88.97167 0.08712700 -0.60204600 0.79369500 87.36027 -0.06802600 -0.79846000 -0.59819300 104.65794 573 'point symmetry operation' ? ? 0.62628100 0.56895500 -0.53297700 152.71186 0.51188600 0.21553000 0.83157700 -56.59710 0.58800100 -0.79362300 -0.15625800 -236.09280 574 'point symmetry operation' ? ? 0.98988300 0.12603500 -0.06518300 -166.59848 0.13383300 -0.67667800 0.72401500 -24.91484 0.04714300 -0.72541200 -0.68669900 108.32775 575 'point symmetry operation' ? ? 0.97986300 0.02149000 -0.19851300 -193.59165 0.17004800 -0.61090600 0.77322600 -206.83267 -0.10465700 -0.79141200 -0.60225800 51.66779 576 'point symmetry operation' ? ? 0.96498800 0.23074300 0.12473000 -270.68302 0.08194000 -0.71692200 0.69232300 -120.05898 0.24916900 -0.65786200 -0.71072700 53.51070 577 'point symmetry operation' ? ? 0.98997400 0.13913200 -0.02438000 -137.03619 0.11510800 -0.69459500 0.71013400 162.63116 0.08186700 -0.70582000 -0.70364500 187.70857 578 'point symmetry operation' ? ? 0.96372400 0.21132300 0.16303200 -303.78294 0.04053500 -0.71962800 0.69317700 -62.92328 0.26380600 -0.66142200 -0.70208800 80.52525 579 'point symmetry operation' ? ? 0.54130300 0.71050200 -0.44964400 143.99195 0.56369500 0.09014800 0.82104900 -5.53397 0.62389000 -0.69789800 -0.35170900 -104.49390 580 'point symmetry operation' ? ? 0.97794100 0.20474300 0.04139900 -237.02158 0.12142400 -0.71845900 0.68488900 -76.41446 0.16996900 -0.66475300 -0.72747100 96.51519 581 'point symmetry operation' ? ? 0.59574100 0.58787000 -0.54726900 95.95256 0.55531000 0.19080800 0.80945900 -134.36938 0.58027900 -0.78613100 -0.21277700 -193.53082 582 'point symmetry operation' ? ? 0.95543500 0.20609800 0.21135000 -340.83542 -0.00956700 -0.69395200 0.71995800 31.16999 0.29504800 -0.68989400 -0.66105400 111.88288 583 'point symmetry operation' ? ? 0.92724800 0.24177600 0.28593100 -330.73120 -0.02505300 -0.72183800 0.69160900 -200.41586 0.37361000 -0.64845600 -0.66326500 -42.70702 584 'point symmetry operation' ? ? 0.93108700 0.23926100 0.27537600 -363.09268 -0.02296200 -0.71493800 0.69881200 -44.82942 0.36407400 -0.65697700 -0.66017500 54.13443 585 'point symmetry operation' ? ? 0.97923600 0.11445200 -0.16732700 -44.14137 0.20023000 -0.67515500 0.70998200 134.74722 -0.03171300 -0.72874400 -0.68405200 164.51578 586 'point symmetry operation' ? ? 0.99260600 0.12009300 -0.01765100 -133.15906 0.09308800 -0.65980600 0.74564800 185.39345 0.07790000 -0.74177700 -0.66610700 181.70396 587 'point symmetry operation' ? ? 0.97899500 0.18450700 -0.08675500 -284.15006 0.19246300 -0.69589100 0.69187800 -268.88256 0.06728400 -0.69404200 -0.71678400 81.76147 588 'point symmetry operation' ? ? 0.57823000 0.61675000 -0.53410700 131.23754 0.56531000 0.16916300 0.80734800 -82.66255 0.58828200 -0.76876800 -0.25083900 -175.21375 589 'point symmetry operation' ? ? 0.97798500 0.20329700 -0.04708700 -210.21807 0.18001700 -0.70777400 0.68311900 -174.01619 0.10554900 -0.67655500 -0.72878800 67.80836 590 'point symmetry operation' ? ? 0.97347500 0.21810200 -0.06913100 -247.52903 0.20446000 -0.69366700 0.69066800 -221.19157 0.10268100 -0.68648200 -0.71986000 74.41872 591 'point symmetry operation' ? ? 0.98492600 0.16805300 -0.04099400 -208.24724 0.15093800 -0.71916700 0.67824600 -106.18603 0.08449900 -0.67420900 -0.73369100 100.10065 592 'point symmetry operation' ? ? 0.97307100 0.21069800 0.09348400 -242.08381 0.08842200 -0.71572900 0.69275900 -186.61306 0.21287200 -0.66583700 -0.71508500 19.64376 593 'point symmetry operation' ? ? 0.95707900 0.22477600 0.18296800 -319.45975 0.03005900 -0.70487200 0.70869900 -14.40284 0.28826700 -0.67278000 -0.68137400 96.15495 594 'point symmetry operation' ? ? 0.97601200 0.21720600 0.01496900 -215.45350 0.14775300 -0.71128600 0.68719900 -142.08950 0.15991000 -0.66850200 -0.72631600 62.05661 595 'point symmetry operation' ? ? 0.97586700 0.21830400 0.00527000 -211.66385 0.15815500 -0.72321600 0.67227000 -191.85600 0.15057000 -0.65521200 -0.74028800 44.54425 596 'point symmetry operation' ? ? 0.41175300 0.89399300 -0.17674000 -47.59400 0.48443600 -0.05045700 0.87337100 5.78399 0.77186900 -0.44523200 -0.45385800 12.15309 597 'point symmetry operation' ? ? 0.98374900 0.14565600 -0.10499500 -257.22137 0.17726300 -0.69471600 0.69710000 -208.78268 0.02859500 -0.70438200 -0.70924500 97.91481 598 'point symmetry operation' ? ? 0.97478800 0.21452800 0.06137600 -214.90577 0.11597300 -0.72208700 0.68201300 -236.76936 0.19062900 -0.65769900 -0.72876100 -2.29664 599 'point symmetry operation' ? ? 0.94721300 -0.16246000 -0.27639400 0.00000 0.16246000 -0.50000000 0.85065100 0.00000 -0.27639400 -0.85065100 -0.44721300 0.00000 600 'point symmetry operation' ? ? 0.48276800 -0.74343800 -0.46285400 5.28753 -0.44684900 -0.66366000 0.59990100 59.39095 -0.75316800 -0.08278800 -0.65259800 224.30041 601 'point symmetry operation' ? ? 0.62805000 -0.69026200 -0.35929100 -146.62055 -0.53793200 -0.71873800 0.44050500 45.72865 -0.56230100 -0.08338500 -0.82271800 306.27418 602 'point symmetry operation' ? ? 0.53531500 -0.74749000 -0.39331500 13.48776 -0.52337300 -0.65902900 0.54015000 153.72154 -0.66296300 -0.08330000 -0.74400300 240.40411 603 'point symmetry operation' ? ? 0.53081000 -0.72580100 -0.43755400 9.48948 -0.49256200 -0.68434800 0.53763500 114.11104 -0.68965500 -0.06985900 -0.72076000 235.12636 604 'point symmetry operation' ? ? 0.36479900 -0.81151300 -0.45647300 10.27973 -0.44815700 -0.58277000 0.67789000 23.40891 -0.81613600 -0.04272200 -0.57627900 176.53108 605 'point symmetry operation' ? ? 0.89531800 -0.38072900 -0.23119300 -89.73166 0.12670700 -0.27990200 0.95163100 -119.47858 -0.42702500 -0.88130600 -0.20236000 -142.65405 606 'point symmetry operation' ? ? 0.45617400 -0.74197200 -0.49130600 -36.96501 -0.44557800 -0.66834800 0.59562700 13.88786 -0.77030200 -0.05279500 -0.63549000 300.29140 607 'point symmetry operation' ? ? 0.89805500 -0.41490500 -0.14611800 -123.70885 0.06373300 -0.20594100 0.97648700 -114.68135 -0.43524100 -0.88625200 -0.15850300 -215.80929 608 'point symmetry operation' ? ? 0.61044100 -0.69319300 -0.38320300 -174.47470 -0.52706200 -0.71664200 0.45676000 -18.61708 -0.59124300 -0.07685300 -0.80282400 305.04453 609 'point symmetry operation' ? ? 0.38283600 -0.79890900 -0.46387500 -44.42631 -0.44107600 -0.59927100 0.66807700 -15.61516 -0.81172000 -0.05116000 -0.58180200 282.56370 610 'point symmetry operation' ? ? 0.64258500 -0.68807800 -0.33709400 -116.92489 -0.54932100 -0.72041600 0.42337600 110.66578 -0.53416400 -0.08688300 -0.84090500 305.96105 611 'point symmetry operation' ? ? 0.87693800 -0.45941200 -0.14114000 -220.73130 0.07423400 -0.16066900 0.98421300 -186.21290 -0.47483600 -0.87357100 -0.10679300 -32.95746 612 'point symmetry operation' ? ? 0.41516900 -0.77734300 -0.47262300 -14.54087 -0.44411000 -0.62658000 0.64044000 15.94647 -0.79397800 -0.05599400 -0.60536200 237.55904 613 'point symmetry operation' ? ? 0.27853300 -0.87964200 -0.38555000 -117.54254 -0.43666800 -0.47353100 0.76491100 -83.86810 -0.85541800 -0.04469500 -0.51600600 326.07994 614 'point symmetry operation' ? ? 0.33341100 -0.83837200 -0.43124100 -35.45651 -0.44113000 -0.54298000 0.71454700 -18.75112 -0.83321200 -0.04800400 -0.55086600 220.27229 615 'point symmetry operation' ? ? 0.50589900 -0.70369700 -0.49887500 -95.77131 -0.41334900 -0.70538500 0.57582600 -60.94335 -0.75710600 -0.08510000 -0.64772600 297.12424 616 'point symmetry operation' ? ? 0.48712700 -0.70735800 -0.51220300 -103.96747 -0.41247000 -0.70330300 0.57899400 -64.49027 -0.76979000 -0.07077500 -0.63436100 351.60375 617 'point symmetry operation' ? ? 0.35495700 -0.82068500 -0.44775100 -80.43233 -0.43821600 -0.56912200 0.69575000 -48.64389 -0.82581700 -0.05074900 -0.56165000 331.78801 618 'point symmetry operation' ? ? 0.32164500 -0.87309800 -0.36639200 84.38255 -0.51369700 -0.48596400 0.70707500 122.97211 -0.79540000 -0.03921300 -0.60481500 65.25694 619 'point symmetry operation' ? ? 0.88707200 -0.44733300 -0.11400100 -170.79340 0.04600600 -0.16005600 0.98603500 -135.54972 -0.45933300 -0.87992900 -0.12140100 -186.33234 620 'point symmetry operation' ? ? 0.43548900 -0.78110300 -0.44746700 30.06603 -0.47356500 -0.62152500 0.62405300 77.76759 -0.76556200 -0.05986400 -0.64057100 182.09586 621 'point symmetry operation' ? ? 0.30561000 -0.86067100 -0.40724400 -78.19827 -0.43837800 -0.50686400 0.74223600 -53.54073 -0.84523900 -0.04830800 -0.53220100 271.92898 622 'point symmetry operation' ? ? 0.59353900 -0.69337900 -0.40857800 -81.63208 -0.50091500 -0.71562800 0.48678600 61.97377 -0.62991800 -0.08426400 -0.77207800 282.91738 623 'point symmetry operation' ? ? 0.46165900 -0.76355000 -0.45151100 161.06143 -0.48876800 -0.64371800 0.58884000 212.11911 -0.74025500 -0.05115900 -0.67037700 97.60588 624 'point symmetry operation' ? ? 0.59528900 -0.70430100 -0.38676900 -54.42623 -0.53367000 -0.70640300 0.46496400 127.65313 -0.60069000 -0.07038100 -0.79637800 288.91197 625 'point symmetry operation' ? ? 0.90204600 -0.34346000 -0.26143500 -42.81999 0.13786900 -0.34469100 0.92853700 -89.11340 -0.40903000 -0.87362700 -0.26357400 -148.01520 626 'point symmetry operation' ? ? 0.53776500 -0.70935500 -0.45565700 -19.51624 -0.47658500 -0.70159000 0.52975300 77.49721 -0.69546800 -0.06772400 -0.71535800 254.84667 627 'point symmetry operation' ? ? 0.88053000 -0.44028700 -0.17553900 -173.70419 0.09908700 -0.19117400 0.97654200 -165.10651 -0.46351700 -0.87726900 -0.12470700 -85.33938 628 'point symmetry operation' ? ? 0.60706400 -0.72490900 -0.32554500 -15.05101 -0.56933000 -0.68256000 0.45823000 225.55503 -0.55438000 -0.09283200 -0.82707000 280.27922 629 'point symmetry operation' ? ? 0.66306300 -0.68226700 -0.30799100 -210.54048 -0.56529100 -0.72609100 0.39145700 32.25918 -0.49070800 -0.08545700 -0.86712300 325.58484 630 'point symmetry operation' ? ? 0.65647300 -0.68898500 -0.30715300 -94.73313 -0.56585600 -0.71903000 0.40348800 177.15275 -0.49885000 -0.09107500 -0.86189000 310.51406 631 'point symmetry operation' ? ? 0.37856000 -0.78787300 -0.48574400 166.59717 -0.41359100 -0.61348500 0.67274000 134.95834 -0.82803100 -0.05377200 -0.55809800 34.67391 632 'point symmetry operation' ? ? 0.45327500 -0.79345500 -0.40616500 163.07693 -0.50812900 -0.60438300 0.61361700 228.25525 -0.73235800 -0.07175300 -0.67712900 80.14819 633 'point symmetry operation' ? ? 0.46497600 -0.73694000 -0.49062800 -100.35681 -0.41973300 -0.67143700 0.61073400 -50.51123 -0.77950100 -0.07804400 -0.62152100 383.53746 634 'point symmetry operation' ? ? 0.88398100 -0.41999700 -0.20537600 -130.96274 0.11747000 -0.22566100 0.96709800 -144.01483 -0.45252400 -0.87902200 -0.15014300 -129.86404 635 'point symmetry operation' ? ? 0.49556400 -0.71762500 -0.48931600 -61.15090 -0.42920900 -0.69209500 0.58033100 -17.21890 -0.75511400 -0.07757300 -0.65098800 273.92561 636 'point symmetry operation' ? ? 0.49779300 -0.71743900 -0.48732200 -81.13843 -0.40678200 -0.68938500 0.59939700 -33.45373 -0.76598300 -0.10014200 -0.63501300 328.68186 637 'point symmetry operation' ? ? 0.47160400 -0.73127200 -0.49277700 -13.72456 -0.45681400 -0.68059700 0.57280800 36.49839 -0.75426200 -0.04503200 -0.65502700 251.28066 638 'point symmetry operation' ? ? 0.56570200 -0.70745100 -0.42366600 -119.07104 -0.50042200 -0.70288200 0.50550500 -8.67976 -0.65540800 -0.07395300 -0.75164600 282.06657 639 'point symmetry operation' ? ? 0.61201000 -0.70571300 -0.35694800 -33.36420 -0.53823800 -0.70237300 0.46580300 176.12156 -0.57943400 -0.09295300 -0.80970100 281.73694 640 'point symmetry operation' ? ? 0.53499200 -0.70631200 -0.46358000 -59.79720 -0.45415000 -0.70311300 0.54715700 11.68763 -0.71241300 -0.08219000 -0.69693100 258.35690 641 'point symmetry operation' ? ? 0.52931900 -0.69716400 -0.48351100 -87.17150 -0.44565000 -0.71341000 0.54078000 -30.80179 -0.72195400 -0.07076900 -0.68831300 273.94670 642 'point symmetry operation' ? ? 0.96669500 -0.08804100 -0.24030900 -4.82923 0.14989400 -0.56629700 0.81045700 32.65439 -0.20743900 -0.81948600 -0.53423900 36.83353 643 'point symmetry operation' ? ? 0.42809600 -0.75993600 -0.48911200 -60.36775 -0.43482400 -0.64765200 0.62568000 -17.71772 -0.79225100 -0.05517300 -0.60769500 339.67933 644 'point symmetry operation' ? ? 0.55367100 -0.70045800 -0.45034000 -142.04635 -0.47914200 -0.71027700 0.51568400 -65.23188 -0.68108100 -0.06974300 -0.72887900 278.95703 645 'point symmetry operation' ? ? 0.13819600 -0.95105700 -0.27639300 0.00000 -0.42532500 -0.30901700 0.85065100 0.00000 -0.89442700 0.00000000 -0.44721300 0.00000 646 'point symmetry operation' ? ? -0.61644800 -0.51748000 -0.59347100 218.14531 -0.64527200 -0.09993000 0.75738900 44.94040 -0.45123900 0.84984000 -0.27231300 65.26043 647 'point symmetry operation' ? ? -0.41711000 -0.51325300 -0.75006100 232.91264 -0.80435500 -0.17574500 0.56756200 123.17672 -0.42312200 0.84005000 -0.33953200 219.02460 648 'point symmetry operation' ? ? -0.53687000 -0.51818700 -0.66577300 260.31205 -0.73806700 -0.09380200 0.66817500 116.43545 -0.40869000 0.85010800 -0.33209700 16.93595 649 'point symmetry operation' ? ? -0.55427500 -0.50497300 -0.66165100 243.73266 -0.71049300 -0.12703400 0.69214300 86.74002 -0.43356600 0.85373500 -0.28836800 38.29333 650 'point symmetry operation' ? ? -0.71579300 -0.48501000 -0.50240000 167.76688 -0.57699000 0.00552400 0.81673200 12.89597 -0.39334800 0.87449000 -0.28380000 59.20183 651 'point symmetry operation' ? ? -0.02470700 -0.99959000 -0.01449200 -191.46575 -0.42374700 -0.00265800 0.90577700 -43.91727 -0.90544300 0.02851900 -0.42350700 63.94719 652 'point symmetry operation' ? ? -0.64106100 -0.49135500 -0.58958600 258.86541 -0.62861300 -0.10458400 0.77065400 32.96308 -0.44032600 0.86465700 -0.24182700 153.74125 653 'point symmetry operation' ? ? -0.04761800 -0.99693700 0.06205000 -267.92984 -0.47630200 0.07726500 0.87588000 -20.06496 -0.87799100 0.01215300 -0.47852200 53.29525 654 'point symmetry operation' ? ? -0.44651100 -0.50792000 -0.73664500 204.82079 -0.78521000 -0.17232700 0.59476700 87.49220 -0.42903800 0.84399100 -0.32187800 272.45869 655 'point symmetry operation' ? ? -0.70345700 -0.49233500 -0.51259700 232.55441 -0.58186300 -0.01523300 0.81314400 13.48029 -0.40814800 0.87027200 -0.27575600 166.72288 656 'point symmetry operation' ? ? -0.38967900 -0.51603200 -0.76279900 260.44631 -0.82211200 -0.17838700 0.54065700 158.25727 -0.41506900 0.83778800 -0.35472300 163.25712 657 'point symmetry operation' ? ? -0.08791400 -0.98979700 0.11213300 -158.28843 -0.45539500 0.14005100 0.87920500 -20.90676 -0.88593800 0.02622900 -0.46306100 242.88152 658 'point symmetry operation' ? ? -0.67668800 -0.49603400 -0.54410000 211.41015 -0.60332300 -0.05000300 0.79592800 21.44794 -0.42201400 0.86686200 -0.26543200 108.37795 659 'point symmetry operation' ? ? -0.77912100 -0.48270900 -0.39995400 227.08145 -0.51699000 0.13394600 0.84544700 1.23917 -0.35453300 0.86547600 -0.35391600 274.97402 660 'point symmetry operation' ? ? -0.74057600 -0.48899300 -0.46090400 179.26024 -0.55285500 0.05350300 0.83155800 5.67091 -0.38196600 0.87064500 -0.30996500 134.02338 661 'point symmetry operation' ? ? -0.60279600 -0.51613800 -0.60847300 215.08573 -0.63176600 -0.15704500 0.75908400 6.98886 -0.48735000 0.84198400 -0.23141200 234.21858 662 'point symmetry operation' ? ? -0.62070100 -0.50410200 -0.60050900 259.91592 -0.62002100 -0.15320900 0.76948100 8.93694 -0.47990100 0.84994500 -0.21745700 266.37808 663 'point symmetry operation' ? ? -0.72540100 -0.49192100 -0.48146500 254.87275 -0.56316200 0.02195700 0.82605500 7.92331 -0.39578200 0.87036200 -0.29295900 232.15509 664 'point symmetry operation' ? ? -0.73008800 -0.47870600 -0.48766000 121.22266 -0.60464800 0.12004100 0.78739500 49.88769 -0.31839200 0.86973000 -0.37708900 -96.52625 665 'point symmetry operation' ? ? -0.07780000 -0.99095300 0.10936500 -264.08580 -0.48418900 0.13344700 0.86472700 -9.27221 -0.87149800 0.01432300 -0.49019000 111.51958 666 'point symmetry operation' ? ? -0.65166200 -0.49952700 -0.57079700 194.19195 -0.63909700 -0.04370300 0.76788400 45.24297 -0.40852500 0.86519500 -0.29076600 18.79493 667 'point symmetry operation' ? ? -0.76066800 -0.48783900 -0.42825000 200.85427 -0.53428800 0.09582800 0.83985300 2.64852 -0.36867500 0.86765700 -0.33354000 206.34316 668 'point symmetry operation' ? ? -0.48034400 -0.51434900 -0.71043300 239.80503 -0.75412200 -0.17139700 0.63397400 98.12003 -0.44785000 0.84027800 -0.30555200 153.01247 669 'point symmetry operation' ? ? -0.62355500 -0.49122500 -0.60817600 201.33283 -0.66677800 -0.07197500 0.74177300 76.93840 -0.40815100 0.86805400 -0.28265700 -184.41206 670 'point symmetry operation' ? ? -0.46217900 -0.50345900 -0.73001400 272.27479 -0.78165000 -0.15751400 0.60350000 135.26453 -0.41882500 0.84954000 -0.32072900 101.47732 671 'point symmetry operation' ? ? -0.00324300 -0.99626800 -0.08625600 -171.30614 -0.41867100 -0.07698100 0.90486900 -46.92531 -0.90813200 0.03904700 -0.41685900 11.64011 672 'point symmetry operation' ? ? -0.55275800 -0.50164500 -0.66544100 241.25214 -0.70165600 -0.15065000 0.69640800 74.16796 -0.44959800 0.85185500 -0.26870900 87.35029 673 'point symmetry operation' ? ? -0.06995700 -0.99420300 0.08164700 -182.57753 -0.43739900 0.10413100 0.89321800 -31.47320 -0.89654200 0.02677400 -0.44214800 174.33020 674 'point symmetry operation' ? ? -0.42587200 -0.52472800 -0.73708500 304.53457 -0.81742100 -0.12611200 0.56206600 191.32462 -0.38788700 0.84187600 -0.37521600 17.65438 675 'point symmetry operation' ? ? -0.34760000 -0.51414600 -0.78411000 223.51749 -0.84706800 -0.18639300 0.49772800 149.85088 -0.40205700 0.83720400 -0.37072600 280.99480 676 'point symmetry operation' ? ? -0.35741500 -0.51974600 -0.77596400 290.02485 -0.84365200 -0.17673200 0.50696800 199.00235 -0.40063200 0.83584100 -0.37531800 114.28091 677 'point symmetry operation' ? ? -0.71236800 -0.49441500 -0.49808200 126.76468 -0.55711400 -0.03321900 0.82977100 11.26021 -0.42679700 0.86859000 -0.25178200 -175.99597 678 'point symmetry operation' ? ? -0.62461400 -0.51012400 -0.59129600 190.68905 -0.67751300 -0.02257500 0.73516400 88.80812 -0.38837300 0.85980400 -0.33151500 -202.16108 679 'point symmetry operation' ? ? -0.63931000 -0.51293000 -0.57287500 293.45926 -0.61287800 -0.11004100 0.78247800 18.12393 -0.46439600 0.85134800 -0.24401300 270.69736 680 'point symmetry operation' ? ? -0.05404300 -0.99749600 0.04561900 -201.39332 -0.42455600 0.06430400 0.90311500 -39.53247 -0.90378700 0.02943900 -0.42696800 112.40162 681 'point symmetry operation' ? ? -0.60892200 -0.51095100 -0.60674900 218.35569 -0.63852200 -0.13810800 0.75711000 22.01329 -0.47064200 0.84844300 -0.24215700 175.80497 682 'point symmetry operation' ? ? -0.61194200 -0.53035800 -0.58672700 255.83202 -0.62169000 -0.13602400 0.77136200 20.62744 -0.48890700 0.83679000 -0.24647900 223.29098 683 'point symmetry operation' ? ? -0.62408500 -0.48376000 -0.61359100 229.38087 -0.64677200 -0.12078300 0.75305900 37.59497 -0.43841100 0.86682600 -0.23750400 103.11898 684 'point symmetry operation' ? ? -0.51308500 -0.50686800 -0.69269700 206.92611 -0.73736100 -0.15281400 0.65798600 62.96620 -0.43936600 0.84837000 -0.29533800 216.86782 685 'point symmetry operation' ? ? -0.43831900 -0.52309900 -0.73092000 286.21825 -0.79517400 -0.15342300 0.58665100 162.09634 -0.41901700 0.83834800 -0.34870600 57.54655 686 'point symmetry operation' ? ? -0.56302000 -0.51388400 -0.64725100 212.51891 -0.68187600 -0.15367000 0.71514400 44.60347 -0.46696400 0.84398400 -0.26388500 152.66582 687 'point symmetry operation' ? ? -0.57137200 -0.50306500 -0.64842900 205.38972 -0.67166500 -0.16737800 0.72170000 26.31904 -0.47159400 0.84788600 -0.24225600 201.78403 688 'point symmetry operation' ? ? 0.20361700 -0.91368400 -0.35174200 39.78140 -0.44694200 -0.40639500 0.79692300 29.25650 -0.87108100 -0.00505900 -0.49111200 2.79949 689 'point symmetry operation' ? ? -0.66802500 -0.49454200 -0.55603200 277.31983 -0.60340900 -0.07728200 0.79367800 21.14944 -0.43547800 0.86571100 -0.24678400 204.90649 690 'point symmetry operation' ? ? -0.53480700 -0.50251600 -0.67930800 180.96668 -0.71307400 -0.16290700 0.68190000 30.71914 -0.45332900 0.84908100 -0.27120700 261.83349 691 'point symmetry operation' ? ? 0.80901700 0.58778500 -0.00000100 0.00000 0.58778500 -0.80901700 0.00000000 0.00000 -0.00000100 0.00000000 -1.00000000 0.00000 692 'point symmetry operation' ? ? 0.94144300 -0.33099000 0.06427300 -168.40689 -0.28715100 -0.88698200 -0.36167300 151.25594 0.17671900 0.32203900 -0.93008700 51.25065 693 'point symmetry operation' ? ? 0.91558600 -0.28593800 0.28274000 -327.40709 -0.13236600 -0.87824000 -0.45953700 82.97909 0.37971200 0.38332100 -0.84195200 57.54598 694 'point symmetry operation' ? ? 0.92385100 -0.33408900 0.18677000 -189.88368 -0.24182800 -0.88772400 -0.39174600 212.53078 0.29667800 0.31674900 -0.90091700 -19.52346 695 'point symmetry operation' ? ? 0.93513900 -0.32515200 0.14068300 -182.31168 -0.24355500 -0.87839100 -0.41122900 187.19926 0.25728700 0.35029300 -0.90061000 10.70587 696 'point symmetry operation' ? ? 0.90808300 -0.41878800 0.00065800 -124.64619 -0.40209400 -0.87232200 -0.27816400 111.58670 0.11706600 0.25233200 -0.96053300 61.87553 697 'point symmetry operation' ? ? 0.88901100 0.42779000 -0.16326200 62.44204 0.45500300 -0.86529500 0.21032400 -196.48947 -0.05129500 -0.26126400 -0.96390300 13.03654 698 'point symmetry operation' ? ? 0.93579500 -0.35094800 0.03350100 -244.34591 -0.31382500 -0.87254900 -0.37439500 139.37736 0.16062500 0.33984400 -0.92666400 112.26380 699 'point symmetry operation' ? ? 0.90702300 0.39642800 -0.14196500 91.80570 0.42108100 -0.85443400 0.30435700 -255.93362 -0.00064500 -0.33583700 -0.94192000 -33.15128 700 'point symmetry operation' ? ? 0.92295000 -0.29297100 0.24966300 -334.74885 -0.15426600 -0.87577500 -0.45740600 30.99077 0.35265600 0.38364900 -0.85349100 104.03312 701 'point symmetry operation' ? ? 0.91583700 -0.40154700 0.00128300 -231.73017 -0.38382000 -0.87633500 -0.29106700 110.17104 0.11800200 0.26607800 -0.95670200 127.37024 702 'point symmetry operation' ? ? 0.90682600 -0.28166900 0.31357300 -317.80973 -0.11326500 -0.87941400 -0.46238600 135.71933 0.40600100 0.38378800 -0.82937900 10.37479 703 'point symmetry operation' ? ? 0.91980200 0.35004100 -0.17729900 -93.97071 0.39098200 -0.85576100 0.33883100 -262.33859 -0.03312100 -0.38097800 -0.92399100 82.65459 704 'point symmetry operation' ? ? 0.92518200 -0.37914600 0.01695300 -184.24424 -0.35375900 -0.87768800 -0.32329300 122.85843 0.13745500 0.29310800 -0.94614700 88.65575 705 'point symmetry operation' ? ? 0.87677300 -0.48081000 -0.00951700 -301.17830 -0.47637000 -0.86562500 -0.15415700 48.60443 0.06588200 0.13969500 -0.98800000 184.68192 706 'point symmetry operation' ? ? 0.89824200 -0.43944800 -0.00676000 -180.12910 -0.42916000 -0.87368800 -0.22911000 82.02749 0.09477600 0.20869800 -0.97337700 104.65948 707 'point symmetry operation' ? ? 0.95436700 -0.29587800 0.04049400 -269.34553 -0.25655300 -0.88171100 -0.39593800 59.82668 0.15285400 0.36748100 -0.91738400 158.24899 708 'point symmetry operation' ? ? 0.95080900 -0.30903800 0.02136900 -313.68918 -0.27570100 -0.87565800 -0.39650000 81.05424 0.14124500 0.37110500 -0.91778600 183.36480 709 'point symmetry operation' ? ? 0.90687100 -0.42135000 -0.00697800 -286.13693 -0.40898700 -0.87603000 -0.25554100 94.75637 0.10155900 0.23459700 -0.96677300 167.52814 710 'point symmetry operation' ? ? 0.87477800 -0.47836800 0.07699400 -10.59283 -0.45366100 -0.86445600 -0.21658000 153.86499 0.17016300 0.15453100 -0.97322400 -52.09981 711 'point symmetry operation' ? ? 0.91996800 0.36264500 -0.14881900 42.28099 0.39199300 -0.85048400 0.35073900 -283.27406 0.00062600 -0.38100400 -0.92457300 -15.23093 712 'point symmetry operation' ? ? 0.92303600 -0.37968900 0.06196800 -124.23095 -0.33956200 -0.87978300 -0.33268400 155.30838 0.18083500 0.28603800 -0.94100000 23.59270 713 'point symmetry operation' ? ? 0.88784800 -0.46005400 -0.00866700 -240.52835 -0.45323900 -0.87113500 -0.18893900 62.37568 0.07937300 0.17167700 -0.98195100 145.54135 714 'point symmetry operation' ? ? 0.93534900 -0.28789800 0.20551500 -269.54955 -0.17315600 -0.87929200 -0.44369200 123.54676 0.30844600 0.37942100 -0.87229600 51.24392 715 'point symmetry operation' ? ? 0.92474900 -0.37060700 0.08654400 2.95422 -0.31585000 -0.87422400 -0.36874300 268.21508 0.21231800 0.31366100 -0.92549300 -92.27240 716 'point symmetry operation' ? ? 0.92069500 -0.30676900 0.24127400 -266.30730 -0.17296300 -0.87489700 -0.45236900 178.26082 0.34986400 0.37476300 -0.85857300 5.57408 717 'point symmetry operation' ? ? 0.87868900 0.45776000 -0.13550200 92.85758 0.47467500 -0.86800400 0.14578200 -151.84120 -0.05088300 -0.19241600 -0.97999300 -2.22516 718 'point symmetry operation' ? ? 0.94141500 -0.31286400 0.12591000 -210.09078 -0.23383600 -0.87457100 -0.42478900 159.29843 0.24301900 0.37046100 -0.89649400 42.65367 719 'point symmetry operation' ? ? 0.90998400 0.37050200 -0.18616500 -27.94901 0.41183100 -0.85979600 0.30190400 -246.96053 -0.04820800 -0.35139600 -0.93498500 54.27248 720 'point symmetry operation' ? ? 0.90087700 -0.30822100 0.30564700 -249.55200 -0.15834300 -0.88896100 -0.42973900 249.77097 0.40416300 0.33874500 -0.84964900 -70.68390 721 'point symmetry operation' ? ? 0.89171300 -0.27788100 0.35725300 -382.07096 -0.08431100 -0.87750300 -0.47210100 42.40741 0.44467900 0.39085900 -0.80590900 59.97277 722 'point symmetry operation' ? ? 0.89327500 -0.27946900 0.35207400 -317.01909 -0.09341000 -0.88155000 -0.46275800 186.62866 0.43969800 0.38048300 -0.81357100 -38.01260 723 'point symmetry operation' ? ? 0.92030600 -0.38994500 -0.03129700 64.74120 -0.38159600 -0.87722000 -0.29132400 200.35905 0.08614600 0.28005100 -0.95611200 -53.24952 724 'point symmetry operation' ? ? 0.91655500 -0.38215700 0.11782300 14.31728 -0.32714800 -0.88596300 -0.32869800 268.49215 0.23000200 0.26272500 -0.93705600 -113.24887 725 'point symmetry operation' ? ? 0.94415700 -0.32879900 0.02139300 -336.64555 -0.29968100 -0.88390500 -0.35903100 107.31712 0.13695900 0.33257100 -0.93308000 186.75266 726 'point symmetry operation' ? ? 0.90135800 0.39098400 -0.18624000 29.51461 0.42917700 -0.86399800 0.26327700 -230.40838 -0.05797400 -0.31723600 -0.94657300 28.23221 727 'point symmetry operation' ? ? 0.94856900 -0.31282700 0.04853600 -236.43824 -0.27054800 -0.88069400 -0.38882200 93.31814 0.16438000 0.35569400 -0.92003300 120.24885 728 'point symmetry operation' ? ? 0.95428600 -0.29681200 0.03521700 -286.83076 -0.26351500 -0.89107600 -0.36951800 100.23252 0.14105800 0.34334600 -0.92855600 153.02233 729 'point symmetry operation' ? ? 0.93636500 -0.34739800 0.05035900 -196.96455 -0.30039200 -0.86722800 -0.39708900 140.91004 0.18162100 0.35669300 -0.91639700 77.53536 730 'point symmetry operation' ? ? 0.93504000 -0.30687000 0.17756800 -282.57037 -0.20546800 -0.87718200 -0.43397400 62.00753 0.28893300 0.36930000 -0.88325300 100.61705 731 'point symmetry operation' ? ? 0.91727300 -0.29203800 0.27078300 -254.86073 -0.15256600 -0.88572100 -0.43843200 213.21762 0.36787700 0.36085000 -0.85700300 -33.04301 732 'point symmetry operation' ? ? 0.94817100 -0.30010800 0.10443400 -228.96068 -0.23343500 -0.88084400 -0.41185100 100.51806 0.21559100 0.36612700 -0.90524700 89.07110 733 'point symmetry operation' ? ? 0.94988900 -0.30056300 0.08586400 -251.70198 -0.23810500 -0.87369200 -0.42422500 68.63064 0.20252500 0.38252300 -0.90147600 124.62066 734 'point symmetry operation' ? ? 0.77423200 0.62592600 0.09370800 -35.19755 0.63116100 -0.77456600 -0.04101600 32.36828 0.04691000 0.09090200 -0.99475400 -12.63979 735 'point symmetry operation' ? ? 0.93109500 -0.36463900 0.00997800 -283.41167 -0.33931100 -0.87581300 -0.34324700 128.17643 0.13390100 0.31621000 -0.93919200 150.29557 736 'point symmetry operation' ? ? 0.94209000 -0.30402400 0.14154700 -286.54514 -0.21660500 -0.87385400 -0.43527200 16.28527 0.25602500 0.37940600 -0.88910200 140.98232 737 'point symmetry operation' ? ? 0.80901700 -0.58778500 -0.00000100 0.00000 -0.58778500 -0.80901700 0.00000000 0.00000 -0.00000100 0.00000000 -1.00000000 0.00000 738 'point symmetry operation' ? ? 0.01782600 -0.94585100 -0.32411000 91.81230 -0.98410000 0.04069700 -0.17289100 206.90521 0.17671900 0.32203900 -0.93008700 51.25065 739 'point symmetry operation' ? ? 0.15704500 -0.92361500 -0.34967400 -22.25665 -0.91167700 0.00055200 -0.41090700 337.02464 0.37971200 0.38332100 -0.84195200 57.54598 740 'point symmetry operation' ? ? 0.05549500 -0.94751500 -0.31485800 143.45138 -0.95336300 0.04341600 -0.29868600 246.26577 0.29667800 0.31674900 -0.90091700 -19.52346 741 'point symmetry operation' ? ? 0.05734000 -0.93587700 -0.34763000 121.69958 -0.96463200 0.03780000 -0.26087500 231.23653 0.25728700 0.35029300 -0.90061000 10.70587 742 'point symmetry operation' ? ? -0.10180100 -0.95904000 -0.26434700 67.60744 -0.98789300 0.12872900 -0.08658400 153.02784 0.11706600 0.25233200 -0.96053300 61.87553 743 'point symmetry operation' ? ? 0.70745300 -0.69075000 0.14957800 -167.57688 -0.70489600 -0.67424400 0.22026400 -120.10456 -0.05129500 -0.26126400 -0.96390300 13.03654 744 'point symmetry operation' ? ? -0.00928800 -0.93829200 -0.34571900 57.04867 -0.98697200 0.06413900 -0.14755700 275.45687 0.16062500 0.33984400 -0.92666400 112.26380 745 'point symmetry operation' ? ? 0.68075700 -0.69011200 0.24559000 -215.03777 -0.73250800 -0.64106100 0.22906800 -166.40037 -0.00064500 -0.33583700 -0.94192000 -33.15128 746 'point symmetry operation' ? ? 0.13849200 -0.92344400 -0.35786900 -73.96917 -0.92544800 0.00800300 -0.37879100 327.94182 0.35265600 0.38364900 -0.85349100 104.03312 747 'point symmetry operation' ? ? -0.08202400 -0.95752800 -0.27642500 33.17031 -0.98962000 0.11109200 -0.09116600 254.43334 0.11800200 0.26607800 -0.95670200 127.37024 748 'point symmetry operation' ? ? 0.17250400 -0.92341300 -0.34285600 30.86801 -0.89744400 -0.00387100 -0.44111200 344.19462 0.40600100 0.38378800 -0.82937900 10.37479 749 'point symmetry operation' ? ? 0.65608000 -0.70570800 0.26745800 -278.53731 -0.75396400 -0.59735400 0.27332500 8.30434 -0.03312100 -0.38097800 -0.92399100 82.65459 750 'point symmetry operation' ? ? -0.05054700 -0.95189300 -0.30223100 59.91068 -0.98921700 0.08936800 -0.11602700 213.19213 0.13745500 0.29310800 -0.94614700 88.65575 751 'point symmetry operation' ? ? -0.18211700 -0.97183700 -0.14955300 -46.84365 -0.98106700 0.18978400 -0.03858700 301.45734 0.06588200 0.13969500 -0.98800000 184.68192 752 'point symmetry operation' ? ? -0.13058300 -0.96672300 -0.21998600 22.34982 -0.98689700 0.14795600 -0.06437000 196.66095 0.09477600 0.20869800 -0.97337700 104.65948 753 'point symmetry operation' ? ? 0.05092000 -0.92998800 -0.36404600 -26.33380 -0.98693600 0.00893300 -0.16086500 274.65043 0.15285400 0.36748100 -0.91738400 158.24899 754 'point symmetry operation' ? ? 0.03161000 -0.92829800 -0.37049100 -19.84813 -0.98947000 0.02331900 -0.14284900 323.38344 0.14124500 0.37110500 -0.91778600 183.36480 755 'point symmetry operation' ? ? -0.10873100 -0.96335800 -0.24519100 1.69748 -0.98887000 0.13002000 -0.07233100 301.41388 0.10155900 0.23459700 -0.96677300 167.52814 756 'point symmetry operation' ? ? -0.16113600 -0.96997000 -0.18218800 143.06088 -0.97215200 0.18782300 -0.14015300 57.62129 0.17016300 0.15453100 -0.97322400 -52.09981 757 'point symmetry operation' ? ? 0.65709300 -0.69679500 0.28758400 -256.34405 -0.75380900 -0.60771100 0.24991900 -127.74823 0.00062600 -0.38100400 -0.92457300 -15.23093 758 'point symmetry operation' ? ? -0.03770900 -0.95405400 -0.29725200 109.31752 -0.98279000 0.08923800 -0.16174100 166.14365 0.18083500 0.28603800 -0.94100000 23.59270 759 'point symmetry operation' ? ? -0.15669500 -0.97066300 -0.18237000 -15.00456 -0.98445200 0.16834200 -0.05014400 248.03133 0.07937300 0.17167700 -0.98195100 145.54135 760 'point symmetry operation' ? ? 0.12435800 -0.92522200 -0.35846900 34.20447 -0.94307800 0.00209100 -0.33256600 294.53497 0.30844600 0.37942100 -0.87229600 51.24392 761 'point symmetry operation' ? ? -0.01462700 -0.94596000 -0.32395300 256.00050 -0.97709100 0.08231900 -0.19625700 80.07341 0.21231800 0.31366100 -0.92549300 -92.27240 762 'point symmetry operation' ? ? 0.12001300 -0.92687300 -0.35567200 87.24251 -0.92908100 0.02139600 -0.36925600 308.35896 0.34986400 0.37476300 -0.85857300 5.57408 763 'point symmetry operation' ? ? 0.72297300 -0.68406500 0.09677400 -115.71494 -0.68900000 -0.70358500 0.17391800 -135.23437 -0.05088300 -0.19241600 -0.97999300 -2.22516 764 'point symmetry operation' ? ? 0.06852200 -0.92844700 -0.36509000 86.58011 -0.96759800 0.02729400 -0.25101600 249.03420 0.24301900 0.37046100 -0.89649400 42.65367 765 'point symmetry operation' ? ? 0.67287600 -0.70322300 0.22959900 -243.51008 -0.73818300 -0.61806000 0.27034600 -49.73396 -0.04820800 -0.35139600 -0.93498500 54.27248 766 'point symmetry operation' ? ? 0.12779300 -0.94069700 -0.31425600 160.43032 -0.90571500 0.01843100 -0.42348500 314.52153 0.40416300 0.33874500 -0.84964900 -70.68390 767 'point symmetry operation' ? ? 0.19537000 -0.92042500 -0.33859800 -77.73469 -0.87412300 -0.00688300 -0.48565600 376.47571 0.44467900 0.39085900 -0.80590900 59.97277 768 'point symmetry operation' ? ? 0.18720000 -0.92476400 -0.33131200 79.52994 -0.87842000 -0.00662300 -0.47784400 359.17450 0.43969800 0.38048300 -0.81357100 -38.01260 769 'point symmetry operation' ? ? -0.07852800 -0.95478500 -0.28673800 210.55888 -0.99318300 0.09978400 -0.06026000 0.34185 0.08614600 0.28005100 -0.95611200 -53.24952 770 'point symmetry operation' ? ? -0.02790500 -0.96069400 -0.27620200 259.77539 -0.97279000 0.08967500 -0.21363100 69.35210 0.23000200 0.26272500 -0.93705600 -113.24887 771 'point symmetry operation' ? ? 0.00674700 -0.94224800 -0.33484900 -1.96457 -0.99055300 0.03956500 -0.13129400 353.33193 0.13695900 0.33257100 -0.93308000 186.75266 772 'point symmetry operation' ? ? 0.68670700 -0.70089000 0.19283900 -210.01081 -0.72461900 -0.63883900 0.25848100 -99.27023 -0.05797400 -0.31723600 -0.94657300 28.23221 773 'point symmetry operation' ? ? 0.03581800 -0.93425800 -0.35479400 15.68737 -0.98574600 0.02536700 -0.16631400 253.70315 0.16438000 0.35569400 -0.92003300 120.24885 774 'point symmetry operation' ? ? 0.04427300 -0.93918300 -0.34055100 6.69119 -0.98901100 0.00692700 -0.14768100 303.76596 0.14105800 0.34334600 -0.92855600 153.02233 775 'point symmetry operation' ? ? 0.00366400 -0.93213500 -0.36209300 73.14797 -0.98336200 0.06240600 -0.17060200 230.86812 0.18162100 0.35669300 -0.91639700 77.53536 776 'point symmetry operation' ? ? 0.09353200 -0.92907800 -0.35786300 -28.34643 -0.95276900 0.02078600 -0.30298300 287.90185 0.28893300 0.36930000 -0.88325300 100.61705 777 'point symmetry operation' ? ? 0.13835500 -0.93261500 -0.33329700 124.02556 -0.91952400 0.00404200 -0.39301300 308.27484 0.36787700 0.36085000 -0.85700300 -33.04301 778 'point symmetry operation' ? ? 0.07099100 -0.93047100 -0.35942200 24.84558 -0.97390000 0.01322400 -0.22659300 248.81643 0.21559100 0.36612700 -0.90524700 89.07110 779 'point symmetry operation' ? ? 0.06708100 -0.92381000 -0.37692900 -12.50860 -0.97697700 0.01586600 -0.21275500 260.59095 0.20252500 0.38252300 -0.90147600 124.62066 780 'point symmetry operation' ? ? 0.83952100 -0.54323400 -0.01005200 19.90740 -0.54129800 -0.83464600 -0.10179800 43.47721 0.04691000 0.09090200 -0.99475400 -12.63979 781 'point symmetry operation' ? ? -0.03497900 -0.94562800 -0.32336400 34.32399 -0.99037700 0.07615100 -0.11556000 309.14937 0.13390100 0.31621000 -0.93919200 150.29557 782 'point symmetry operation' ? ? 0.08511900 -0.92503300 -0.37022800 -73.05912 -0.96291500 0.01910800 -0.26912600 277.55315 0.25602500 0.37940600 -0.88910200 140.98232 783 'point symmetry operation' ? ? -0.30901700 -0.95105700 0.00000000 0.00000 -0.95105700 0.30901700 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 784 'point symmetry operation' ? ? -0.93042700 -0.25357900 -0.26458400 225.15023 -0.32105700 0.91213500 0.25482000 -23.38144 0.17672000 0.32203800 -0.93008700 51.25060 785 'point symmetry operation' ? ? -0.81852700 -0.28488800 -0.49885100 313.65198 -0.43108200 0.87858100 0.20558200 125.31379 0.37971300 0.38332000 -0.84195200 57.54576 786 'point symmetry operation' ? ? -0.88955400 -0.25150800 -0.38136300 278.54175 -0.34738400 0.91455700 0.20714800 -60.33014 0.29667900 0.31674900 -0.90091700 -19.52349 787 'point symmetry operation' ? ? -0.89970100 -0.25325200 -0.35553000 257.52640 -0.35262100 0.90175400 0.25000000 -44.28720 0.25728700 0.35029200 -0.90061000 10.70583 788 'point symmetry operation' ? ? -0.97100000 -0.17393100 -0.16403400 166.43006 -0.20845700 0.95188100 0.22465200 -17.01026 0.11706600 0.25233100 -0.96053300 61.87549 789 'point symmetry operation' ? ? -0.45178100 -0.85469800 0.25570600 -166.01042 -0.89065400 0.44858900 -0.07419300 122.26083 -0.05129400 -0.26126400 -0.96390300 13.03648 790 'point symmetry operation' ? ? -0.94153700 -0.22894900 -0.24716800 279.60420 -0.29615700 0.91218900 0.28320000 30.86446 0.16062500 0.33984300 -0.92666400 112.26368 791 'point symmetry operation' ? ? -0.48629200 -0.82294200 0.29374800 -224.70660 -0.87379700 0.45823700 -0.16278500 153.09261 -0.00064400 -0.33583700 -0.94192000 -33.15136 792 'point symmetry operation' ? ? -0.83735700 -0.27774900 -0.47083900 289.03363 -0.41769300 0.88072100 0.22330100 171.68865 0.35265600 0.38364800 -0.85349100 104.03287 793 'point symmetry operation' ? ? -0.96653200 -0.19023800 -0.17212400 252.23080 -0.22779900 0.94499400 0.23472300 47.07752 0.11800300 0.26607700 -0.95670200 127.37012 794 'point symmetry operation' ? ? -0.80021400 -0.28903200 -0.52547100 336.88748 -0.44138600 0.87702300 0.18976400 77.00480 0.40600200 0.38378700 -0.82937900 10.37461 795 'point symmetry operation' ? ? -0.51432200 -0.78619400 0.34259700 -78.17493 -0.85695800 0.48657600 -0.16990700 267.47115 -0.03312000 -0.38097800 -0.92399100 82.65436 796 'point symmetry operation' ? ? -0.95642200 -0.20915700 -0.20374300 221.27130 -0.25761200 0.93292100 0.25158400 8.90162 0.13745500 0.29310700 -0.94614700 88.65567 797 'point symmetry operation' ? ? -0.98932800 -0.11981800 -0.08291200 272.22760 -0.12996300 0.98291900 0.13030900 137.70664 0.06588300 0.13969400 -0.98800100 184.68170 798 'point symmetry operation' ? ? -0.97894800 -0.15802000 -0.12919900 193.94224 -0.18077600 0.96513000 0.18932700 39.51575 0.09477600 0.20869700 -0.97337700 104.65938 799 'point symmetry operation' ? ? -0.92289700 -0.27888600 -0.26548800 253.07060 -0.35340700 0.88723200 0.29651800 109.91678 0.15285500 0.36748100 -0.91738400 158.24881 800 'point symmetry operation' ? ? -0.93127400 -0.26468200 -0.25034500 301.42265 -0.33582600 0.89007100 0.30821400 118.80790 0.14124600 0.37110400 -0.91778600 183.36459 801 'point symmetry operation' ? ? -0.97407100 -0.17403800 -0.14455800 287.18631 -0.20216800 0.95638700 0.21083800 91.52780 0.10156000 0.23459600 -0.96677300 167.52796 802 'point symmetry operation' ? ? -0.97436600 -0.12110700 -0.18959300 99.00941 -0.14716200 0.98053800 0.12996100 -118.25315 0.17016400 0.15453000 -0.97322400 -52.09973 803 'point symmetry operation' ? ? -0.51386200 -0.79328900 0.32655600 -200.71056 -0.85787300 0.47489800 -0.19628100 204.32143 0.00062700 -0.38100400 -0.92457300 -15.23106 804 'point symmetry operation' ? ? -0.94634200 -0.20994900 -0.24568100 191.79308 -0.26783600 0.93493600 0.23272300 -52.62595 0.18083600 0.28603700 -0.94100000 23.59269 805 'point symmetry operation' ? ? -0.98469200 -0.13984900 -0.10404500 231.25525 -0.15518700 0.97517700 0.15794800 90.91626 0.07937300 0.17167700 -0.98195100 145.54119 806 'point symmetry operation' ? ? -0.85849200 -0.28392000 -0.42706200 290.68933 -0.40969800 0.88058500 0.23815500 58.48599 0.30844700 0.37942000 -0.87229600 51.24377 807 'point symmetry operation' ? ? -0.93378900 -0.21402800 -0.28675800 155.26295 -0.28802600 0.92510000 0.24745000 -218.72713 0.21231900 0.31366000 -0.92549400 -92.27224 808 'point symmetry operation' ? ? -0.84652300 -0.26607100 -0.46109200 320.22641 -0.40124100 0.88812200 0.22415700 12.31559 0.34986400 0.37476300 -0.85857300 5.57397 809 'point symmetry operation' ? ? -0.43186700 -0.88053700 0.19531100 -164.37351 -0.90050100 0.43316500 -0.03829500 68.26178 -0.05088200 -0.19241600 -0.97999300 -2.22517 810 'point symmetry operation' ? ? -0.89906600 -0.26094800 -0.35154900 263.60047 -0.36417300 0.89144100 0.26965300 -5.38676 0.24302000 0.37046000 -0.89649400 42.65359 811 'point symmetry operation' ? ? -0.49412400 -0.80511900 0.32806500 -122.54864 -0.86805400 0.47781300 -0.13482100 216.22340 -0.04820700 -0.35139600 -0.93498500 54.27231 812 'point symmetry operation' ? ? -0.82189700 -0.27316200 -0.49986900 348.70367 -0.40142000 0.90035300 0.16801100 -55.38593 0.40416400 0.33874400 -0.84964900 -70.68396 813 'point symmetry operation' ? ? -0.77096800 -0.29097300 -0.56651900 334.02853 -0.45592700 0.87325000 0.17194900 190.26763 0.44468000 0.39085800 -0.80590900 59.97249 814 'point symmetry operation' ? ? -0.77758000 -0.29206700 -0.55683700 366.17159 -0.44948400 0.87745700 0.16743400 35.35352 0.43969900 0.38048300 -0.81357100 -38.01275 815 'point symmetry operation' ? ? -0.96884000 -0.20014500 -0.14591700 65.39143 -0.23222500 0.93889000 0.25408200 -200.14793 0.08614700 0.28005000 -0.95611200 -53.24935 816 'point symmetry operation' ? ? -0.93380200 -0.21158500 -0.28852600 146.23289 -0.27407000 0.94138700 0.19666700 -225.63035 0.23000300 0.26272400 -0.93705600 -113.24870 817 'point symmetry operation' ? ? -0.93998800 -0.25354200 -0.22834200 335.43171 -0.31251500 0.90835800 0.27788700 111.05421 0.13696000 0.33257000 -0.93308000 186.75245 818 'point symmetry operation' ? ? -0.47694900 -0.82415900 0.30542100 -159.30860 -0.87701700 0.46917400 -0.10352600 169.05610 -0.05797300 -0.31723600 -0.94657300 28.23210 819 'point symmetry operation' ? ? -0.92643300 -0.26457600 -0.26781100 246.13381 -0.33867700 0.89637200 0.28603400 63.47914 0.16438100 0.35569300 -0.92003400 120.24871 820 'point symmetry operation' ? ? -0.92692400 -0.28363500 -0.24568900 290.96642 -0.34772800 0.89535800 0.27824600 87.50532 0.14105900 0.34334600 -0.92855600 153.02216 821 'point symmetry operation' ? ? -0.93410100 -0.22869400 -0.27414500 242.17272 -0.30736000 0.90579800 0.29165100 1.77438 0.18162100 0.35669200 -0.91639700 77.53528 822 'point symmetry operation' ? ? -0.87723500 -0.26733200 -0.39874000 265.05154 -0.38337600 0.89003000 0.24672000 115.92577 0.28893400 0.36929900 -0.88325300 100.61686 823 'point symmetry operation' ? ? -0.83176600 -0.28435000 -0.47677300 331.51301 -0.41573200 0.88821900 0.19553600 -22.69322 0.36787800 0.36084900 -0.85700300 -33.04309 824 'point symmetry operation' ? ? -0.90429700 -0.27495500 -0.32657000 244.31632 -0.36846800 0.88901700 0.27180900 53.25906 0.21559100 0.36612700 -0.90524700 89.07097 825 'point symmetry operation' ? ? -0.90843200 -0.27038300 -0.31882000 243.97147 -0.36570000 0.88349900 0.29273500 92.42358 0.20252600 0.38252200 -0.90147700 124.62050 826 'point symmetry operation' ? ? -0.25537900 -0.96166400 -0.09992100 47.50104 -0.96570300 0.25872700 -0.02189800 -5.49788 0.04691100 0.09090200 -0.99475400 -12.63980 827 'point symmetry operation' ? ? -0.95271400 -0.21979100 -0.20982900 304.62536 -0.27277600 0.92287800 0.27182700 62.88852 0.13390100 0.31621000 -0.93919200 150.29542 828 'point symmetry operation' ? ? -0.88948400 -0.26767800 -0.37036100 241.39233 -0.37851000 0.88566400 0.26894300 155.25221 0.25602500 0.37940500 -0.88910200 140.98210 829 'point symmetry operation' ? ? -1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 830 'point symmetry operation' ? ? -0.59286000 0.78913100 0.16058700 47.33812 0.78567600 0.52303300 0.33037800 -221.35576 0.17672000 0.32203800 -0.93008700 51.25060 831 'point symmetry operation' ? ? -0.66292200 0.74754500 0.04136700 216.10415 0.64525400 0.54244100 0.53796400 -259.57658 0.37971300 0.38332000 -0.84195200 57.54576 832 'point symmetry operation' ? ? -0.60526900 0.79207500 0.07916200 28.69671 0.73866900 0.52181100 0.42671000 -283.55186 0.29667900 0.31674900 -0.90091700 -19.52349 833 'point symmetry operation' ? ? -0.61338500 0.77935900 0.12789900 37.46035 0.74670100 0.51951400 0.41538300 -258.60754 0.25728700 0.35029200 -0.90061000 10.70583 834 'point symmetry operation' ? ? -0.49831000 0.85154500 0.16296800 35.25196 0.85905900 0.45956500 0.22542600 -163.54078 0.11706600 0.25233100 -0.96053300 61.87549 835 'point symmetry operation' ? ? -0.98666900 0.16251800 0.00845600 64.97692 0.15444200 0.95148800 -0.26611800 195.66587 -0.05129400 -0.26126400 -0.96390300 13.03648 836 'point symmetry operation' ? ? -0.57261300 0.79679400 0.19296000 115.75620 0.80393700 0.49962500 0.32258400 -256.38165 0.16062500 0.33984300 -0.92666400 112.26368 837 'point symmetry operation' ? ? -0.98130200 0.18150600 -0.06404500 76.16157 0.19247300 0.92426700 -0.32967400 261.01676 -0.00064400 -0.33583700 -0.94192000 -33.15136 838 'point symmetry operation' ? ? -0.65600700 0.75178600 0.06687400 252.60176 0.66729900 0.53631300 0.51679800 -221.83254 0.35265600 0.38364800 -0.85349100 104.03287 839 'point symmetry operation' ? ? -0.51532500 0.83995500 0.17004600 122.71690 0.84883200 0.47294600 0.23623300 -225.33790 0.11800300 0.26607700 -0.95670200 127.37012 840 'point symmetry operation' ? ? -0.66706200 0.74478200 0.01809700 177.33975 0.62465200 0.54590000 0.55839300 -296.60313 0.40600200 0.38378700 -0.82937900 10.37461 841 'point symmetry operation' ? ? -0.97394900 0.21981400 -0.05572300 230.22272 0.22433500 0.89807400 -0.37833300 157.00180 -0.03312000 -0.38097800 -0.92399100 82.65436 842 'point symmetry operation' ? ? -0.54055400 0.82262800 0.17631100 76.84247 0.83000500 0.48720900 0.27151400 -207.69067 0.13745500 0.29310700 -0.94614700 88.65567 843 'point symmetry operation' ? ? -0.42932100 0.89778500 0.09831000 215.08962 0.90074600 0.41769300 0.11912200 -216.35007 0.06588300 0.13969400 -0.98800100 184.68170 844 'point symmetry operation' ? ? -0.47443900 0.86906200 0.14013600 97.51309 0.87517100 0.44852700 0.18138100 -172.23893 0.09477600 0.20869700 -0.97337700 104.65938 845 'point symmetry operation' ? ? -0.62130100 0.75762700 0.19996500 182.74007 0.76851800 0.53940600 0.34412300 -206.71822 0.15285500 0.36748100 -0.91738400 158.24881 846 'point symmetry operation' ? ? -0.60716800 0.76471600 0.21576800 206.13762 0.78191800 0.52677400 0.33333600 -249.95623 0.14124600 0.37110400 -0.91778600 183.36459 847 'point symmetry operation' ? ? -0.49327800 0.85579700 0.15584800 175.79345 0.86392300 0.46106000 0.20263500 -244.84668 0.10156000 0.23459600 -0.96677300 167.52796 848 'point symmetry operation' ? ? -0.44105500 0.89512200 0.06501300 -81.86982 0.88120100 0.41818200 0.22047400 -130.70571 0.17016400 0.15453000 -0.97322400 -52.09973 849 'point symmetry operation' ? ? -0.97467700 0.20651500 -0.08576300 132.29823 0.22361500 0.90121400 -0.37122700 254.02574 0.00062700 -0.38100400 -0.92457300 -15.23106 850 'point symmetry operation' ? ? -0.54716200 0.82429900 0.14541300 9.21704 0.81725900 0.48858400 0.30557100 -198.66828 0.18083600 0.28603700 -0.94100000 23.59269 851 'point symmetry operation' ? ? -0.45187800 0.88423200 0.11806600 157.92820 0.88854200 0.43435000 0.14776100 -191.84208 0.07937300 0.17167700 -0.98195100 145.54119 852 'point symmetry operation' ? ? -0.65493500 0.74975000 0.09453000 145.45132 0.68987000 0.54214000 0.47975300 -258.38872 0.30844700 0.37942000 -0.87229600 51.24377 853 'point symmetry operation' ? ? -0.56248600 0.81368400 0.14672600 -160.04293 0.79908100 0.48942400 0.34918900 -215.25412 0.21231900 0.31366000 -0.92549400 -92.27224 854 'point symmetry operation' ? ? -0.64319300 0.76243300 0.07070000 110.66813 0.68110100 0.52749300 0.50779300 -300.74756 0.34986400 0.37476300 -0.85857300 5.57397 855 'point symmetry operation' ? ? -0.98988100 0.13986400 0.02393400 14.12662 0.13246000 0.97129500 -0.19758500 177.42246 -0.05088200 -0.19241600 -0.97999300 -2.22517 856 'point symmetry operation' ? ? -0.62417500 0.76717300 0.14782000 76.33384 0.74252700 0.52364600 0.41767000 -252.36344 0.24302000 0.37046000 -0.89649400 42.65359 857 'point symmetry operation' ? ? -0.97826100 0.20563200 -0.02684500 167.77101 0.20169600 0.91336500 -0.35367000 183.36728 -0.04820700 -0.35139600 -0.93498500 54.27231 858 'point symmetry operation' ? ? -0.63575300 0.77187400 0.00532000 55.08014 0.65762400 0.53801700 0.52732100 -348.75194 0.40416400 0.33874400 -0.84964900 -70.68396 859 'point symmetry operation' ? ? -0.67185400 0.74059400 -0.01153100 284.17559 0.59234500 0.54658100 0.59192700 -258.88400 0.44468000 0.39085800 -0.80590900 59.97249 860 'point symmetry operation' ? ? -0.66777000 0.74425700 -0.01283300 146.77632 0.60062400 0.54892100 0.58132400 -337.32490 0.43969900 0.38048300 -0.81357100 -38.01275 861 'point symmetry operation' ? ? -0.52024700 0.83108900 0.19655500 -170.14487 0.84966000 0.48048200 0.21729100 -124.03998 0.08614700 0.28005000 -0.95611200 -53.24935 862 'point symmetry operation' ? ? -0.54921600 0.82992800 0.09788200 -169.39872 0.80340600 0.49213300 0.33517800 -208.79923 0.23000300 0.26272400 -0.93705600 -113.24870 863 'point symmetry operation' ? ? -0.58769100 0.78555100 0.19372500 209.27279 0.79740900 0.52183000 0.30303800 -284.69677 0.13696000 0.33257000 -0.93308000 186.75245 864 'point symmetry operation' ? ? -0.98147800 0.19153200 -0.00407900 111.55282 0.18259300 0.92880400 -0.32246400 203.75258 -0.05797300 -0.31723600 -0.94657300 28.23210 865 'point symmetry operation' ? ? -0.60838400 0.77074200 0.18927600 136.43169 0.77643200 0.52862100 0.34309300 -214.47095 0.16438100 0.35569300 -0.92003400 120.24871 866 'point symmetry operation' ? ? -0.61714400 0.76388700 0.18870600 173.13596 0.77410300 0.54643400 0.31964700 -249.68479 0.14105900 0.34334600 -0.92855600 153.02216 867 'point symmetry operation' ? ? -0.58096900 0.79079500 0.19266100 76.52295 0.79340300 0.49740700 0.35085200 -229.77154 0.18162100 0.35669200 -0.91639700 77.53528 868 'point symmetry operation' ? ? -0.63569200 0.76385800 0.11142800 192.15727 0.71583000 0.52928200 0.45546500 -216.25589 0.28893400 0.36929900 -0.88325300 100.61686 869 'point symmetry operation' ? ? -0.65241400 0.75687800 0.03863500 80.86054 0.66258800 0.54490700 0.51386100 -322.30006 0.36787800 0.36084900 -0.85700300 -33.04309 870 'point symmetry operation' ? ? -0.62987700 0.76054000 0.15759000 126.15018 0.74617400 0.53621900 0.39458000 -215.90059 0.21559100 0.36612700 -0.90524700 89.07097 871 'point symmetry operation' ? ? -0.62852200 0.75670400 0.17988700 163.29127 0.75096200 0.53016600 0.39367600 -203.47013 0.20252600 0.38252200 -0.90147700 124.62050 872 'point symmetry operation' ? ? -0.99735400 -0.05110700 -0.05170400 9.44982 -0.05553900 0.99454800 0.08826400 -46.87509 0.04691100 0.09090200 -0.99475400 -12.63980 873 'point symmetry operation' ? ? -0.55383000 0.80979000 0.19368200 153.94484 0.82179200 0.49421800 0.28355800 -270.28221 0.13390100 0.31621000 -0.93919200 150.29542 874 'point symmetry operation' ? ? -0.63485000 0.75959900 0.14133200 222.24783 0.72898300 0.52826200 0.43534200 -181.60213 0.25602500 0.37940500 -0.88910200 140.98210 875 'point symmetry operation' ? ? -0.30901700 0.95105700 0.00000000 0.00000 0.95105700 0.30901700 0.00000000 0.00000 0.00000000 0.00000000 -1.00000000 0.00000 876 'point symmetry operation' ? ? 0.56401900 0.74128900 0.36383300 -195.89366 0.80663100 -0.58888300 -0.05063500 -113.42394 0.17672000 0.32203800 -0.93008700 51.25060 877 'point symmetry operation' ? ? 0.40881900 0.74689600 0.52441700 -180.09227 0.82987100 -0.54333400 0.12689800 -285.74094 0.37971300 0.38332000 -0.84195200 57.54576 878 'point symmetry operation' ? ? 0.51547800 0.74103700 0.43028800 -260.80621 0.80390600 -0.59206000 0.05657300 -114.91455 0.29667900 0.31674900 -0.90091700 -19.52349 879 'point symmetry operation' ? ? 0.52060900 0.73492200 0.43457600 -234.37463 0.81410700 -0.58067600 0.00672100 -115.54105 0.25728700 0.35029200 -0.90061000 10.70583 880 'point symmetry operation' ? ? 0.66302800 0.70021500 0.26475300 -144.64315 0.73938500 -0.66785400 -0.08533100 -84.06350 0.11706600 0.25233100 -0.96053300 61.87549 881 'point symmetry operation' ? ? -0.15801400 0.95514000 -0.25048000 206.16837 0.98610400 0.13946200 -0.09027700 -1.33267 -0.05129400 -0.26126400 -0.96390300 13.03648 882 'point symmetry operation' ? ? 0.58764300 0.72139500 0.36642400 -208.06293 0.79301700 -0.60340400 -0.08383200 -189.31703 0.16062500 0.33984300 -0.92666400 112.26368 883 'point symmetry operation' ? ? -0.12018600 0.93511900 -0.33333000 271.77704 0.99275200 0.11299200 -0.04096500 8.22462 -0.00064400 -0.33583700 -0.94192000 -33.15136 884 'point symmetry operation' ? ? 0.43192300 0.74237900 0.51217000 -132.91715 0.83010700 -0.54926200 0.09609800 -308.78870 0.35265600 0.38364800 -0.85349100 104.03287 885 'point symmetry operation' ? ? 0.64804400 0.70935900 0.27721800 -176.38758 0.75240700 -0.65269700 -0.08872300 -186.34401 0.11800300 0.26607700 -0.95670200 127.37012 886 'point symmetry operation' ? ? 0.38794600 0.74933300 0.53665500 -227.28549 0.82744200 -0.53963800 0.15534200 -260.31562 0.40600200 0.38378700 -0.82937900 10.37461 887 'point symmetry operation' ? ? -0.08761100 0.92204600 -0.37703600 220.46040 0.99560400 0.06846500 -0.06391600 -170.43870 -0.03312000 -0.38097800 -0.92399100 82.65436 888 'point symmetry operation' ? ? 0.62234200 0.71756900 0.31270900 -173.78004 0.77058300 -0.63181000 -0.08377900 -137.26152 0.13745500 0.29310700 -0.94614700 88.65567 889 'point symmetry operation' ? ? 0.72399300 0.67468000 0.14367100 -139.29490 0.68665500 -0.72477100 -0.05668800 -271.41834 0.06588300 0.13969400 -0.98800100 184.68170 890 'point symmetry operation' ? ? 0.68572800 0.69513000 0.21580800 -133.67584 0.72166200 -0.68792500 -0.07722800 -145.96526 0.09477600 0.20869700 -0.97337700 104.65938 891 'point symmetry operation' ? ? 0.53891200 0.74712600 0.38907300 -140.13102 0.82837800 -0.55386100 -0.08383800 -237.67567 0.15285500 0.36748100 -0.91738400 158.24881 892 'point symmetry operation' ? ? 0.55602400 0.73730300 0.38369700 -174.02259 0.81907800 -0.56450600 -0.10220100 -273.28935 0.14124600 0.37110400 -0.91778600 183.36459 893 'point symmetry operation' ? ? 0.66920900 0.70295000 0.24087700 -178.53998 0.73610200 -0.67143700 -0.08560200 -242.85138 0.10156000 0.23459600 -0.96677300 167.52796 894 'point symmetry operation' ? ? 0.70177900 0.67432300 0.22977300 -149.60775 0.69177400 -0.72208700 0.00629900 37.47258 0.17016400 0.15453000 -0.97322400 -52.09973 895 'point symmetry operation' ? ? -0.08852200 0.92092300 -0.37956000 282.47536 0.99607500 0.08208300 -0.03315000 -47.32489 0.00062700 -0.38100400 -0.92457300 -15.23106 896 'point symmetry operation' ? ? 0.60817700 0.71939400 0.33555100 -186.09664 0.77292900 -0.63297400 -0.04386900 -70.15781 0.18083600 0.28603700 -0.94100000 23.59269 897 'point symmetry operation' ? ? 0.70541600 0.68633500 0.17701400 -133.65025 0.70433600 -0.70673400 -0.06662700 -209.48118 0.07937300 0.17167700 -0.98195100 145.54119 898 'point symmetry operation' ? ? 0.45372000 0.74729100 0.48548400 -200.79547 0.83606200 -0.54552400 0.05834900 -218.17900 0.30844700 0.37942000 -0.87229600 51.24377 899 'point symmetry operation' ? ? 0.58615400 0.71691300 0.37744000 -254.17492 0.78188600 -0.62261900 -0.03163900 85.69277 0.21231900 0.31366000 -0.92549400 -92.27224 900 'point symmetry operation' ? ? 0.44900800 0.73728000 0.50478700 -251.82974 0.82218500 -0.56211300 0.08967700 -198.18781 0.34986400 0.37476300 -0.85857300 5.57397 901 'point symmetry operation' ? ? -0.17991300 0.96697700 -0.18051900 173.10424 0.98236600 0.16712800 -0.08382000 41.39134 -0.05088200 -0.19241600 -0.97999300 -2.22517 902 'point symmetry operation' ? ? 0.51330500 0.73508700 0.44290700 -216.42356 0.82308000 -0.56781000 -0.01151800 -150.58243 0.24302000 0.37046000 -0.89649400 42.65359 903 'point symmetry operation' ? ? -0.11047500 0.93220600 -0.34465600 226.23683 0.99271000 0.08667700 -0.08375900 -102.89619 -0.04820700 -0.35139600 -0.93498500 54.27231 904 'point symmetry operation' ? ? 0.42898000 0.75020700 0.50315700 -314.66227 0.80785400 -0.56784000 0.15789200 -160.15463 0.40416400 0.33874400 -0.84964900 -70.68396 905 'point symmetry operation' ? ? 0.35573900 0.74868500 0.55939300 -158.39835 0.82201600 -0.53544500 0.19388200 -350.26674 0.44468000 0.39085800 -0.80590900 59.97249 906 'point symmetry operation' ? ? 0.36487500 0.75204300 0.54890600 -275.45883 0.82069000 -0.53820500 0.19184400 -243.83178 0.43969900 0.38048300 -0.81357100 -38.01275 907 'point symmetry operation' ? ? 0.64731000 0.71378600 0.26739500 -170.54675 0.75734400 -0.64193600 -0.11978900 123.48701 0.08614700 0.28005000 -0.95611200 -53.24935 908 'point symmetry operation' ? ? 0.59436800 0.72450900 0.34902100 -250.92705 0.77060200 -0.63723200 0.01048400 96.58533 0.23000300 0.26272400 -0.93705600 -113.24870 909 'point symmetry operation' ? ? 0.57677500 0.73903900 0.34807000 -206.09401 0.80534100 -0.58584900 -0.09060000 -287.00649 0.13696000 0.33257000 -0.93308000 186.75245 910 'point symmetry operation' ? ? -0.12963700 0.94253200 -0.30794200 228.25204 0.98986600 0.10485900 -0.09576700 -43.13008 -0.05797300 -0.31723600 -0.94657300 28.23210 911 'point symmetry operation' ? ? 0.55043000 0.74092100 0.38479100 -161.81439 0.81853900 -0.56966600 -0.07399100 -196.02948 0.16438100 0.35569300 -0.92003400 120.24871 912 'point symmetry operation' ? ? 0.54550900 0.75574400 0.36231500 -183.96251 0.82615000 -0.55764300 -0.08069400 -241.81901 0.14105900 0.34334600 -0.92855600 153.02216 913 'point symmetry operation' ? ? 0.57504200 0.71743200 0.39321600 -194.87894 0.79771000 -0.59838400 -0.07481200 -143.78100 0.18162100 0.35669200 -0.91639700 77.53528 914 'point symmetry operation' ? ? 0.48435500 0.73942200 0.46760600 -146.29181 0.82578300 -0.56291500 0.03477200 -249.57926 0.28893400 0.36929900 -0.88325300 100.61686 915 'point symmetry operation' ? ? 0.42855200 0.75212600 0.50065000 -281.53845 0.82523300 -0.55144800 0.12204800 -176.49918 0.36787800 0.36084900 -0.85700300 -33.04309 916 'point symmetry operation' ? ? 0.51501100 0.74499400 0.42396600 -166.35122 0.82962900 -0.55761600 -0.02794500 -186.69296 0.21559100 0.36612700 -0.90524700 89.07097 917 'point symmetry operation' ? ? 0.51998400 0.73805200 0.42999600 -143.05191 0.82982000 -0.55583900 -0.04943100 -218.17503 0.20252600 0.38252200 -0.90147700 124.62050 918 'point symmetry operation' ? ? -0.36102000 0.93007900 0.06796600 -41.66073 0.93137800 0.35593700 0.07644800 -23.47252 0.04691100 0.09090200 -0.99475400 -12.63980 919 'point symmetry operation' ? ? 0.61042900 0.72026900 0.32953100 -209.48222 0.78067200 -0.61743400 -0.09657800 -229.93212 0.13390100 0.31621000 -0.93919200 150.29542 920 'point symmetry operation' ? ? 0.49712500 0.73713600 0.45770900 -104.03562 0.82904700 -0.55918000 0.00011300 -267.48850 0.25602500 0.37940500 -0.88910200 140.98210 921 'point symmetry operation' ? ? -0.13819600 -0.42532500 0.89442700 0.00000 0.95105700 -0.30901700 0.00000000 0.00000 0.27639300 0.85065100 0.44721300 0.00000 922 'point symmetry operation' ? ? -0.57416100 -0.40144300 0.71356900 54.85016 0.32105700 -0.91213500 -0.25482000 23.38144 0.75316700 0.08278800 0.65259800 -224.30036 923 'point symmetry operation' ? ? -0.70568100 -0.47025800 0.52997200 88.79866 0.43108200 -0.87858100 -0.20558200 -125.31379 0.56230000 0.08338600 0.82271800 -306.27396 924 'point symmetry operation' ? ? -0.66317800 -0.39578600 0.63525400 142.02980 0.34738400 -0.91455700 -0.20714800 60.33014 0.66296300 0.08330100 0.74400400 -240.40408 925 'point symmetry operation' ? ? -0.63248300 -0.42656900 0.64653200 105.59354 0.35262100 -0.90175400 -0.25000000 44.28720 0.68965500 0.06986000 0.72076000 -235.12633 926 'point symmetry operation' ? ? -0.53895100 -0.30347600 0.78576900 19.08655 0.20845700 -0.95188100 -0.22465200 17.01026 0.81613500 0.04272300 0.57627900 -176.53105 927 'point symmetry operation' ? ? -0.15616300 -0.14855000 0.97649600 -85.90222 0.89065400 -0.44858900 0.07419300 -122.26083 0.42702400 0.88130600 0.20236000 142.65412 928 'point symmetry operation' ? ? -0.56473500 -0.40635400 0.71829600 24.63090 0.29615700 -0.91218900 -0.28320000 -30.86446 0.77030200 0.05279600 0.63549000 -300.29129 929 'point symmetry operation' ? ? -0.21690000 -0.06764900 0.97384700 -70.84026 0.87379700 -0.45823700 0.16278500 -153.09261 0.43524000 0.88625200 0.15850200 215.80936 930 'point symmetry operation' ? ? -0.68990200 -0.46735900 0.55282000 36.20967 0.41769300 -0.88072100 -0.22330100 -171.68865 0.59124200 0.07685400 0.80282400 -305.04428 931 'point symmetry operation' ? ? -0.53779000 -0.32306400 0.77872400 -1.12245 0.22779900 -0.94499400 -0.23472300 -47.07752 0.81172000 0.05116100 0.58180200 -282.56358 932 'point symmetry operation' ? ? -0.72100400 -0.47252800 0.50682200 141.38104 0.44138600 -0.87702300 -0.18976400 -77.00480 0.53416300 0.08688400 0.84090500 -305.96088 933 'point symmetry operation' ? ? -0.20038800 -0.01083900 0.97965600 -108.88922 0.85695800 -0.48657600 0.16990700 -267.47115 0.47483500 0.87357100 0.10679300 32.95769 934 'point symmetry operation' ? ? -0.55066800 -0.35570100 0.75514300 19.65933 0.25761200 -0.93292100 -0.25158400 -8.90162 0.79397800 0.05599500 0.60536200 -237.55897 935 'point symmetry operation' ? ? -0.50136700 -0.17853100 0.84661500 -43.44068 0.12996300 -0.98291900 -0.13030900 -137.70664 0.85541800 0.04469600 0.51600600 -326.07973 936 'point symmetry operation' ? ? -0.52256800 -0.25733300 0.81283500 -6.87673 0.18077600 -0.96513000 -0.18932700 -39.51575 0.83321200 0.04800500 0.55086600 -220.27219 937 'point symmetry operation' ? ? -0.54944900 -0.45340600 0.70180300 -28.36563 0.35340700 -0.88723200 -0.29651800 -109.91678 0.75710600 0.08510100 0.64772600 -297.12406 938 'point symmetry operation' ? ? -0.54281200 -0.45029500 0.70893500 -29.20621 0.33582600 -0.89007100 -0.30821400 -118.80790 0.76979000 0.07077600 0.63436100 -351.60354 939 'point symmetry operation' ? ? -0.52645500 -0.28766100 0.80006000 -21.40816 0.20216800 -0.95638700 -0.21083800 -91.52780 0.82581700 0.05075000 0.56165000 -331.78783 940 'point symmetry operation' ? ? -0.58794800 -0.19237700 0.78568900 90.87773 0.14716200 -0.98053800 -0.12996100 118.25315 0.79539900 0.03921400 0.60481500 -65.25702 941 'point symmetry operation' ? ? -0.23036600 -0.01398900 0.97300300 -76.13734 0.85787300 -0.47489800 0.19628100 -204.32143 0.45933200 0.87992900 0.12140100 186.33247 942 'point symmetry operation' ? ? -0.58496100 -0.34973100 0.73178400 64.67041 0.26783600 -0.93493600 -0.23272300 52.62595 0.76556200 0.05986500 0.64057100 -182.09585 943 'point symmetry operation' ? ? -0.51136000 -0.21609500 0.83175300 -26.75569 0.15518700 -0.97517700 -0.15794800 -90.91626 0.84523800 0.04830900 0.53220200 -271.92882 944 'point symmetry operation' ? ? -0.65981200 -0.46633700 0.58921800 84.16616 0.40969800 -0.88058500 -0.23815500 -58.48599 0.62991700 0.08426400 0.77207800 -282.91723 945 'point symmetry operation' ? ? -0.60750600 -0.37626200 0.69954400 151.96645 0.28802600 -0.92510000 -0.24745000 218.72713 0.74025500 0.05116000 0.67037700 -97.60604 946 'point symmetry operation' ? ? -0.69150400 -0.45418800 0.56172500 138.22384 0.40124100 -0.88812200 -0.22415700 -12.31559 0.60068900 0.07038200 0.79637800 -288.91186 947 'point symmetry operation' ? ? -0.14762600 -0.22168600 0.96387800 -71.51971 0.90050100 -0.43316500 0.03829500 -68.26178 0.40902900 0.87362700 0.26357400 148.01522 948 'point symmetry operation' ? ? -0.61943700 -0.44804900 0.64463100 79.73499 0.36417300 -0.89144100 -0.26965300 5.38676 0.69546800 0.06772400 0.71535900 -254.84659 949 'point symmetry operation' ? ? -0.17786100 -0.04576100 0.98299100 -103.34803 0.86805400 -0.47781300 0.13482100 -216.22340 0.46351600 0.87726900 0.12470700 85.33954 950 'point symmetry operation' ? ? -0.72905800 -0.42514400 0.53640100 219.16642 0.40142000 -0.90035300 -0.16801100 55.38593 0.55437900 0.09283300 0.82707000 -280.27917 951 'point symmetry operation' ? ? -0.74252000 -0.47972100 0.46747200 95.74075 0.45592700 -0.87325000 -0.17194900 -190.26763 0.49070800 0.08545700 0.86712300 -325.58455 952 'point symmetry operation' ? ? -0.74102200 -0.47093000 0.47865500 197.75624 0.44948400 -0.87745700 -0.16743400 -35.35352 0.49884900 0.09107600 0.86189000 -310.51391 953 'point symmetry operation' ? ? -0.51033000 -0.33999200 0.78991700 76.87162 0.23222500 -0.93889000 -0.25408200 200.14793 0.82803100 0.05377300 0.55809800 -34.67408 954 'point symmetry operation' ? ? -0.62332900 -0.32961100 0.70909600 166.69000 0.27407000 -0.94138700 -0.19666700 225.63035 0.73235700 0.07175400 0.67712900 -80.14836 955 'point symmetry operation' ? ? -0.54287500 -0.41084800 0.73245500 -17.02712 0.31251500 -0.90835800 -0.27788700 -111.05421 0.77950000 0.07804500 0.62152100 -383.53725 956 'point symmetry operation' ? ? -0.16144500 -0.08483000 0.98322900 -96.49647 0.87701700 -0.46917400 0.10352600 -169.05610 0.45252300 0.87902200 0.15014300 129.86416 957 'point symmetry operation' ? ? -0.56133900 -0.43646300 0.70313400 2.52048 0.33867700 -0.89637200 -0.28603400 -63.47914 0.75511300 0.07757400 0.65098900 -273.92548 958 'point symmetry operation' ? ? -0.54069900 -0.43394300 0.72065000 -6.74327 0.34772800 -0.89535800 -0.27824600 -87.50532 0.76598300 0.10014300 0.63501300 -328.68168 959 'point symmetry operation' ? ? -0.58018900 -0.42131000 0.69704900 38.95310 0.30736000 -0.90579800 -0.29165100 -1.77438 0.75426200 0.04503200 0.65502800 -251.28058 960 'point symmetry operation' ? ? -0.65074100 -0.44986600 0.61168300 28.53997 0.38337600 -0.89003000 -0.24672000 -115.92577 0.65540700 0.07395400 0.75164600 -282.06638 961 'point symmetry operation' ? ? -0.70101600 -0.44991900 0.55330800 177.81151 0.41573200 -0.88821900 -0.19553600 22.69322 0.57943400 0.09295400 0.80970100 -281.73686 962 'point symmetry operation' ? ? -0.59724400 -0.45043700 0.66363100 29.59389 0.36846800 -0.88901700 -0.27180900 -53.25906 0.71241200 0.08219100 0.69693100 -258.35678 963 'point symmetry operation' ? ? -0.58740700 -0.46305700 0.66372500 -2.35681 0.36570000 -0.88349900 -0.29273500 -92.42358 0.72195300 0.07076900 0.68831300 -273.94654 964 'point symmetry operation' ? ? -0.15616700 -0.51137400 0.84504900 32.54845 0.96570300 -0.25872700 0.02189800 5.49788 0.20743800 0.81948600 0.53423900 -36.83352 965 'point symmetry operation' ? ? -0.54583100 -0.38112000 0.74620100 1.80406 0.27277600 -0.92287800 -0.27182700 -62.88852 0.79225100 0.05517400 0.60769600 -339.67917 966 'point symmetry operation' ? ? -0.62678400 -0.45906000 0.62960700 -18.14451 0.37851000 -0.88566400 -0.26894300 -155.25221 0.68108100 0.06974400 0.72887900 -278.95681 967 'point symmetry operation' ? ? -0.44721300 0.00000000 0.89442800 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 0.89442800 0.00000000 0.44721300 0.00000 968 'point symmetry operation' ? ? -0.42319800 0.06487000 0.90371300 -24.66975 -0.78567600 -0.52303300 -0.33037800 221.35576 0.45124000 -0.84984100 0.27231300 -65.26047 969 'point symmetry operation' ? ? -0.63609300 -0.00854000 0.77156600 45.17405 -0.64525400 -0.54244100 -0.53796400 259.57658 0.42312300 -0.84005100 0.33953200 -219.02481 970 'point symmetry operation' ? ? -0.53604200 0.07091700 0.84120800 30.29590 -0.73866900 -0.52181100 -0.42671000 283.55186 0.40869100 -0.85010800 0.33209700 -16.93598 971 'point symmetry operation' ? ? -0.50443900 0.03522800 0.86272900 7.17716 -0.74670100 -0.51951400 -0.41538300 258.60754 0.43356600 -0.85373600 0.28836800 -38.29337 972 'point symmetry operation' ? ? -0.32755800 0.15513000 0.93200900 -39.57804 -0.85905900 -0.45956500 -0.22542600 163.54078 0.39334900 -0.87449100 0.28380000 -59.20186 973 'point symmetry operation' ? ? -0.39537200 0.30636200 0.86592400 17.39833 -0.15444200 -0.95148800 0.26611800 -195.66587 0.90544400 -0.02852000 0.42350700 -63.94726 974 'point symmetry operation' ? ? -0.39974800 0.05237100 0.91512800 -48.64410 -0.80393700 -0.49962500 -0.32258400 256.38165 0.44032700 -0.86465800 0.24182700 -153.74136 975 'point symmetry operation' ? ? -0.43827500 0.38155400 0.81383800 63.71195 -0.19247300 -0.92426700 0.32967400 -261.01676 0.87799200 -0.01215300 0.47852200 -53.29532 976 'point symmetry operation' ? ? -0.60880100 -0.00693700 0.79329400 19.91688 -0.66729900 -0.53631300 -0.51679800 221.83254 0.42903800 -0.84399100 0.32187800 -272.45894 977 'point symmetry operation' ? ? -0.33600500 0.13765200 0.93174800 -59.04281 -0.84883200 -0.47294600 -0.23623300 225.33790 0.40814800 -0.87027300 0.27575600 -166.72300 978 'point symmetry operation' ? ? -0.66145800 -0.01019300 0.74991300 70.02930 -0.62465200 -0.54590000 -0.55839300 296.60313 0.41507000 -0.83778800 0.35472300 -163.25730 979 'point symmetry operation' ? ? -0.40593900 0.43906100 0.80152300 29.03022 -0.22433500 -0.89807400 0.37833300 -157.00180 0.88593900 -0.02623000 0.46306100 -242.88175 980 'point symmetry operation' ? ? -0.36468600 0.10572700 0.92510900 -44.93116 -0.83000500 -0.48720900 -0.27151400 207.69067 0.42201500 -0.86686200 0.26543200 -108.37802 981 'point symmetry operation' ? ? -0.25092500 0.27655500 0.92766100 -68.99361 -0.90074600 -0.41769300 -0.11912200 216.35007 0.35453300 -0.86547700 0.35391600 -274.97424 982 'point symmetry operation' ? ? -0.29694600 0.20199100 0.93328600 -50.00116 -0.87517100 -0.44852700 -0.18138100 172.23893 0.38196700 -0.87064600 0.30996500 -134.02347 983 'point symmetry operation' ? ? -0.41457100 0.01013600 0.90996100 -59.81843 -0.76851800 -0.53940600 -0.34412300 206.71822 0.48735000 -0.84198500 0.23141200 -234.21876 984 'point symmetry operation' ? ? -0.39786800 0.01006500 0.91738800 -71.81900 -0.78191800 -0.52677400 -0.33333600 249.95623 0.47990100 -0.84994600 0.21745700 -266.37829 985 'point symmetry operation' ? ? -0.31143800 0.17289400 0.93440600 -71.22458 -0.86392300 -0.46106000 -0.20263500 244.84668 0.39578200 -0.87036300 0.29295900 -232.15527 986 'point symmetry operation' ? ? -0.34944500 0.26209400 0.89955300 9.98621 -0.88120100 -0.41818200 -0.22047400 130.70571 0.31839200 -0.86973000 0.37708900 96.52634 987 'point symmetry operation' ? ? -0.43644900 0.43313700 0.78861000 72.78857 -0.22361500 -0.90121400 0.37122700 -254.02574 0.87149800 -0.01432300 0.49019000 -111.51971 988 'point symmetry operation' ? ? -0.40644300 0.11279800 0.90668700 -16.97998 -0.81725900 -0.48858400 -0.30557100 198.66828 0.40852500 -0.86519500 0.29076600 -18.79494 989 'point symmetry operation' ? ? -0.27307900 0.24188800 0.93108500 -59.54857 -0.88854200 -0.43435000 -0.14776100 191.84208 0.36867500 -0.86765800 0.33353900 -206.34332 990 'point symmetry operation' ? ? -0.56877900 -0.00406600 0.82248100 19.21386 -0.68987000 -0.54214000 -0.47975300 258.38872 0.44785000 -0.84027900 0.30555200 -153.01261 991 'point symmetry operation' ? ? -0.44145500 0.08334400 0.89340500 10.95760 -0.79908100 -0.48942400 -0.34918900 215.25412 0.40815100 -0.86805400 0.28265700 184.41222 992 'point symmetry operation' ? ? -0.60057200 0.00577200 0.79955000 44.50671 -0.68110100 -0.52749300 -0.50779300 300.74756 0.41882600 -0.84954000 0.32072900 -101.47743 993 'point symmetry operation' ? ? -0.39717700 0.23465100 0.88723700 8.30786 -0.13246000 -0.97129500 0.19758500 -177.42246 0.90813300 -0.03904700 0.41685800 -11.64012 994 'point symmetry operation' ? ? -0.49650300 0.01174000 0.86795600 -4.01308 -0.74252700 -0.52364600 -0.41767000 252.36344 0.44959800 -0.85185500 0.26870900 -87.35036 995 'point symmetry operation' ? ? -0.39437400 0.40626000 0.82427100 26.48670 -0.20169600 -0.91336500 0.35367000 -183.36728 0.89654300 -0.02677400 0.44214800 -174.33037 996 'point symmetry operation' ? ? -0.64581200 0.04221000 0.76232900 87.85427 -0.65762400 -0.53801700 -0.52732100 348.75194 0.38788800 -0.84187700 0.37521600 -17.65443 997 'point symmetry operation' ? ? -0.69819600 -0.01839100 0.71567100 73.44594 -0.59234500 -0.54658100 -0.59192700 258.88400 0.40205800 -0.83720500 0.37072600 -280.99508 998 'point symmetry operation' ? ? -0.69191400 -0.00747300 0.72194200 99.63995 -0.60062400 -0.54892100 -0.58132400 337.32490 0.40063300 -0.83584100 0.37531800 -114.28105 999 'point symmetry operation' ? ? -0.30971300 0.12118900 0.94307600 -28.46329 -0.84966000 -0.48048200 -0.21729100 124.03998 0.42679800 -0.86859100 0.25178100 175.99614 1000 'point symmetry operation' ? ? -0.45133700 0.13616700 0.88190400 25.53550 -0.80340600 -0.49213300 -0.33517800 208.79923 0.38837400 -0.85980500 0.33151500 202.16125 1001 'point symmetry operation' ? ? -0.38532400 0.05384800 0.92120900 -73.44711 -0.79740900 -0.52183000 -0.30303800 284.69677 0.46439700 -0.85134800 0.24401300 -270.69757 1002 'point symmetry operation' ? ? -0.38707700 0.36940000 0.84481700 24.63629 -0.18259300 -0.92880400 0.32246400 -203.75258 0.90378800 -0.02943900 0.42696800 -112.40173 1003 'point symmetry operation' ? ? -0.41910400 0.02654400 0.90755100 -46.53979 -0.77643200 -0.52862100 -0.34309300 214.47095 0.47064300 -0.84844300 0.24215700 -175.80511 1004 'point symmetry operation' ? ? -0.40216200 0.03452200 0.91491800 -59.43865 -0.77410300 -0.54643400 -0.31964700 249.68479 0.48890700 -0.83679100 0.24647900 -223.29115 1005 'point symmetry operation' ? ? -0.42226400 0.03461800 0.90581200 -35.12767 -0.79340300 -0.49740700 -0.35085200 229.77154 0.43841200 -0.86682600 0.23750300 -103.11905 1006 'point symmetry operation' ? ? -0.54272100 0.01129600 0.83983800 -4.05931 -0.71583000 -0.52928200 -0.45546500 216.25589 0.43936600 -0.84837100 0.29533800 -216.86801 1007 'point symmetry operation' ? ? -0.62080800 0.01573200 0.78380500 65.71655 -0.66258800 -0.54490700 -0.51386100 322.30006 0.41901700 -0.83834900 0.34870600 -57.54663 1008 'point symmetry operation' ? ? -0.47452000 0.01264900 0.88015400 -23.25157 -0.74617400 -0.53621900 -0.39458000 215.90059 0.46696400 -0.84398500 0.26388500 -152.66595 1009 'point symmetry operation' ? ? -0.46222800 -0.00373000 0.88675400 -38.43809 -0.75096200 -0.53016600 -0.39367600 203.47013 0.47159500 -0.84788600 0.24225600 -201.78419 1010 'point symmetry operation' ? ? -0.48798800 -0.10416100 0.86661300 15.53147 0.05553900 -0.99454800 -0.08826400 46.87509 0.87108200 0.00505900 0.49111300 -2.79950 1011 'point symmetry operation' ? ? -0.36744500 0.07932200 0.92665700 -65.58230 -0.82179200 -0.49421800 -0.28355800 270.28221 0.43547900 -0.86571200 0.24678400 -204.90664 1012 'point symmetry operation' ? ? -0.51290900 0.00035200 0.85844300 -26.70622 -0.72898300 -0.52826200 -0.43534200 181.60213 0.45333000 -0.84908200 0.27120700 -261.83371 1013 'point symmetry operation' ? ? -0.13819600 0.42532500 0.89442700 0.00000 -0.95105700 -0.30901700 0.00000000 0.00000 0.27639300 -0.85065100 0.44721300 0.00000 1014 'point symmetry operation' ? ? 0.09417400 0.04347400 0.99460600 -133.44612 -0.80663100 0.58888300 0.05063500 113.42394 -0.58350500 -0.80704800 0.09052500 152.29264 1015 'point symmetry operation' ? ? -0.15679600 -0.00883000 0.98759100 -132.01016 -0.82987100 0.54333400 -0.12689800 285.74094 -0.53547200 -0.83947000 -0.09252100 135.34419 1016 'point symmetry operation' ? ? -0.03482900 0.04809200 0.99823500 -99.17359 -0.80390600 0.59206000 -0.05657300 114.91455 -0.59373600 -0.80445800 0.01804100 242.00326 1017 'point symmetry operation' ? ? 0.00269800 0.01535600 0.99987800 -114.39096 -0.81410700 0.58067600 -0.00672100 115.54105 -0.58070900 -0.81399000 0.01406800 204.84320 1018 'point symmetry operation' ? ? 0.19180700 0.08745300 0.97752800 -120.02941 -0.73938500 0.66785400 0.08533100 84.06350 -0.64538400 -0.73913700 0.19276100 101.70121 1019 'point symmetry operation' ? ? -0.02478700 0.66083300 0.75012300 80.54096 -0.98610400 -0.13946200 0.09027700 1.33267 0.16427200 -0.73746200 0.65510600 -190.23262 1020 'point symmetry operation' ? ? 0.11913400 0.01865200 0.99270300 -193.46015 -0.79301700 0.60340400 0.08383200 189.31703 -0.59743700 -0.79721700 0.08667700 135.89133 1021 'point symmetry operation' ? ? -0.05317300 0.71857900 0.69340900 151.19365 -0.99275200 -0.11299200 0.04096500 -8.22462 0.10778600 -0.68620500 0.71937800 -228.25897 1022 'point symmetry operation' ? ? -0.12226400 -0.01114400 0.99243500 -152.49218 -0.83010700 0.54926200 -0.09609800 308.78870 -0.54403600 -0.83557600 -0.07640600 72.35986 1023 'point symmetry operation' ? ? 0.18426900 0.07924800 0.97967500 -192.80613 -0.75240700 0.65269700 0.08872300 186.34401 -0.63240000 -0.75346300 0.17989800 100.80424 1024 'point symmetry operation' ? ? -0.18964400 -0.00815800 0.98181900 -110.92441 -0.82744200 0.53963800 -0.15534200 260.31562 -0.52855900 -0.84185800 -0.10909000 198.65062 1025 'point symmetry operation' ? ? -0.00955700 0.75310800 0.65782700 24.66436 -0.99560400 -0.06846500 0.06391600 170.43870 0.09317300 -0.65432500 0.75045200 -234.14979 1026 'point symmetry operation' ? ? 0.15537600 0.05874300 0.98610700 -157.01274 -0.77058300 0.63181000 0.08377900 137.26152 -0.61811100 -0.77289400 0.14343400 115.78559 1027 'point symmetry operation' ? ? 0.26485200 0.17678000 0.94794600 -227.47887 -0.68665500 0.72477100 0.05668800 271.41834 -0.67702300 -0.66592500 0.31334300 41.99708 1028 'point symmetry operation' ? ? 0.22189600 0.12420600 0.96712700 -153.39178 -0.72166200 0.68792500 0.07722800 145.96526 -0.65571900 -0.71507500 0.24228300 72.75825 1029 'point symmetry operation' ? ? 0.10429100 0.00543900 0.99453100 -204.21049 -0.82837800 0.55386100 0.08383800 237.67567 -0.55037600 -0.83259100 0.06226900 54.56606 1030 'point symmetry operation' ? ? 0.12232700 -0.00219400 0.99248700 -241.83148 -0.81907800 0.56450600 0.10220100 273.28935 -0.56049000 -0.82542600 0.06725700 73.64749 1031 'point symmetry operation' ? ? 0.20844100 0.10453900 0.97243100 -229.68699 -0.73610200 0.67143700 0.08560200 242.85138 -0.64397700 -0.73365200 0.21690600 84.77031 1032 'point symmetry operation' ? ? 0.16164600 0.16335000 0.97323500 -20.30708 -0.69177400 0.72208700 -0.00629900 -37.47258 -0.70378900 -0.67224100 0.22972300 157.11286 1033 'point symmetry operation' ? ? -0.04014800 0.75262900 0.65721900 139.94966 -0.99607500 -0.08208300 0.03315000 47.32489 0.07889600 -0.65330800 0.75297000 -245.84203 1034 'point symmetry operation' ? ? 0.11024100 0.06588300 0.99171900 -104.32677 -0.77292900 0.63297400 0.04386900 70.15781 -0.62484200 -0.77136400 0.12070200 155.89889 1035 'point symmetry operation' ? ? 0.24447800 0.15338500 0.95744600 -189.94616 -0.70433600 0.70673400 0.06662700 209.48118 -0.66644000 -0.69065200 0.28081500 54.45250 1036 'point symmetry operation' ? ? -0.07297300 -0.00516600 0.99732000 -135.63220 -0.83606200 0.54552400 -0.05834900 218.17900 -0.54376100 -0.83807900 -0.04412800 156.68002 1037 'point symmetry operation' ? ? 0.07223200 0.04006700 0.99658200 -31.13947 -0.78188600 0.62261900 0.03163900 -85.69277 -0.61922400 -0.78149900 0.07630000 268.60622 1038 'point symmetry operation' ? ? -0.11212500 -0.00547700 0.99367900 -117.60707 -0.82218500 0.56211300 -0.08967700 198.18781 -0.55806900 -0.82704200 -0.06753000 222.75056 1039 'point symmetry operation' ? ? -0.03494900 0.60454700 0.79580200 79.40470 -0.98236600 -0.16712800 0.08382000 -41.39134 0.18367400 -0.77884000 0.59972700 -153.83397 1040 'point symmetry operation' ? ? 0.01219400 -0.00260900 0.99992200 -134.93797 -0.82308000 0.56781000 0.01151800 150.58243 -0.56779500 -0.82315600 0.00477600 174.49983 1041 'point symmetry operation' ? ? -0.00628800 0.73119300 0.68214100 52.63335 -0.99271000 -0.08667700 0.08375900 102.89619 0.12037000 -0.67664100 0.72640700 -226.62358 1042 'point symmetry operation' ? ? -0.16964900 0.03252000 0.98496700 -77.49942 -0.80785400 0.56784000 -0.15789200 160.15463 -0.56443900 -0.82249600 -0.07006300 313.05321 1043 'point symmetry operation' ? ? -0.23864200 -0.01477300 0.97099500 -124.47892 -0.82201600 0.53544500 -0.19388200 350.26674 -0.51705000 -0.84444100 -0.13992300 114.85531 1044 'point symmetry operation' ? ? -0.23010100 -0.00399100 0.97315800 -89.18918 -0.82069000 0.53820500 -0.19184400 243.83178 -0.52299300 -0.84280400 -0.12711700 263.37761 1045 'point symmetry operation' ? ? 0.21243300 0.06873000 0.97475500 -28.64299 -0.75734400 0.64193600 0.11978900 -123.48701 -0.61749700 -0.76367200 0.18842100 176.35539 1046 'point symmetry operation' ? ? 0.06008800 0.08902200 0.99421500 -10.92506 -0.77060200 0.63723200 -0.01048400 -96.58533 -0.63447900 -0.76551400 0.10689000 275.08219 1047 'point symmetry operation' ? ? 0.13544100 0.03304800 0.99023400 -259.20442 -0.80534100 0.58584900 0.09060000 287.00649 -0.57713300 -0.80974600 0.10596200 100.81793 1048 'point symmetry operation' ? ? -0.00612200 0.70525700 0.70892500 76.82567 -0.98986600 -0.10485900 0.09576700 43.13008 0.14187700 -0.70115400 0.69875200 -216.78052 1049 'point symmetry operation' ? ? 0.09913300 0.01320800 0.99498600 -179.91924 -0.81853900 0.56966600 0.07399100 196.02948 -0.56583300 -0.82177000 0.06728400 90.95438 1050 'point symmetry operation' ? ? 0.11779200 0.03088100 0.99255800 -219.13764 -0.82615000 0.55764300 0.08069400 241.81901 -0.55100100 -0.82950600 0.09119800 96.10755 1051 'point symmetry operation' ? ? 0.09472000 0.00180900 0.99550200 -156.50206 -0.79771000 0.59838400 0.07481200 143.78100 -0.59555700 -0.80120800 0.05812200 139.63020 1052 'point symmetry operation' ? ? -0.04182000 0.00036800 0.99912500 -155.41811 -0.82578300 0.56291500 -0.03477200 249.57926 -0.56243500 -0.82651400 -0.02323700 85.85020 1053 'point symmetry operation' ? ? -0.13738600 0.01360700 0.99042400 -96.35304 -0.82523300 0.55144800 -0.12204800 176.49918 -0.54782800 -0.83409800 -0.06453200 266.59288 1054 'point symmetry operation' ? ? 0.03748900 0.00569700 0.99928000 -154.06195 -0.82962900 0.55761600 0.02794500 186.69296 -0.55705500 -0.83008000 0.02563100 108.95533 1055 'point symmetry operation' ? ? 0.05139900 -0.01207200 0.99860500 -175.43867 -0.82982000 0.55583900 0.04943100 218.17503 -0.55566000 -0.83120300 0.01855200 72.21760 1056 'point symmetry operation' ? ? -0.20341100 0.33463800 0.92013100 -7.32584 -0.93137800 -0.35593700 -0.07644800 23.47252 0.30192600 -0.87254000 0.38407600 42.91516 1057 'point symmetry operation' ? ? 0.15322700 0.03928700 0.98740900 -228.11150 -0.78067200 0.61743400 0.09657800 229.93212 -0.60586600 -0.78564100 0.12527800 120.15249 1058 'point symmetry operation' ? ? -0.00667500 -0.00969400 0.99993000 -172.62436 -0.82904700 0.55918000 -0.00011300 267.48850 -0.55914000 -0.82898900 -0.01176900 30.00326 1059 'point symmetry operation' ? ? 0.36180300 0.26286500 0.89442700 0.00000 -0.58778500 0.80901700 0.00000000 0.00000 -0.72360700 -0.52573100 0.44721400 0.00000 1060 'point symmetry operation' ? ? 0.26296300 -0.43606200 0.86063900 -121.15368 0.28715100 0.88698200 0.36167300 -151.25594 -0.92108400 0.15202700 0.35846000 127.70779 1061 'point symmetry operation' ? ? 0.06983600 -0.47072700 0.87951000 -197.89121 0.13236600 0.87824000 0.45953700 -82.97909 -0.98873800 0.08432500 0.12364200 267.10666 1062 'point symmetry operation' ? ? 0.14780000 -0.43271800 0.88933100 -67.45608 0.24182800 0.88772400 0.39174600 -212.53078 -0.95899700 0.15716400 0.23585000 178.56832 1063 'point symmetry operation' ? ? 0.18808100 -0.45872300 0.86844500 -91.10772 0.24355500 0.87839100 0.41122900 -187.19926 -0.95147600 0.13417000 0.27693400 158.27678 1064 'point symmetry operation' ? ? 0.30139900 -0.41298000 0.85942200 -111.08652 0.40209400 0.87232200 0.27816400 -111.58670 -0.86456800 0.26173000 0.42897500 83.81544 1065 'point symmetry operation' ? ? 0.44345600 0.42499500 0.78912900 16.26468 -0.45500300 0.86529500 -0.21032400 196.48947 -0.77221600 -0.26578700 0.57709600 -61.67996 1066 'point symmetry operation' ? ? 0.27483200 -0.46091400 0.84381600 -209.68637 0.31382500 0.87254900 0.37439500 -139.37736 -0.90883500 0.16191500 0.38445200 168.34389 1067 'point symmetry operation' ? ? 0.40620800 0.47767000 0.77899000 70.70816 -0.42108100 0.85443400 -0.30435700 255.93362 -0.81097800 -0.20438600 0.54821700 -67.28780 1068 'point symmetry operation' ? ? 0.09733000 -0.47416600 0.87503900 -242.75389 0.15426600 0.87577500 0.45740600 -30.99077 -0.98322400 0.09046900 0.15838700 252.88369 1069 'point symmetry operation' ? ? 0.30402900 -0.41756400 0.85627400 -217.55606 0.38382000 0.87633500 0.29106700 -110.17104 -0.87192200 0.24016200 0.42670200 150.30423 1070 'point symmetry operation' ? ? 0.04240600 -0.46923600 0.88205400 -151.40797 0.11326500 0.87941400 0.46238600 -135.71933 -0.99266000 0.08029800 0.09044100 279.61807 1071 'point symmetry operation' ? ? 0.44097100 0.49730000 0.74715200 -115.95328 -0.39098200 0.85576100 -0.33883100 262.33859 -0.80788500 -0.14270800 0.57180200 47.08587 1072 'point symmetry operation' ? ? 0.29081000 -0.43172200 0.85384100 -161.69247 0.35375900 0.87768800 0.32329300 -122.85843 -0.88897900 0.20803700 0.40796600 125.14512 1073 'point symmetry operation' ? ? 0.33317700 -0.33997100 0.87943900 -299.87523 0.47637000 0.86562500 0.15415700 -48.60443 -0.81367300 0.36757700 0.45035900 186.79005 1074 'point symmetry operation' ? ? 0.31693500 -0.38319200 0.86759200 -174.16629 0.42916000 0.87368800 0.22911000 -82.02749 -0.84579800 0.29972300 0.44135400 114.30736 1075 'point symmetry operation' ? ? 0.29008800 -0.46100500 0.83864300 -261.99690 0.25655300 0.88171100 0.39593800 -59.82668 -0.92197000 0.10030000 0.37404700 170.13909 1076 'point symmetry operation' ? ? 0.29888000 -0.47013200 0.83044900 -304.29219 0.27570100 0.87565800 0.39650000 -81.05424 -0.91359700 0.11045000 0.39133300 198.56915 1077 'point symmetry operation' ? ? 0.31472700 -0.39826300 0.86158800 -277.80575 0.40898700 0.87603000 0.25554100 -94.75637 -0.85654900 0.27195300 0.43859500 181.00801 1078 'point symmetry operation' ? ? 0.23901300 -0.35214800 0.90491100 41.86220 0.45366100 0.86445600 0.21658000 -153.86499 -0.85852500 0.35875700 0.36637300 32.77420 1079 'point symmetry operation' ? ? 0.41086100 0.50296000 0.76041000 32.53165 -0.39199300 0.85048400 -0.35073900 283.27406 -0.82312500 -0.15397000 0.54658900 -31.00574 1080 'point symmetry operation' ? ? 0.25104900 -0.42564100 0.86936900 -76.65963 0.33956200 0.87978300 0.33268400 -155.30838 -0.90646100 0.21168500 0.36540200 100.56461 1081 'point symmetry operation' ? ? 0.32606400 -0.35929500 0.87440800 -237.74343 0.45323900 0.87113500 0.18893900 -62.37568 -0.82961300 0.33470900 0.44689300 150.04722 1082 'point symmetry operation' ? ? 0.14241700 -0.46811600 0.87211500 -166.37989 0.17315600 0.87929200 0.44369200 -123.54676 -0.97454300 0.08782300 0.20628400 218.17562 1083 'point symmetry operation' ? ? 0.22365600 -0.44628600 0.86649000 83.85202 0.31585000 0.87422400 0.36874300 -268.21508 -0.92207200 0.19120900 0.33648600 38.62302 1084 'point symmetry operation' ? ? 0.09881900 -0.47238900 0.87583200 -124.08158 0.17296300 0.87489700 0.45236900 -178.26082 -0.97995900 0.10678400 0.16816300 235.69979 1085 'point symmetry operation' ? ? 0.43847200 0.37681800 0.81593500 43.51735 -0.47467500 0.86800400 -0.14578200 151.84120 -0.76316800 -0.32338300 0.55946200 -82.05924 1086 'point symmetry operation' ? ? 0.20365000 -0.47126700 0.85815700 -132.10585 0.23383600 0.87457100 0.42478900 -159.29843 -0.95070900 0.11416000 0.28830600 168.83570 1087 'point symmetry operation' ? ? 0.45007400 0.47999200 0.75302100 -61.04183 -0.41183100 0.85979600 -0.30190400 246.96053 -0.79235600 -0.17423800 0.58464900 0.72708 1088 'point symmetry operation' ? ? 0.04138900 -0.44082300 0.89663900 -48.38120 0.15834300 0.88896100 0.42973900 -249.77097 -0.98651600 0.12419000 0.10659500 254.81694 1089 'point symmetry operation' ? ? 0.00105200 -0.47386600 0.88059600 -224.50814 0.08431100 0.87750300 0.47210100 -42.40741 -0.99643900 0.07374800 0.04087600 314.91425 1090 'point symmetry operation' ? ? 0.00620600 -0.46529600 0.88513300 -107.77539 0.09341000 0.88155000 0.46275800 -186.62866 -0.99560900 0.07980800 0.04893500 300.55036 1091 'point symmetry operation' ? ? 0.33452100 -0.42487300 0.84117700 76.58081 0.38159600 0.87722000 0.29132400 -200.35905 -0.86167300 0.22353500 0.45557900 -34.09250 1092 'point symmetry operation' ? ? 0.20417500 -0.40589400 0.89082100 107.69565 0.32714800 0.88596300 0.32869800 -268.49215 -0.92265200 0.22431800 0.31367900 37.84053 1093 'point symmetry operation' ? ? 0.29973900 -0.44450400 0.84414000 -317.58877 0.29968100 0.88390500 0.35903100 -107.31712 -0.90573000 0.14535700 0.39815100 217.58686 1094 'point symmetry operation' ? ? 0.45495200 0.45859800 0.76335200 -12.05228 -0.42917700 0.86399800 -0.26327700 230.40838 -0.78027200 -0.20783500 0.58989800 -39.02444 1095 'point symmetry operation' ? ? 0.27718600 -0.45804200 0.84460900 -213.29199 0.27054800 0.88069400 0.38882200 -93.31814 -0.92193900 0.12073100 0.36803900 157.70005 1096 'point symmetry operation' ? ? 0.30060200 -0.43983600 0.84627500 -265.14165 0.26351500 0.89107600 0.36951800 -100.23252 -0.91662300 0.11192800 0.38376400 188.11577 1097 'point symmetry operation' ? ? 0.25630700 -0.47439600 0.84217200 -157.43478 0.30039200 0.86722800 0.39708900 -140.91004 -0.91873400 0.15120400 0.36478300 141.49570 1098 'point symmetry operation' ? ? 0.15973200 -0.46754700 0.86941600 -216.36362 0.20546800 0.87718200 0.43397400 -62.00753 -0.96554100 0.10931700 0.23618100 207.74150 1099 'point symmetry operation' ? ? 0.08117700 -0.45335700 0.88762400 -84.42236 0.15256600 0.88572100 0.43843200 -213.21762 -0.98495400 0.09983100 0.14106700 242.73172 1100 'point symmetry operation' ? ? 0.23120400 -0.46168600 0.85638200 -182.06170 0.23343500 0.88084400 0.41185100 -100.51806 -0.94448500 0.10468800 0.31142900 164.95500 1101 'point symmetry operation' ? ? 0.24365800 -0.47655400 0.84470500 -224.02839 0.23810500 0.87369200 0.42422500 -68.63064 -0.94017900 0.09776300 0.32635300 169.39723 1102 'point symmetry operation' ? ? 0.30428800 0.19861700 0.93164300 -4.43542 -0.63116100 0.77456600 0.04101600 -32.36828 -0.71347300 -0.60049800 0.36105200 37.13434 1103 'point symmetry operation' ? ? 0.29663300 -0.44589800 0.84450200 -261.17372 0.33931100 0.87581300 0.34324700 -128.17643 -0.89267900 0.18473000 0.41109400 186.27708 1104 'point symmetry operation' ? ? 0.19231900 -0.47531400 0.85853900 -254.24497 0.21660500 0.87385400 0.43527200 -16.28527 -0.95712900 0.10225200 0.27101500 193.24479 1105 'point symmetry operation' ? ? 0.36180300 -0.26286500 0.89442700 0.00000 0.58778500 0.80901700 0.00000000 0.00000 -0.72360700 0.52573100 0.44721400 0.00000 1106 'point symmetry operation' ? ? -0.15009100 -0.71103600 0.68694900 -4.78031 0.98410000 -0.04069700 0.17289100 -206.90521 -0.09497500 0.70197600 0.70584000 -105.03938 1107 'point symmetry operation' ? ? -0.26939300 -0.75590500 0.59668600 -61.42401 0.91167700 -0.00055200 0.41090700 -337.02464 -0.31027800 0.65468100 0.68929100 -5.82825 1108 'point symmetry operation' ? ? -0.24054000 -0.70705000 0.66499700 81.61564 0.95336300 -0.04341600 0.29868600 -246.26577 -0.18231500 0.70582900 0.68452000 -119.57568 1109 'point symmetry operation' ? ? -0.20448200 -0.73184700 0.65006600 44.85002 0.96463200 -0.03780000 0.26087500 -231.23653 -0.16634800 0.68041900 0.71369400 -113.63923 1110 'point symmetry operation' ? ? -0.15023400 -0.65458700 0.74090800 -25.10823 0.98789300 -0.12872900 0.08658400 -153.02784 0.03870000 0.74494600 0.66600200 -88.14148 1111 'point symmetry operation' ? ? 0.36226200 -0.07523000 0.92903500 -86.60273 0.70489600 0.67424400 -0.22026400 120.10456 -0.60982600 0.73466700 0.29728300 144.05527 1112 'point symmetry operation' ? ? -0.14782200 -0.72358200 0.67422400 -74.89884 0.98697200 -0.06413900 0.14755700 -275.45687 -0.06352600 0.68725200 0.72363700 -101.23167 1113 'point symmetry operation' ? ? 0.30501900 -0.00824500 0.95231000 -66.51618 0.73250800 0.64106100 -0.22906800 166.40037 -0.60860000 0.76744600 0.20157700 207.16140 1114 'point symmetry operation' ? ? -0.25349000 -0.75612200 0.60334200 -126.12987 0.92544800 -0.00800300 0.37879100 -327.94182 -0.28158400 0.65438100 0.70178100 19.63520 1115 'point symmetry operation' ? ? -0.14222700 -0.66620600 0.73207900 -99.08917 0.98962000 -0.11109200 0.09116600 -254.43334 0.02059200 0.73744700 0.67509200 -86.63001 1116 'point symmetry operation' ? ? -0.28599300 -0.75623200 0.58849000 4.52520 0.89744400 0.00387100 0.44111200 -344.19462 -0.33586100 0.65429100 0.67756900 -32.24885 1117 'point symmetry operation' ? ? 0.32303100 0.02515500 0.94605400 -198.49384 0.75396400 0.59735400 -0.27332500 -8.30434 -0.57200500 0.80158300 0.17399900 212.16730 1118 'point symmetry operation' ? ? -0.14554900 -0.68786200 0.71109800 -52.50325 0.98921700 -0.08936800 0.11602700 -213.19213 -0.01626100 0.72031800 0.69345300 -93.23373 1119 'point symmetry operation' ? ? -0.14037200 -0.55956400 0.81681300 -186.13351 0.98106700 -0.18978400 0.03858700 -301.45734 0.13342700 0.80676500 0.57561100 -40.69383 1120 'point symmetry operation' ? ? -0.14316900 -0.61899600 0.77223400 -83.61512 0.98689700 -0.14795600 0.06437000 -196.66095 0.07441200 0.77133200 0.63206900 -66.79533 1121 'point symmetry operation' ? ? -0.11394600 -0.74458700 0.65772700 -153.31893 0.98693600 -0.00893300 0.16086500 -274.65043 -0.11390200 0.66746400 0.73587900 -47.21727 1122 'point symmetry operation' ? ? -0.11219800 -0.74707300 0.65520500 -172.88271 0.98947000 -0.02331900 0.14284900 -323.38344 -0.09144000 0.66433300 0.74182300 -64.25033 1123 'point symmetry operation' ? ? -0.13946400 -0.64065500 0.75505600 -149.08251 0.98887000 -0.13002000 0.07233100 -301.41388 0.05183300 0.75674000 0.65165900 -76.43897 1124 'point symmetry operation' ? ? -0.22426100 -0.57199900 0.78900100 110.57811 0.97215200 -0.18782300 0.14015300 -57.62129 0.06802500 0.79846000 0.59819300 -104.65789 1125 'point symmetry operation' ? ? 0.29330000 0.02916500 0.95557500 -101.01730 0.75380900 0.60771100 -0.24991900 127.74823 -0.58800300 0.79362300 0.15625800 236.09267 1126 'point symmetry operation' ? ? -0.17860800 -0.68250500 0.70872100 27.78625 0.98279000 -0.08923800 0.16174100 -166.14365 -0.04714400 0.72541200 0.68669800 -108.32754 1127 'point symmetry operation' ? ? -0.14106900 -0.58764600 0.79672500 -136.88630 0.98445200 -0.16834200 0.05014400 -248.03133 0.10465500 0.79141200 0.60225800 -51.66744 1128 'point symmetry operation' ? ? -0.22026900 -0.75313500 0.61989400 -30.53718 0.94307800 -0.00209100 0.33256600 -294.53497 -0.24917100 0.65786200 0.71072700 -53.51030 1129 'point symmetry operation' ? ? -0.19644500 -0.70359200 0.68291100 197.01757 0.97709100 -0.08231900 0.19625700 -80.07341 -0.08186900 0.70582000 0.70364500 -187.70851 1130 'point symmetry operation' ? ? -0.25925600 -0.74970800 0.60887100 34.03044 0.92908100 -0.02139600 0.36925600 -308.35896 -0.26380700 0.66142200 0.70208800 -80.52484 1131 'point symmetry operation' ? ? 0.36883300 -0.13382100 0.91981100 -49.75896 0.68900000 0.70358500 -0.17391800 135.23437 -0.62389200 0.69789700 0.35170900 104.49374 1132 'point symmetry operation' ? ? -0.18671900 -0.74656300 0.63857500 0.56918 0.96759800 -0.02729400 0.25101600 -249.03420 -0.16997000 0.66475400 0.72747000 -96.51487 1133 'point symmetry operation' ? ? 0.34403600 -0.00019200 0.93895600 -157.44351 0.73818300 0.61806000 -0.27034600 49.73396 -0.58028000 0.78613100 0.21277800 193.53080 1134 'point symmetry operation' ? ? -0.30434400 -0.72367400 0.61941000 134.96816 0.90571500 -0.01843100 0.42348500 -314.52153 -0.29504900 0.68989500 0.66105400 -111.88247 1135 'point symmetry operation' ? ? -0.31036200 -0.76122000 0.56940200 -88.40505 0.87412300 0.00688300 0.48565600 -376.47571 -0.37361100 0.64845600 0.66326500 42.70756 1136 'point symmetry operation' ? ? -0.30956000 -0.75388000 0.57951300 69.56643 0.87842000 0.00662300 0.47784400 -359.17450 -0.36407600 0.65697700 0.66017400 -54.13395 1137 'point symmetry operation' ? ? -0.11217100 -0.67747700 0.72694000 141.79235 0.99318300 -0.09978400 0.06026000 -0.34185 0.03171200 0.72874400 0.68405200 -164.51583 1138 'point symmetry operation' ? ? -0.21820000 -0.66462300 0.71460800 217.46767 0.97279000 -0.08967500 0.21363100 -69.35210 -0.07790200 0.74177800 0.66610600 -181.70392 1139 'point symmetry operation' ? ? -0.11948300 -0.71884600 0.68482400 -167.91514 0.99055300 -0.03956500 0.13129400 -353.33193 -0.06728500 0.69404200 0.71678300 -81.76097 1140 'point symmetry operation' ? ? 0.35895700 -0.02970200 0.93288100 -119.17112 0.72461900 0.63883900 -0.25848100 99.27023 -0.58828300 0.76876700 0.25084000 175.21366 1141 'point symmetry operation' ? ? -0.13100800 -0.73595400 0.66423500 -100.53818 0.98574600 -0.02536700 0.16631400 -253.70315 -0.10555000 0.67655600 0.72878800 -67.80801 1142 'point symmetry operation' ? ? -0.10636700 -0.72711300 0.67822700 -133.87487 0.98901100 -0.00692700 0.14768100 -303.76596 -0.10268300 0.68648200 0.71986000 -74.41829 1143 'point symmetry operation' ? ? -0.16080800 -0.73589800 0.65771800 -36.63698 0.98336200 -0.06240600 0.17060200 -230.86812 -0.08450000 0.67420900 0.73369100 -100.10034 1144 'point symmetry operation' ? ? -0.21660100 -0.74580700 0.62996500 -102.67141 0.95276900 -0.02078600 0.30298300 -287.90185 -0.21287300 0.66583700 0.71508500 -19.64335 1145 'point symmetry operation' ? ? -0.26716600 -0.73983100 0.61747200 85.02045 0.91952400 -0.00404200 0.39301300 -308.27484 -0.28826800 0.67278000 0.68137300 -96.15455 1146 'point symmetry operation' ? ? -0.16108200 -0.74359200 0.64893900 -68.55629 0.97390000 -0.01322400 0.22659300 -248.81643 -0.15991200 0.66850200 0.72631500 -62.05626 1147 'point symmetry operation' ? ? -0.15114500 -0.75527800 0.63773800 -117.05804 0.97697700 -0.01586600 0.21275500 -260.59095 -0.15057100 0.65521200 0.74028800 -44.54388 1148 'point symmetry operation' ? ? 0.33348600 -0.32424600 0.88524000 20.20823 0.54129800 0.83464600 0.10179800 -43.47721 -0.77187000 0.44523100 0.45385800 -12.15304 1149 'point symmetry operation' ? ? -0.13540800 -0.70572300 0.69542700 -119.07825 0.99037700 -0.07615100 0.11556000 -309.14937 -0.02859600 0.70438200 0.70924500 -97.91439 1150 'point symmetry operation' ? ? -0.19092900 -0.75303700 0.62966700 -158.77128 0.96291500 -0.01910800 0.26912600 -277.55315 -0.19063100 0.65770000 0.72876000 2.29705 1151 'point symmetry operation' ? ? 0.44721400 -0.52573200 0.72360600 0.00000 -0.85065100 0.00000000 0.52573200 0.00000 -0.27639400 -0.85065100 -0.44721400 0.00000 1152 'point symmetry operation' ? ? -0.27579500 -0.86091400 0.42750900 58.11829 -0.59722400 0.50197000 0.62558000 13.32414 -0.75316800 -0.08278700 -0.65259900 224.30046 1153 'point symmetry operation' ? ? -0.31752500 -0.89686400 0.30791700 -1.81754 -0.76354200 0.43437600 0.47783000 153.57556 -0.56230100 -0.08338500 -0.82271900 306.27424 1154 'point symmetry operation' ? ? -0.33233600 -0.85776100 0.39217200 150.36603 -0.67084600 0.50725500 0.54098000 34.67501 -0.66296300 -0.08330000 -0.74400400 240.40409 1155 'point symmetry operation' ? ? -0.30442500 -0.87513900 0.37610800 111.45866 -0.65704100 0.47880300 0.58227700 26.23729 -0.68965500 -0.06985900 -0.72076100 235.12638 1156 'point symmetry operation' ? ? -0.31349400 -0.80501900 0.50365200 25.43998 -0.48543400 0.59170900 0.64361200 -2.54281 -0.81613600 -0.04272200 -0.57628000 176.53114 1157 'point symmetry operation' ? ? 0.39717400 -0.38385500 0.83361100 -141.35967 -0.81234400 0.27560100 0.51394800 48.41899 -0.42702500 -0.88130600 -0.20236100 -142.65404 1158 'point symmetry operation' ? ? -0.28280400 -0.86491900 0.41465200 1.78557 -0.57153900 0.49912700 0.65131900 39.44752 -0.77030200 -0.05279500 -0.63549100 300.29152 1159 'point symmetry operation' ? ? 0.33812900 -0.32407500 0.88354100 -147.29686 -0.83440700 0.33095900 0.44071800 82.21565 -0.43524100 -0.88625200 -0.15850300 -215.80932 1160 'point symmetry operation' ? ? -0.31262900 -0.89577600 0.31598700 -71.62139 -0.74343600 0.43781200 0.50559400 160.18253 -0.59124200 -0.07685300 -0.80282400 305.04464 1161 'point symmetry operation' ? ? -0.30118500 -0.81681800 0.49203300 -28.57915 -0.50039900 0.57462400 0.64761800 37.42671 -0.81172000 -0.05116000 -0.58180300 282.56383 1162 'point symmetry operation' ? ? -0.32386500 -0.89778500 0.29848600 69.11781 -0.78088500 0.43178100 0.45142600 145.39997 -0.53416400 -0.08688200 -0.84090500 305.96106 1163 'point symmetry operation' ? ? 0.34158900 -0.29477300 0.89242700 -245.30888 -0.81107900 0.38727700 0.43837100 152.38514 -0.47483600 -0.87357100 -0.10679400 -32.95737 1164 'point symmetry operation' ? ? -0.29408000 -0.83612600 0.46304500 10.67283 -0.53208700 0.54567300 0.64739900 18.75700 -0.79397800 -0.05599400 -0.60536300 237.55913 1165 'point symmetry operation' ? ? -0.32922600 -0.72218000 0.60833100 -116.08572 -0.39983900 0.69026100 0.60305100 85.87312 -0.85541800 -0.04469500 -0.51600700 326.08013 1166 'point symmetry operation' ? ? -0.31651000 -0.77547600 0.54631300 -28.78986 -0.45340900 0.62955000 0.63094200 27.92682 -0.83321200 -0.04800400 -0.55086700 220.27239 1167 'point symmetry operation' ? ? -0.23678700 -0.88831600 0.39348100 -87.55532 -0.60887100 0.45128000 0.65239800 72.25156 -0.75710600 -0.08510000 -0.64772600 297.12440 1168 'point symmetry operation' ? ? -0.24175200 -0.88746700 0.39237600 -93.46136 -0.59074600 0.45540500 0.66605300 78.95054 -0.76979000 -0.07077500 -0.63436200 351.60393 1169 'point symmetry operation' ? ? -0.30708100 -0.79487300 0.52333400 -71.11779 -0.47300000 0.60465000 0.64083600 61.46406 -0.82581700 -0.05074900 -0.56165100 331.78818 1170 'point symmetry operation' ? ? -0.38916100 -0.73198200 0.55924600 143.02918 -0.46464400 0.68019500 0.56695800 -42.25215 -0.79540000 -0.03921300 -0.60481600 65.25689 1171 'point symmetry operation' ? ? 0.31787500 -0.29045700 0.90254700 -181.69379 -0.82944000 0.37597900 0.41312300 120.54708 -0.45933300 -0.87993000 -0.12140200 -186.33236 1172 'point symmetry operation' ? ? -0.31581400 -0.83248000 0.45523400 83.25247 -0.56051500 0.55081200 0.61840900 -4.56295 -0.76556200 -0.05986400 -0.64057200 182.09589 1173 'point symmetry operation' ? ? -0.32248400 -0.74801900 0.58006200 -75.08466 -0.42611900 0.66191700 0.61667600 57.82612 -0.84523800 -0.04830800 -0.53220200 271.92912 1174 'point symmetry operation' ? ? -0.29298500 -0.89487000 0.33670200 33.71505 -0.71928100 0.43830200 0.53900600 96.78782 -0.62991700 -0.08426300 -0.77207800 282.91743 1175 'point symmetry operation' ? ? -0.32218600 -0.84816300 0.42049500 251.50816 -0.59010200 0.52726000 0.61137400 -87.63021 -0.74025500 -0.05115900 -0.67037800 97.60579 1176 'point symmetry operation' ? ? -0.32359600 -0.88947100 0.32268800 104.58692 -0.73106700 0.45154000 0.51152100 91.20954 -0.60068900 -0.07038100 -0.79637900 288.91198 1177 'point symmetry operation' ? ? 0.40986900 -0.43395700 0.80230200 -97.98414 -0.81529300 0.22013400 0.53557300 13.18667 -0.40903000 -0.87362700 -0.26357500 -148.01521 1178 'point symmetry operation' ? ? -0.28708100 -0.88645500 0.36301800 67.67358 -0.65871900 0.45783400 0.59705900 42.50910 -0.69546800 -0.06772300 -0.71535900 254.84671 1179 'point symmetry operation' ? ? 0.36633700 -0.31787400 0.87450200 -210.70336 -0.80681500 0.35966200 0.46871600 114.18189 -0.46351700 -0.87726900 -0.12470800 -85.33932 1180 'point symmetry operation' ? ? -0.35387200 -0.87316300 0.33520300 209.86478 -0.75328600 0.47850700 0.45121300 84.01480 -0.55437900 -0.09283200 -0.82707100 280.27915 1181 'point symmetry operation' ? ? -0.33272500 -0.90138600 0.27712300 -34.38015 -0.80529600 0.42450100 0.41388400 210.20479 -0.49070800 -0.08545600 -0.86712400 325.58490 1182 'point symmetry operation' ? ? -0.33530000 -0.89674700 0.28882400 139.20832 -0.79920300 0.43307100 0.41680400 144.83994 -0.49884900 -0.09107500 -0.86189100 310.51402 1183 'point symmetry operation' ? ? -0.27636800 -0.82692500 0.48971000 179.83450 -0.48783900 0.55973500 0.66985900 -116.73902 -0.82803100 -0.05377200 -0.55809900 34.67386 1184 'point symmetry operation' ? ? -0.34319000 -0.81999400 0.45807200 267.47735 -0.58811100 0.56785700 0.57590400 -84.56073 -0.73235700 -0.07175200 -0.67713000 80.14808 1185 'point symmetry operation' ? ? -0.25550500 -0.86630200 0.42922900 -79.05071 -0.57192400 0.49338700 0.65534200 79.83637 -0.77950100 -0.07804400 -0.62152200 383.53765 1186 'point symmetry operation' ? ? 0.38488600 -0.34440400 0.85630000 -177.43615 -0.80441700 0.32970800 0.49417400 80.05000 -0.45252400 -0.87902200 -0.15014400 -129.86402 1187 'point symmetry operation' ? ? -0.25506400 -0.87998100 0.40072000 -35.27261 -0.60394300 0.46863300 0.64469900 52.83716 -0.75511400 -0.07757300 -0.65098900 273.92574 1188 'point symmetry operation' ? ? -0.23304700 -0.87734600 0.41946800 -56.88929 -0.59913300 0.46929400 0.64869400 66.82963 -0.76598300 -0.10014200 -0.63501400 328.68201 1189 'point symmetry operation' ? ? -0.28872200 -0.87326200 0.39249600 30.47112 -0.58968600 0.48516600 0.64566700 24.33155 -0.75426200 -0.04503100 -0.65502800 251.28074 1190 'point symmetry operation' ? ? -0.30111800 -0.88709500 0.34984300 -45.04974 -0.69265400 0.45562400 0.55914000 110.56127 -0.65540800 -0.07395300 -0.75164700 282.06667 1191 'point symmetry operation' ? ? -0.32277400 -0.88607400 0.33270100 157.19167 -0.74838100 0.45412900 0.48341900 86.15591 -0.57943400 -0.09295200 -0.80970200 281.73690 1192 'point symmetry operation' ? ? -0.26660100 -0.88696300 0.37712200 -7.36257 -0.64914900 0.45446900 0.60997100 60.48232 -0.71241200 -0.08219000 -0.69693200 258.35699 1193 'point symmetry operation' ? ? -0.26027000 -0.89392900 0.36489800 -56.23153 -0.64112700 0.44258700 0.62695600 73.38690 -0.72195400 -0.07076800 -0.68831400 273.94683 1194 'point symmetry operation' ? ? 0.44128400 -0.56578700 0.69653000 29.56388 -0.87306300 -0.09126400 0.47899200 14.68365 -0.20743900 -0.81948600 -0.53424000 36.83352 1195 'point symmetry operation' ? ? -0.28125400 -0.85078700 0.44391200 -35.50495 -0.54151200 0.52260700 0.65851900 51.93822 -0.79225100 -0.05517300 -0.60769600 339.67948 1196 'point symmetry operation' ? ? -0.28459700 -0.89196800 0.35128100 -105.93378 -0.67463600 0.44668800 0.58765400 114.93654 -0.68108100 -0.06974200 -0.72888000 278.95717 1197 'point symmetry operation' ? ? -0.36180300 -0.58778500 0.72360700 0.00000 -0.26286500 0.80901700 0.52573100 0.00000 -0.89442700 0.00000000 -0.44721400 0.00000 1198 'point symmetry operation' ? ? -0.80418300 -0.25494900 0.53692700 110.15138 0.38687600 0.46127200 0.79847000 -193.58107 -0.45123900 0.84984000 -0.27231400 65.26048 1199 'point symmetry operation' ? ? -0.89388100 -0.32574800 0.30800200 189.12184 0.14813600 0.43382400 0.88873600 -183.44924 -0.42312200 0.84005100 -0.33953300 219.02466 1200 'point symmetry operation' ? ? -0.86784500 -0.24933900 0.42973700 191.17742 0.28251800 0.46383900 0.83966500 -211.59081 -0.40869000 0.85010800 -0.33209800 16.93593 1201 'point symmetry operation' ? ? -0.84699900 -0.27686200 0.45380600 157.81209 0.30759200 0.44100200 0.84315100 -204.99927 -0.43356500 0.85373600 -0.28836900 38.29335 1202 'point symmetry operation' ? ? -0.76994200 -0.14462300 0.62150900 64.10754 0.50246000 0.46297900 0.73019400 -155.57063 -0.39334800 0.87449100 -0.28380100 59.20189 1203 'point symmetry operation' ? ? -0.41064200 -0.31141800 0.85696700 -100.93391 -0.10744700 0.94984500 0.29368300 168.52349 -0.90544300 0.02851900 -0.42350800 63.94721 1204 'point symmetry operation' ? ? -0.79594500 -0.25130300 0.55074400 111.34344 0.41543300 0.43498800 0.79887400 -236.00936 -0.44032600 0.86465700 -0.24182800 153.74136 1205 'point symmetry operation' ? ? -0.46770500 -0.23458700 0.85218600 -101.87770 -0.10189800 0.97201900 0.21164900 248.61590 -0.87799100 0.01215300 -0.47852300 53.29521 1206 'point symmetry operation' ? ? -0.88475800 -0.32084800 0.33802100 146.50300 0.18201300 0.42980900 0.88438400 -167.75944 -0.42903700 0.84399100 -0.32187900 272.45879 1207 'point symmetry operation' ? ? -0.77076400 -0.16662800 0.61494500 84.68367 0.48922100 0.46353100 0.73878400 -217.00663 -0.40814800 0.87027200 -0.27575700 166.72301 1208 'point symmetry operation' ? ? -0.90229200 -0.32911800 0.27847800 230.99378 0.11655900 0.43565100 0.89253700 -198.79482 -0.41506900 0.83778800 -0.35472400 163.25713 1209 'point symmetry operation' ? ? -0.46027300 -0.17266700 0.87082400 -68.79731 -0.05711400 0.98463100 0.16504500 144.08066 -0.88593800 0.02622900 -0.46306200 242.88160 1210 'point symmetry operation' ? ? -0.78290200 -0.20083900 0.58883600 85.72743 0.45713100 0.45630500 0.76342500 -194.43512 -0.42201400 0.86686200 -0.26543300 108.37804 1211 'point symmetry operation' ? ? -0.73244800 -0.02177500 0.68047500 71.35042 0.58122900 0.50047500 0.64163600 -215.58425 -0.35453300 0.86547600 -0.35391700 274.97421 1212 'point symmetry operation' ? ? -0.75464700 -0.10022300 0.64843100 60.78773 0.53348800 0.48159300 0.69531100 -168.73412 -0.38196600 0.87064500 -0.30996600 134.02348 1213 'point symmetry operation' ? ? -0.78711900 -0.30885400 0.53390300 73.11183 0.37806600 0.44234600 0.81326200 -202.39889 -0.48734900 0.84198500 -0.23141300 234.21874 1214 'point symmetry operation' ? ? -0.78148200 -0.30148700 0.54625200 88.81783 0.39872500 0.43208500 0.80890100 -244.43292 -0.47990000 0.84994600 -0.21745800 266.37826 1215 'point symmetry operation' ? ? -0.75976000 -0.13112900 0.63684400 86.29540 0.51587000 0.47463000 0.71316500 -239.94982 -0.39578200 0.87036300 -0.29296000 232.15526 1216 'point symmetry operation' ? ? -0.80066300 -0.03376200 0.59816200 84.90584 0.50750800 0.49237200 0.70711100 -99.87341 -0.31839200 0.86973000 -0.37709000 -96.52631 1217 'point symmetry operation' ? ? -0.48453200 -0.17930500 0.85620000 -90.42532 -0.07563000 0.98368900 0.16320400 248.29516 -0.87149800 0.01432200 -0.49019100 111.51957 1218 'point symmetry operation' ? ? -0.80919100 -0.19592700 0.55391500 103.03715 0.42227600 0.46157400 0.78014900 -170.70659 -0.40852400 0.86519500 -0.29076700 18.79495 1219 'point symmetry operation' ? ? -0.74319700 -0.05961300 0.66641100 64.58617 0.55833400 0.49357500 0.66681900 -190.20522 -0.36867500 0.86765800 -0.33354100 206.34330 1220 'point symmetry operation' ? ? -0.86564700 -0.32195100 0.38340900 167.42139 0.22379800 0.43621000 0.87157000 -197.74724 -0.44784900 0.84027900 -0.30555300 153.01252 1221 'point symmetry operation' ? ? -0.82683200 -0.22024900 0.51753100 135.38797 0.38699000 0.44494100 0.80763000 -167.70355 -0.40815100 0.86805400 -0.28265800 -184.41216 1222 'point symmetry operation' ? ? -0.88621400 -0.30538200 0.34837600 212.78160 0.19801500 0.43014300 0.88077600 -217.14952 -0.41882500 0.84954000 -0.32073000 101.47732 1223 'point symmetry operation' ? ? -0.39918200 -0.38107600 0.83392700 -97.56506 -0.12629200 0.92371900 0.36165400 148.42102 -0.90813200 0.03904700 -0.41685900 11.64010 1224 'point symmetry operation' ? ? -0.83812600 -0.29829300 0.45669100 145.08882 0.30888000 0.43053900 0.84807300 -206.52513 -0.44959800 0.85185500 -0.26871000 87.35033 1225 'point symmetry operation' ? ? -0.43760900 -0.20819100 0.87473100 -86.35231 -0.06863100 0.97772100 0.19836900 163.91574 -0.89654200 0.02677400 -0.44214900 174.33026 1226 'point symmetry operation' ? ? -0.90901500 -0.28209000 0.30678500 276.06673 0.15243100 0.46007500 0.87469700 -230.50686 -0.38788700 0.84187700 -0.37521700 17.65431 1227 'point symmetry operation' ? ? -0.91302400 -0.33615000 0.23106400 211.58720 0.06882800 0.43138300 0.89953900 -166.27114 -0.40205700 0.83720500 -0.37072700 280.99486 1228 'point symmetry operation' ? ? -0.91280800 -0.32869300 0.24237000 278.88492 0.07921800 0.43969400 0.89464700 -214.33474 -0.40063200 0.83584100 -0.37531900 114.28087 1229 'point symmetry operation' ? ? -0.74998100 -0.18437600 0.63524300 49.88152 0.50534400 0.45995100 0.73011700 -117.08075 -0.42679700 0.86859100 -0.25178300 -175.99602 1230 'point symmetry operation' ? ? -0.83736900 -0.17910700 0.51646200 143.38764 0.38468000 0.47818100 0.78953400 -153.91277 -0.38837300 0.85980400 -0.33151600 -202.16119 1231 'point symmetry operation' ? ? -0.78043900 -0.26316000 0.56715300 107.92063 0.41863000 0.45382100 0.78663500 -273.49559 -0.46439600 0.85134800 -0.24401400 270.69754 1232 'point symmetry operation' ? ? -0.42047700 -0.24708600 0.87301100 -99.83151 -0.07979700 0.96854600 0.23569200 179.32014 -0.90378700 0.02943900 -0.42696900 112.40164 1233 'point symmetry operation' ? ? -0.79543800 -0.28924000 0.53255900 88.41139 0.38180400 0.44326500 0.81101200 -200.86600 -0.47064200 0.84844300 -0.24215800 175.80509 1234 'point symmetry operation' ? ? -0.78036200 -0.29325600 0.55230000 98.67418 0.38987800 0.46236600 0.79637400 -236.93635 -0.48890600 0.83679000 -0.24648000 223.29113 1235 'point symmetry operation' ? ? -0.80796900 -0.26436200 0.52659100 106.63743 0.39367600 0.42275900 0.81626800 -206.53658 -0.43841100 0.86682600 -0.23750500 103.11906 1236 'point symmetry operation' ? ? -0.85982400 -0.30196500 0.41172700 123.82798 0.26011600 0.43483800 0.86212300 -177.34067 -0.43936500 0.84837100 -0.29533900 216.86792 1237 'point symmetry operation' ? ? -0.89170300 -0.30756100 0.33207100 242.60894 0.17114300 0.45008600 0.87643100 -222.11905 -0.41901600 0.83834900 -0.34870700 57.54652 1238 'point symmetry operation' ? ? -0.82248500 -0.30494800 0.48013100 108.09226 0.32475200 0.44124500 0.83656300 -188.33415 -0.46696300 0.84398400 -0.26388600 152.66591 1239 'point symmetry operation' ? ? -0.81535400 -0.31464100 0.48600200 88.49970 0.33585100 0.42672000 0.83971100 -187.20409 -0.47159400 0.84788600 -0.24225700 201.78415 1240 'point symmetry operation' ? ? -0.36214600 -0.66884800 0.64922400 40.11770 -0.33176400 0.74338200 0.58078900 -28.79358 -0.87108100 -0.00505900 -0.49111300 2.79948 1241 'point symmetry operation' ? ? -0.78030600 -0.22632100 0.58301000 105.81072 0.44886600 0.44645500 0.77407800 -257.21115 -0.43547800 0.86571100 -0.24678500 204.90664 1242 'point symmetry operation' ? ? -0.84343800 -0.31021900 0.43860700 85.13731 0.28828000 0.42758000 0.85677900 -162.61669 -0.45332900 0.84908100 -0.27120800 261.83363 1243 'point symmetry operation' ? ? -0.67082000 0.16246000 0.72360700 0.00000 0.68819100 0.50000000 0.52573100 0.00000 -0.27639300 0.85065100 -0.44721400 0.00000 1244 'point symmetry operation' ? ? -0.39793700 0.38130800 0.83441600 -41.29139 0.70793200 -0.45086200 0.54365000 -170.19958 0.58350500 0.80704900 -0.09052600 -152.29259 1245 'point symmetry operation' ? ? -0.61463600 0.31222000 0.72439000 61.15566 0.57921700 -0.44475700 0.68315400 -308.76281 0.53547200 0.83947000 0.09252000 -135.34413 1246 'point symmetry operation' ? ? -0.50070100 0.38691200 0.77433700 -12.68817 0.62990100 -0.45071800 0.63251700 -151.26064 0.59373600 0.80445800 -0.01804200 -242.00328 1247 'point symmetry operation' ? ? -0.47633700 0.35373600 0.80496800 -24.63104 0.66021200 -0.46075100 0.59315100 -160.71203 0.58070900 0.81399000 -0.01406900 -204.84319 1248 'point symmetry operation' ? ? -0.27942400 0.46330600 0.84099300 -47.69465 0.71091700 -0.48890100 0.50554300 -138.56033 0.64538400 0.73913700 -0.19276200 -101.70115 1249 'point symmetry operation' ? ? -0.59967000 0.45265200 0.65992600 65.94241 0.78320500 0.50125500 0.36787600 46.26272 -0.16427200 0.73746200 -0.65510700 190.23263 1250 'point symmetry operation' ? ? -0.36974200 0.36976200 0.85238900 -45.23497 0.71158900 -0.47720000 0.51567500 -266.87370 0.59743700 0.79721800 -0.08667800 -135.89121 1251 'point symmetry operation' ? ? -0.62654200 0.51492800 0.58505800 117.48404 0.77189800 0.51378200 0.37443400 95.52337 -0.10778600 0.68620400 -0.71937900 228.25894 1252 'point symmetry operation' ? ? -0.58683800 0.31383200 0.74641200 58.13249 0.59970500 -0.45091200 0.66108400 -339.44783 0.54403600 0.83557600 0.07640500 -72.35976 1253 'point symmetry operation' ? ? -0.29317600 0.44775800 0.84472500 -46.45335 0.71702000 -0.48146200 0.50406000 -264.08404 0.63240000 0.75346300 -0.17989900 -100.80412 1254 'point symmetry operation' ? ? -0.63978300 0.31059100 0.70300100 63.26977 0.55794500 -0.44137100 0.70277300 -275.79944 0.52855900 0.84185800 0.10908900 -198.65061 1255 'point symmetry operation' ? ? -0.59293300 0.56903500 0.56976200 120.13524 0.79984300 0.49805500 0.33495200 -123.39026 -0.09317300 0.65432400 -0.75045300 234.14987 1256 'point symmetry operation' ? ? -0.32723500 0.41889300 0.84702200 -46.34582 0.71474200 -0.47661600 0.51184100 -203.33667 0.61811100 0.77289400 -0.14343500 -115.78550 1257 'point symmetry operation' ? ? -0.18933500 0.56902700 0.80022500 -24.49878 0.71119100 -0.48244300 0.51132800 -353.29067 0.67702300 0.66592500 -0.31334400 -41.99690 1258 'point symmetry operation' ? ? -0.24466400 0.50483700 0.82781600 -38.30047 0.71426400 -0.48353600 0.50598500 -208.24978 0.65571900 0.71507500 -0.24228300 -72.75814 1259 'point symmetry operation' ? ? -0.40253400 0.32995200 0.85387200 -25.50769 0.73147200 -0.44488500 0.51674500 -312.31549 0.55037700 0.83259200 -0.06227000 -54.56590 1260 'point symmetry operation' ? ? -0.38247700 0.33003300 0.86301200 -35.01055 0.73454900 -0.45798500 0.50068700 -363.24062 0.56049000 0.82542600 -0.06725800 -73.64731 1261 'point symmetry operation' ? ? -0.26403700 0.47923400 0.83703000 -43.07643 0.71803800 -0.48175600 0.50232700 -331.47745 0.64397700 0.73365200 -0.21690700 -84.77015 1262 'point symmetry operation' ? ? -0.27584000 0.55658500 0.78366200 -38.45463 0.65467000 -0.48816500 0.57715000 18.37966 0.70379000 0.67224100 -0.22972400 -157.11292 1263 'point symmetry operation' ? ? -0.61795800 0.56064300 0.55118600 141.03862 0.78224200 0.50879100 0.35948500 43.97386 -0.07889600 0.65330800 -0.75297100 245.84201 1264 'point symmetry operation' ? ? -0.36512900 0.42535300 0.82810300 -43.16451 0.69011100 -0.47336100 0.54742700 -118.08063 0.62484200 0.77136500 -0.12070300 -155.89886 1265 'point symmetry operation' ? ? -0.21621100 0.53949900 0.81375300 -30.53989 0.71352000 -0.48160100 0.50887000 -281.12132 0.66644000 0.69065200 -0.28081600 -54.45235 1266 'point symmetry operation' ? ? -0.55046100 0.31647200 0.77255300 18.51347 0.63349500 -0.44437400 0.63341500 -256.23309 0.54376100 0.83807900 0.04412700 -156.67997 1267 'point symmetry operation' ? ? -0.40114300 0.39838100 0.82484900 -75.56134 0.67501600 -0.48015800 0.56018000 51.02342 0.61922400 0.78149900 -0.07630100 -268.60632 1268 'point symmetry operation' ? ? -0.57397900 0.32597100 0.75119300 21.34558 0.59925500 -0.45797800 0.65662000 -229.46500 0.55806900 0.82704200 0.06752900 -222.75056 1269 'point symmetry operation' ? ? -0.60569400 0.39085300 0.69308600 39.91062 0.77420800 0.49055400 0.39994900 80.15926 -0.18367400 0.77884000 -0.59972800 153.83396 1270 'point symmetry operation' ? ? -0.47392900 0.33163900 0.81572500 -20.65713 0.67305300 -0.46090100 0.57842100 -201.13830 0.56779500 0.82315600 -0.00477700 -174.49979 1271 'point symmetry operation' ? ? -0.58858700 0.54060000 0.60109600 103.06217 0.79942200 0.49990800 0.33319000 -52.30749 -0.12037000 0.67664100 -0.72640800 226.62363 1272 'point symmetry operation' ? ? -0.61209400 0.36007700 0.70404900 31.43803 0.55385000 -0.44027700 0.70668700 -175.12088 0.56443900 0.82249700 0.07006200 -313.05328 1273 'point symmetry operation' ? ? -0.67623400 0.30277500 0.67159100 105.17586 0.52475400 -0.44186600 0.72759000 -356.53848 0.51705000 0.84444200 0.13992200 -114.85525 1274 'point symmetry operation' ? ? -0.66854500 0.31312100 0.67453900 71.16498 0.52870200 -0.43776200 0.72721300 -249.68811 0.52299400 0.84280500 0.12711600 -263.37765 1275 'point symmetry operation' ? ? -0.27329300 0.43292400 0.85900400 -95.75651 0.73756900 -0.47893800 0.47603600 83.06701 0.61749700 0.76367200 -0.18842200 -176.35544 1276 'point symmetry operation' ? ? -0.40433500 0.44657500 0.79817500 -65.61002 0.65874900 -0.46320500 0.59286700 71.71741 0.63447900 0.76551400 -0.10689100 -275.08230 1277 'point symmetry operation' ? ? -0.36379300 0.37108900 0.85436900 -41.00284 0.73114400 -0.45453600 0.50874800 -384.54959 0.57713400 0.80974600 -0.10596300 -100.81775 1278 'point symmetry operation' ? ? -0.58678100 0.50893100 0.62982300 87.50456 0.79721900 0.49937300 0.33921800 10.26415 -0.14187700 0.70115400 -0.69875300 216.78054 1279 'point symmetry operation' ? ? -0.40092400 0.34552700 0.84845200 -30.33465 0.72048100 -0.45310600 0.52497800 -264.34501 0.56583300 0.82177000 -0.06728500 -90.95426 1280 'point symmetry operation' ? ? -0.39030300 0.35275700 0.85042700 -35.14863 0.73760500 -0.43299100 0.51812800 -324.44150 0.55100100 0.82950700 -0.09119900 -96.10740 1281 'point symmetry operation' ? ? -0.39225200 0.35318500 0.84935200 -42.10063 0.70103500 -0.48303800 0.52461700 -208.31088 0.59555700 0.80120800 -0.05812300 -139.63012 1282 'point symmetry operation' ? ? -0.51921600 0.33117100 0.78787100 20.96294 0.64349100 -0.45519100 0.61540200 -293.26625 0.56243600 0.82651500 0.02323600 -85.85010 1283 'point symmetry operation' ? ? -0.59620700 0.33514100 0.72953200 25.79221 0.58687400 -0.43813300 0.68089500 -199.42575 0.54782900 0.83409800 0.06453200 -266.59291 1284 'point symmetry operation' ? ? -0.45731400 0.33236800 0.82486100 -14.90352 0.69322000 -0.44777100 0.56475400 -241.59308 0.55705600 0.83008000 -0.02563200 -108.95524 1285 'point symmetry operation' ? ? -0.44617300 0.31694700 0.83694300 -13.69297 0.70155000 -0.45677800 0.54697500 -279.62751 0.55566000 0.83120300 -0.01855300 -72.21747 1286 'point symmetry operation' ? ? -0.71201300 0.06151400 0.69946600 7.87005 0.63393800 0.48465500 0.60268700 -23.29569 -0.30192600 0.87254000 -0.38407700 -42.91517 1287 'point symmetry operation' ? ? -0.33490400 0.39470300 0.85559900 -49.39559 0.72164100 -0.47642200 0.50225100 -320.09952 0.60586600 0.78564100 -0.12527800 -120.15234 1288 'point symmetry operation' ? ? -0.49270100 0.32083500 0.80889400 17.56957 0.66678900 -0.45808400 0.58783600 -317.86868 0.55914000 0.82899000 0.01176800 -30.00312 1289 'point symmetry operation' ? ? -0.05278600 0.68819100 0.72360700 0.00000 0.68819100 -0.50000000 0.52573100 0.00000 0.72360700 0.52573100 -0.44721400 0.00000 1290 'point symmetry operation' ? ? 0.38152500 0.16857300 0.90885800 -186.92154 -0.07774400 -0.97389500 0.21327200 51.15618 0.92108400 -0.15202700 -0.35846000 -127.70779 1291 'point symmetry operation' ? ? 0.13430200 0.13539000 0.98164800 -208.87151 -0.06603700 -0.98719700 0.14519000 -49.18623 0.98873800 -0.08432500 -0.12364200 -267.10666 1292 'point symmetry operation' ? ? 0.26171600 0.17171500 0.94974700 -179.49572 -0.10876700 -0.97252900 0.20580700 132.29122 0.95899700 -0.15716400 -0.23585000 -178.56832 1293 'point symmetry operation' ? ? 0.29532000 0.14519000 0.94430200 -183.74081 -0.08648800 -0.98026400 0.17776800 97.89551 0.95147600 -0.13417000 -0.27693400 -158.27678 1294 'point symmetry operation' ? ? 0.48018300 0.17863000 0.85878800 -155.46002 -0.14814200 -0.94846600 0.28011600 24.98045 0.86456800 -0.26173000 -0.42897500 -83.81544 1295 'point symmetry operation' ? ? 0.09132000 0.85243700 0.51479400 128.65207 0.62876300 -0.45023200 0.63399400 -149.40315 0.77221600 0.26578700 -0.57709600 61.67996 1296 'point symmetry operation' ? ? 0.40680600 0.13998400 0.90272600 -251.56402 -0.09234700 -0.97682500 0.19309000 -10.49205 0.90883500 -0.16191500 -0.38445200 -168.34389 1297 'point symmetry operation' ? ? 0.08112500 0.88866700 0.45132000 207.63821 0.57942500 -0.41048400 0.70410900 -165.49339 0.81097800 0.20438600 -0.54821700 67.28780 1298 'point symmetry operation' ? ? 0.16941700 0.13115900 0.97677800 -214.60823 -0.06759400 -0.98722500 0.14428600 -117.61529 0.98322400 -0.09046900 -0.15838700 -252.88369 1299 'point symmetry operation' ? ? 0.47156900 0.17728000 0.86382600 -240.76369 -0.13181200 -0.95440800 0.26782700 -38.74614 0.87192200 -0.24016200 -0.42670200 -150.30423 1300 'point symmetry operation' ? ? 0.10088300 0.13728700 0.98538100 -202.26569 -0.06670800 -0.98727100 0.14438000 20.80369 0.99266000 -0.08029800 -0.09044100 -279.61807 1301 'point symmetry operation' ? ? 0.12694000 0.90532800 0.40529900 60.39049 0.57550700 -0.40001900 0.71328500 -280.39206 0.80788500 0.14270800 -0.57180200 -47.08587 1302 'point symmetry operation' ? ? 0.44320500 0.16662200 0.88079900 -203.02651 -0.11526300 -0.96382500 0.24032600 4.35400 0.88897900 -0.20803700 -0.40796600 -125.14512 1303 'point symmetry operation' ? ? 0.54955000 0.23375900 0.80209200 -271.17342 -0.18955500 -0.90013500 0.39220600 -136.94060 0.81367300 -0.36757700 -0.45035900 -186.79005 1304 'point symmetry operation' ? ? 0.50866000 0.20353200 0.83656400 -189.11822 -0.16090800 -0.93206300 0.32460400 -36.01085 0.84579800 -0.29972300 -0.44135400 -114.30736 1305 'point symmetry operation' ? ? 0.38548500 0.14529500 0.91120300 -247.12545 -0.03704600 -0.98429100 0.17262200 -105.59727 0.92197000 -0.10030000 -0.37404700 -170.13909 1306 'point symmetry operation' ? ? 0.40385300 0.13435400 0.90490500 -293.82035 -0.04736900 -0.98475900 0.16735100 -113.28439 0.91359700 -0.11045000 -0.39133300 -198.56915 1307 'point symmetry operation' ? ? 0.49501600 0.19271600 0.84724200 -280.44625 -0.14588500 -0.94281600 0.29969200 -86.63077 0.85654900 -0.27195300 -0.43859500 -181.00801 1308 'point symmetry operation' ? ? 0.46002100 0.22322000 0.85939100 -56.57234 -0.22653100 -0.90634800 0.35667600 149.08537 0.85852500 -0.35875700 -0.36637300 -32.77420 1309 'point symmetry operation' ? ? 0.10198700 0.90680600 0.40902500 192.82302 0.55862700 -0.39242300 0.73071100 -210.05188 0.82312500 0.15397000 -0.54658900 31.00574 1310 'point symmetry operation' ? ? 0.40269400 0.17277200 0.89888100 -153.30703 -0.12714800 -0.96194500 0.24185600 80.58765 0.90646100 -0.21168500 -0.36540200 -100.56461 1311 'point symmetry operation' ? ? 0.53019900 0.22136500 0.81846600 -229.00222 -0.17502200 -0.91595200 0.36110900 -89.27924 0.82961300 -0.33470900 -0.44689300 -150.04722 1312 'point symmetry operation' ? ? 0.21699700 0.13812100 0.96635200 -207.22335 -0.05637500 -0.98651400 0.15366200 2.15563 0.97454300 -0.08782300 -0.20628400 -218.17562 1313 'point symmetry operation' ? ? 0.36659400 0.15280200 0.91774800 -89.81514 -0.12406500 -0.96958300 0.21099100 266.27754 0.92207200 -0.19120900 -0.33648600 -38.62302 1314 'point symmetry operation' ? ? 0.18161200 0.13208100 0.97446000 -205.16340 -0.08184500 -0.98547000 0.14882700 71.28256 0.97995900 -0.10678400 -0.16816300 -235.69979 1315 'point symmetry operation' ? ? 0.07572500 0.81505300 0.57441700 124.45638 0.64174800 -0.48074200 0.59753400 -97.26320 0.76316800 0.32338300 -0.55946200 82.05924 1316 'point symmetry operation' ? ? 0.30220200 0.13279700 0.94394900 -200.50933 -0.06947500 -0.98454700 0.16075100 51.22514 0.95070900 -0.11416000 -0.28830600 -168.83570 1317 'point symmetry operation' ? ? 0.12205000 0.89369700 0.43175200 95.77585 0.59772600 -0.41345700 0.68686000 -235.67477 0.79235600 0.17423800 -0.58464900 -0.72708 1318 'point symmetry operation' ? ? 0.12655700 0.16588500 0.97799100 -185.95308 -0.10377400 -0.97829400 0.17936500 173.63106 0.98651600 -0.12419000 -0.10659500 -254.81694 1319 'point symmetry operation' ? ? 0.05040800 0.13241700 0.98991200 -206.55766 -0.06759100 -0.98844700 0.13566300 -97.65448 0.99643900 -0.07374800 -0.04087600 -314.91425 1320 'point symmetry operation' ? ? 0.05992600 0.14172900 0.98809000 -196.88993 -0.07192200 -0.98668300 0.14588900 87.63679 0.99560900 -0.07980800 -0.04893500 -300.55036 1321 'point symmetry operation' ? ? 0.49493000 0.17188700 0.85176300 -55.81286 -0.11209100 -0.95942000 0.25874500 207.10699 0.86167300 -0.22353500 -0.45557900 34.09250 1322 'point symmetry operation' ? ? 0.35747400 0.19238100 0.91389400 -70.68808 -0.14465700 -0.95533800 0.25768900 280.51664 0.92265200 -0.22431800 -0.31367900 -37.84053 1323 'point symmetry operation' ? ? 0.41864300 0.15993500 0.89395700 -320.01446 -0.06626500 -0.97636700 0.20571100 -99.85282 0.90573000 -0.14535700 -0.39815100 -217.58686 1324 'point symmetry operation' ? ? 0.11580000 0.87885900 0.46281500 125.68017 0.61462600 -0.42943100 0.66168200 -193.48843 0.78027200 0.20783500 -0.58989800 39.02444 1325 'point symmetry operation' ? ? 0.38327300 0.14709500 0.91184700 -227.40810 -0.05595100 -0.98172700 0.18188500 -49.87406 0.92193900 -0.12073100 -0.36803900 -157.70005 1326 'point symmetry operation' ? ? 0.39808300 0.16792600 0.90184900 -273.41958 -0.03649800 -0.97942500 0.19848200 -74.75671 0.91662300 -0.11192800 -0.38376400 -188.11577 1327 'point symmetry operation' ? ? 0.38392300 0.12594900 0.91473500 -210.19244 -0.09236800 -0.98044600 0.17376500 21.46066 0.91873400 -0.15120400 -0.36478300 -141.49570 1328 'point symmetry operation' ? ? 0.24999700 0.13734100 0.95845700 -211.48921 -0.07233900 -0.98447300 0.15993800 -77.01036 0.96554100 -0.10931700 -0.23618100 -207.74150 1329 'point symmetry operation' ? ? 0.15535000 0.15384000 0.97580700 -193.62548 -0.07571400 -0.98304000 0.16703400 122.87431 0.98495400 -0.09983100 -0.14106700 -242.73172 1330 'point symmetry operation' ? ? 0.32425800 0.14423500 0.93490800 -206.37426 -0.05295400 -0.98399000 0.17017400 -25.69249 0.94448500 -0.10468800 -0.31142900 -164.95500 1331 'point symmetry operation' ? ? 0.33707900 0.12800300 0.93273400 -221.58309 -0.04941200 -0.98694400 0.15330000 -76.15738 0.94017900 -0.09776300 -0.32635300 -169.39723 1332 'point symmetry operation' ? ? -0.12481300 0.61596400 0.77782400 -22.61395 0.68947700 -0.50989300 0.51442400 23.57940 0.71347300 0.60049800 -0.36105200 -37.13434 1333 'point symmetry operation' ? ? 0.43942400 0.15405100 0.88497200 -286.63447 -0.10015200 -0.97064000 0.21869300 -49.81731 0.89267900 -0.18473000 -0.41109400 -186.27708 1334 'point symmetry operation' ? ? 0.28290700 0.12910100 0.95041900 -215.26101 -0.06219400 -0.98634500 0.15249400 -136.26655 0.95712900 -0.10225200 -0.27101500 -193.24479 1335 'point symmetry operation' ? ? 0.63819700 0.26286500 0.72360600 0.00000 -0.26286500 -0.80901700 0.52573100 0.00000 0.72360600 -0.52573100 -0.44721400 0.00000 1336 'point symmetry operation' ? ? 0.45701300 -0.59916300 0.65737500 -125.48297 -0.88437400 -0.38501300 0.26390700 164.58008 0.09497400 -0.70197500 -0.70584000 105.03942 1337 'point symmetry operation' ? ? 0.31792700 -0.61186500 0.72425300 -247.79108 -0.89590700 -0.44386400 0.01829300 236.55449 0.31027700 -0.65468000 -0.68929000 5.82846 1338 'point symmetry operation' ? ? 0.36577200 -0.59753500 0.71355500 -78.72270 -0.91267300 -0.38047000 0.14923300 247.20574 0.18231400 -0.70582800 -0.68452000 119.57571 1339 'point symmetry operation' ? ? 0.40156700 -0.61429600 0.67925200 -99.63276 -0.90059500 -0.39958900 0.17104700 213.43652 0.16634800 -0.68041800 -0.71369400 113.63926 1340 'point symmetry operation' ? ? 0.45912700 -0.60523800 0.65029900 -110.26032 -0.88752700 -0.28061300 0.36544700 109.04391 -0.03870000 -0.74494500 -0.66600200 88.14151 1341 'point symmetry operation' ? ? 0.70740400 0.33544700 0.62213700 0.53236 -0.35734000 -0.58969500 0.72427000 -148.07054 0.60982500 -0.73466600 -0.29728300 -144.05521 1342 'point symmetry operation' ? ? 0.46053700 -0.62309100 0.63218900 -222.50369 -0.88536400 -0.37342200 0.27692200 178.82487 0.06352500 -0.68725100 -0.72363700 101.23179 1343 'point symmetry operation' ? ? 0.67732400 0.37013400 0.63579200 43.99461 -0.41332500 -0.52347600 0.74507400 -173.71809 0.60859900 -0.76744600 -0.20157700 -207.16132 1344 'point symmetry operation' ? ? 0.33888700 -0.61642000 0.71076100 -294.80050 -0.89770000 -0.43796300 0.04818700 191.17315 0.28158300 -0.65438100 -0.70178100 -19.63495 1345 'point symmetry operation' ? ? 0.46661900 -0.60427100 0.64585000 -229.71679 -0.88421800 -0.30171200 0.35655000 147.59775 -0.02059300 -0.73744600 -0.67509200 86.63014 1346 'point symmetry operation' ? ? 0.29613100 -0.60953000 0.73537600 -198.65141 -0.89414900 -0.44763400 -0.01096200 281.11913 0.33586100 -0.65429100 -0.67756900 32.24902 1347 'point symmetry operation' ? ? 0.70450700 0.37146600 0.60471700 -165.46636 -0.42009600 -0.46848400 0.77720100 -109.95359 0.57200400 -0.80158300 -0.17399900 -212.16707 1348 'point symmetry operation' ? ? 0.46369600 -0.60902200 0.64348800 -167.78702 -0.88584500 -0.33201500 0.32410500 141.61544 0.01626100 -0.72031700 -0.69345300 93.23381 1349 'point symmetry operation' ? ? 0.46309300 -0.56425000 0.68349500 -327.77720 -0.87620900 -0.17536500 0.44889300 134.47752 -0.13342700 -0.80676400 -0.57561100 40.69404 1350 'point symmetry operation' ? ? 0.46425700 -0.58774500 0.66258600 -183.24030 -0.88256900 -0.24413800 0.40183100 109.95432 -0.07441200 -0.77133100 -0.63206900 66.79543 1351 'point symmetry operation' ? ? 0.48792200 -0.60763600 0.62666600 -285.47294 -0.86542300 -0.43043100 0.25646000 132.07822 0.11390200 -0.66746400 -0.73587900 47.21745 1352 'point symmetry operation' ? ? 0.49082500 -0.61810200 0.61403500 -329.94487 -0.86644600 -0.42025300 0.26955200 160.00476 0.09143900 -0.66433200 -0.74182300 64.25053 1353 'point symmetry operation' ? ? 0.46841400 -0.59472600 0.65336700 -297.77671 -0.88198700 -0.27138000 0.38529400 156.22043 -0.05183400 -0.75673900 -0.65165900 76.43914 1354 'point symmetry operation' ? ? 0.38998500 -0.57315800 0.72069500 55.59079 -0.91830500 -0.18426200 0.35037700 111.61287 -0.06802500 -0.79845900 -0.59819300 104.65781 1355 'point symmetry operation' ? ? 0.68036300 0.38079700 0.62617800 -6.63657 -0.43744600 -0.47450600 0.76386100 -162.72713 0.58800200 -0.79362200 -0.15625800 -236.09254 1356 'point symmetry operation' ? ? 0.43317200 -0.60461100 0.66843500 -75.17704 -0.90007700 -0.32897200 0.28572500 150.74544 0.04714400 -0.72541200 -0.68669800 108.32755 1357 'point symmetry operation' ? ? 0.46451900 -0.57436500 0.67403700 -256.53235 -0.87935700 -0.20921900 0.42773600 120.20178 -0.10465600 -0.79141100 -0.60225800 51.66759 1358 'point symmetry operation' ? ? 0.37612600 -0.61052900 0.69698100 -197.82825 -0.89243600 -0.44099000 0.09531300 220.33449 0.24917000 -0.65786100 -0.71072700 53.51044 1359 'point symmetry operation' ? ? 0.41539200 -0.61760400 0.66784300 112.32489 -0.90595100 -0.34696400 0.24263000 180.58493 0.08186800 -0.70581900 -0.70364500 187.70835 1360 'point symmetry operation' ? ? 0.33635700 -0.61910400 0.70962900 -153.71743 -0.90402900 -0.42335800 0.05915000 269.47026 0.26380600 -0.66142100 -0.70208800 80.52495 1361 'point symmetry operation' ? ? 0.70337700 0.30529200 0.64191600 39.23273 -0.34061700 -0.64787000 0.68135400 -138.65455 0.62389100 -0.69789700 -0.35170900 -104.49372 1362 'point symmetry operation' ? ? 0.41768100 -0.62002600 0.66416100 -145.91794 -0.89255400 -0.41673800 0.17226900 201.80749 0.16996900 -0.66475300 -0.72747000 96.51494 1363 'point symmetry operation' ? ? 0.71222500 0.36313000 0.60072600 -98.14188 -0.39498300 -0.50013500 0.77061900 -132.77876 0.58027900 -0.78613000 -0.21277800 -193.53064 1364 'point symmetry operation' ? ? 0.28614700 -0.59630000 0.75003100 -75.67932 -0.91162800 -0.41045400 0.02147300 333.78564 0.29504900 -0.68989400 -0.66105400 111.88253 1365 'point symmetry operation' ? ? 0.26270900 -0.61179500 0.74611600 -292.80801 -0.88960600 -0.45300300 -0.05821800 252.61198 0.37361000 -0.64845500 -0.66326500 -42.70728 1366 'point symmetry operation' ? ? 0.26588300 -0.60601000 0.74970500 -154.83686 -0.89261100 -0.44847900 -0.04595400 331.46842 0.36407500 -0.65697700 -0.66017400 54.13410 1367 'point symmetry operation' ? ? 0.49303000 -0.60674300 0.62352600 114.51173 -0.86943400 -0.31748500 0.37853300 83.62016 -0.03171200 -0.72874300 -0.68405200 164.51566 1368 'point symmetry operation' ? ? 0.39526400 -0.59040200 0.70369800 135.17118 -0.91525800 -0.31810700 0.24720500 183.93148 0.07790100 -0.74177700 -0.66610600 181.70375 1369 'point symmetry operation' ? ? 0.48556900 -0.60481500 0.63120600 -343.52928 -0.87160500 -0.39051800 0.29631000 187.15347 0.06728500 -0.69404100 -0.71678300 81.76118 1370 'point symmetry operation' ? ? 0.71632300 0.35146900 0.60278500 -38.06217 -0.37523800 -0.53429000 0.75744900 -150.35846 0.58828200 -0.76876700 -0.25084000 -175.21355 1371 'point symmetry operation' ? ? 0.47341900 -0.61031100 0.63513300 -230.45989 -0.87449000 -0.41206100 0.25587600 146.15529 0.10554900 -0.67655500 -0.72878800 67.80814 1372 'point symmetry operation' ? ? 0.49527300 -0.59231900 0.63550100 -286.85600 -0.86264700 -0.42178200 0.27917500 167.06213 0.10268200 -0.68648200 -0.71986000 74.41847 1373 'point symmetry operation' ? ? 0.44790800 -0.63203700 0.63238200 -165.34061 -0.89007700 -0.38206300 0.24857700 165.24159 0.08450000 -0.67420900 -0.73369000 100.10042 1374 'point symmetry operation' ? ? 0.38478900 -0.61558900 0.68774000 -252.28726 -0.89812100 -0.42155800 0.12516500 172.56871 0.21287200 -0.66583700 -0.71508500 19.64354 1375 'point symmetry operation' ? ? 0.32434100 -0.60091300 0.73055200 -112.41618 -0.90094600 -0.43159200 0.04498600 299.37341 0.28826700 -0.67277900 -0.68137300 96.15463 1376 'point symmetry operation' ? ? 0.44212500 -0.60935200 0.65819000 -201.71366 -0.88258300 -0.42637500 0.19811900 161.00034 0.15991100 -0.66850100 -0.72631500 62.05639 1377 'point symmetry operation' ? ? 0.45197300 -0.62036000 0.64099400 -247.87332 -0.87923100 -0.43110600 0.20273000 142.01749 0.15057000 -0.65521100 -0.74028800 44.54404 1378 'point symmetry operation' ? ? 0.58796400 0.22827100 0.77600900 -9.20643 -0.24190000 -0.86583000 0.43797500 47.05191 0.77186900 -0.44523100 -0.45385800 12.15305 1379 'point symmetry operation' ? ? 0.47258100 -0.61570400 0.63053500 -278.04954 -0.88082300 -0.35320700 0.31527100 180.11465 0.02859500 -0.70438100 -0.70924500 97.91454 1380 'point symmetry operation' ? ? 0.41152200 -0.62045200 0.66759800 -291.59024 -0.89124000 -0.42716600 0.15238100 131.22173 0.19063000 -0.65769900 -0.72876000 -2.29682 1381 'point symmetry operation' ? ? 0.05278600 0.68819100 -0.72360700 0.00000 -0.68819100 -0.50000000 -0.52573100 0.00000 -0.72360700 0.52573100 0.44721400 0.00000 1382 'point symmetry operation' ? ? 0.69986500 0.55132000 -0.45413100 -117.74854 -0.70793200 0.45086200 -0.54365000 170.19958 -0.09497500 0.70197600 0.70584000 -105.03938 1383 'point symmetry operation' ? ? 0.75381400 0.61121600 -0.24120400 -148.40503 -0.57921700 0.44475700 -0.68315400 308.76281 -0.31027800 0.65468100 0.68929100 -5.82825 1384 'point symmetry operation' ? ? 0.75497400 0.54649700 -0.36243100 -210.77996 -0.62990100 0.45071800 -0.63251700 151.26064 -0.18231500 0.70582900 0.68452000 -119.57568 1385 'point symmetry operation' ? ? 0.73242600 0.56985900 -0.37257600 -172.20195 -0.66021200 0.46075100 -0.59315100 160.71203 -0.16634800 0.68041900 0.71369400 -113.63923 1386 'point symmetry operation' ? ? 0.70221100 0.45390800 -0.54851500 -69.63457 -0.71091700 0.48890100 -0.50554300 138.56033 0.03870000 0.74494600 0.66600200 -88.14148 1387 'point symmetry operation' ? ? 0.12125100 0.45717400 -0.88107300 140.65891 -0.78320500 -0.50125500 -0.36787600 -46.26272 -0.60982600 0.73466700 0.29728300 144.05527 1388 'point symmetry operation' ? ? 0.69971800 0.54769100 -0.45872700 -101.31507 -0.71158900 0.47720000 -0.51567500 266.87370 -0.06352600 0.68725200 0.72363700 -101.23167 1389 'point symmetry operation' ? ? 0.18379100 0.38347700 -0.90507800 151.62056 -0.77189800 -0.51378200 -0.37443400 -95.52337 -0.60860000 0.76744600 0.20157700 207.16140 1390 'point symmetry operation' ? ? 0.74904200 0.60701200 -0.26546700 -90.71808 -0.59970500 0.45091200 -0.66108400 339.44783 -0.28158400 0.65438100 0.70178100 19.63520 1391 'point symmetry operation' ? ? 0.69674800 0.47367500 -0.53867900 -69.38734 -0.71702000 0.48146200 -0.50406000 264.08404 0.02059200 0.73744700 0.67509200 -86.63001 1392 'point symmetry operation' ? ? 0.75887700 0.61408000 -0.21681900 -205.97352 -0.55794500 0.44137100 -0.70277300 275.79944 -0.33586100 0.65429100 0.67756900 -32.24885 1393 'point symmetry operation' ? ? 0.18183100 0.33076500 -0.92603000 155.70396 -0.79984300 -0.49805500 -0.33495200 123.39026 -0.57200500 0.80158300 0.17399900 212.16730 1394 'point symmetry operation' ? ? 0.69919900 0.50396300 -0.50709200 -82.83519 -0.71474200 0.47661600 -0.51184100 203.33667 -0.01626100 0.72031800 0.69345300 -93.23373 1395 'point symmetry operation' ? ? 0.69022000 0.34114500 -0.63813500 -26.60692 -0.71119100 0.48244300 -0.51132800 353.29067 0.13342700 0.80676500 0.57561100 -40.69383 1396 'point symmetry operation' ? ? 0.69591000 0.41381300 -0.58691500 -47.94835 -0.71426400 0.48353600 -0.50598500 208.24978 0.07441200 0.77133200 0.63206900 -66.79533 1397 'point symmetry operation' ? ? 0.67229000 0.59713400 -0.43755900 -37.39779 -0.73147200 0.44488500 -0.51674500 312.31549 -0.11390200 0.66746400 0.73587900 -47.21727 1398 'point symmetry operation' ? ? 0.67236600 0.59068800 -0.44610700 -50.21491 -0.73454900 0.45798500 -0.50068700 363.24062 -0.09144000 0.66433300 0.74182300 -64.25033 1399 'point symmetry operation' ? ? 0.69407200 0.44187800 -0.56833800 -56.55631 -0.71803800 0.48175600 -0.50232700 331.47745 0.05183300 0.75674000 0.65165900 -76.43897 1400 'point symmetry operation' ? ? 0.75284800 0.35235800 -0.55593500 -123.32864 -0.65467000 0.48816500 -0.57715000 -18.37966 0.06802500 0.79846000 0.59819300 -104.65789 1401 'point symmetry operation' ? ? 0.20579200 0.33360900 -0.91997500 156.81343 -0.78224200 -0.50879100 -0.35948500 -43.97386 -0.58800300 0.79362300 0.15625800 236.09267 1402 'point symmetry operation' ? ? 0.72216700 0.49970600 -0.47829900 -120.13642 -0.69011100 0.47336100 -0.54742700 118.08063 -0.04714400 0.72541200 0.68669800 -108.32754 1403 'point symmetry operation' ? ? 0.69277400 0.37646700 -0.61509100 -35.04577 -0.71352000 0.48160100 -0.50887000 281.12132 0.10465500 0.79141200 0.60225800 -51.66744 1404 'point symmetry operation' ? ? 0.73252800 0.60807100 -0.30602800 -148.41823 -0.63349500 0.44437400 -0.63341500 256.23309 -0.24917100 0.65786200 0.71072700 -53.51030 1405 'point symmetry operation' ? ? 0.73324700 0.52083300 -0.43713000 -206.45676 -0.67501600 0.48015800 -0.56018000 -51.02342 -0.08186900 0.70582000 0.70364500 -187.70851 1406 'point symmetry operation' ? ? 0.75584300 0.59395100 -0.27554300 -208.78013 -0.59925500 0.45797800 -0.65662000 229.46500 -0.26380700 0.66142200 0.70208800 -80.52484 1407 'point symmetry operation' ? ? 0.10659100 0.52182000 -0.84637000 119.74470 -0.77420800 -0.49055400 -0.39994900 -80.15926 -0.62389200 0.69789700 0.35170900 104.49374 1408 'point symmetry operation' ? ? 0.71979900 0.58794000 -0.36907500 -146.83917 -0.67305300 0.46090100 -0.57842100 201.13830 -0.16997000 0.66475400 0.72747000 -96.51487 1409 'point symmetry operation' ? ? 0.15556100 0.36344200 -0.91853700 156.60757 -0.79942200 -0.49990800 -0.33319000 52.30749 -0.58028000 0.78613100 0.21277800 193.53080 1410 'point symmetry operation' ? ? 0.77858600 0.57463200 -0.25219500 -294.06281 -0.55385000 0.44027700 -0.70668700 175.12088 -0.29504900 0.68989500 0.66105400 -111.88247 1411 'point symmetry operation' ? ? 0.76488400 0.61988600 -0.17519400 -149.76562 -0.52475400 0.44186600 -0.72759000 356.53848 -0.37361100 0.64845600 0.66326500 42.70756 1412 'point symmetry operation' ? ? 0.76676200 0.61379600 -0.18796700 -267.39799 -0.52870200 0.43776200 -0.72721300 249.68811 -0.36407600 0.65697700 0.66017400 -54.13395 1413 'point symmetry operation' ? ? 0.67452600 0.48944000 -0.55268700 -114.91353 -0.73756900 0.47893800 -0.47603600 -83.06701 0.03171200 0.72874400 0.68405200 -164.51583 1414 'point symmetry operation' ? ? 0.74831900 0.48498200 -0.45256100 -216.69942 -0.65874900 0.46320500 -0.59286700 -71.71741 -0.07790200 0.74177800 0.66610600 -181.70392 1415 'point symmetry operation' ? ? 0.67889700 0.55830300 -0.47686200 -71.83705 -0.73114400 0.45453600 -0.50874800 384.54959 -0.06728500 0.69404200 0.71678300 -81.76097 1416 'point symmetry operation' ? ? 0.13551700 0.39953000 -0.90664800 154.76121 -0.79721900 -0.49937300 -0.33921800 -10.26415 -0.58828300 0.76876700 0.25084000 175.21366 1417 'point symmetry operation' ? ? 0.68539500 0.58048900 -0.43962000 -67.78585 -0.72048100 0.45310600 -0.52497800 264.34501 -0.10555000 0.67655600 0.72878800 -67.80801 1418 'point symmetry operation' ? ? 0.66737900 0.58417600 -0.46189300 -70.24207 -0.73760500 0.43299100 -0.51812800 324.44150 -0.10268300 0.68648200 0.71986000 -74.41829 1419 'point symmetry operation' ? ? 0.70810200 0.55867300 -0.43182800 -106.06097 -0.70103500 0.48303800 -0.52461700 208.31088 -0.08450000 0.67420900 0.73369100 -100.10034 1420 'point symmetry operation' ? ? 0.73525800 0.59115300 -0.33156300 -86.16151 -0.64349100 0.45519100 -0.61540200 293.26625 -0.21287300 0.66583700 0.71508500 -19.64335 1421 'point symmetry operation' ? ? 0.75662400 0.59616100 -0.26853800 -249.98252 -0.58687400 0.43813300 -0.68089500 199.42575 -0.28826800 0.67278000 0.68137300 -96.15455 1422 'point symmetry operation' ? ? 0.70276200 0.59380700 -0.39181500 -90.78743 -0.69322000 0.44777100 -0.56475400 241.59308 -0.15991200 0.66850200 0.72631500 -62.05626 1423 'point symmetry operation' ? ? 0.69653200 0.60170700 -0.39088600 -58.46954 -0.70155000 0.45677800 -0.54697500 279.62751 -0.15057100 0.65521200 0.74028800 -44.54388 1424 'point symmetry operation' ? ? 0.04837000 0.75291400 -0.65634000 -41.90408 -0.63393800 -0.48465500 -0.60268700 23.29569 -0.77187000 0.44523100 0.45385800 -12.15304 1425 'point symmetry operation' ? ? 0.69167700 0.52618300 -0.49468800 -85.37710 -0.72164100 0.47642200 -0.50225100 320.09952 -0.02859600 0.70438200 0.70924500 -97.91439 1426 'point symmetry operation' ? ? 0.72045300 0.59798900 -0.35122300 -34.69289 -0.66678900 0.45808400 -0.58783600 317.86868 -0.19063100 0.65770000 0.72876000 2.29705 1427 'point symmetry operation' ? ? 0.67082000 0.16246000 -0.72360700 0.00000 -0.68819100 0.50000000 -0.52573100 0.00000 0.27639300 0.85065100 0.44721400 0.00000 1428 'point symmetry operation' ? ? 0.65321900 -0.21136400 -0.72706900 -30.63152 0.07774400 0.97389500 -0.21327200 -51.15618 0.75316700 0.08278800 0.65259900 -224.30041 1429 'point symmetry operation' ? ? 0.82429200 -0.13597000 -0.54959500 -145.49728 0.06603700 0.98719700 -0.14519000 49.18623 0.56230000 0.08338600 0.82271900 -306.27402 1430 'point symmetry operation' ? ? 0.74070900 -0.21736500 -0.63569000 -79.44350 0.10876700 0.97252900 -0.20580700 -132.29122 0.66296200 0.08330100 0.74400400 -240.40406 1431 'point symmetry operation' ? ? 0.71895500 -0.18493600 -0.67000200 -59.39572 0.08648800 0.98026400 -0.17776800 -97.89551 0.68965500 0.06986000 0.72076100 -235.12634 1432 'point symmetry operation' ? ? 0.55854900 -0.31398400 -0.76774800 -5.44302 0.14814200 0.94846600 -0.28011600 -24.98045 0.81613500 0.04272300 0.57628000 -176.53111 1433 'point symmetry operation' ? ? 0.64985100 -0.14349400 -0.74639300 -2.36665 -0.62876300 0.45023200 -0.63399400 149.40315 0.42702400 0.88130600 0.20236100 142.65411 1434 'point symmetry operation' ? ? 0.63095700 -0.20742300 -0.74757500 -38.06855 0.09234700 0.97682500 -0.19309000 10.49205 0.77030200 0.05279500 0.63549100 -300.29140 1435 'point symmetry operation' ? ? 0.68908100 -0.21461600 -0.69217600 -32.67448 -0.57942500 0.41048400 -0.70410900 165.49339 0.43524000 0.88625200 0.15850300 215.80940 1436 'point symmetry operation' ? ? 0.80365700 -0.13957400 -0.57849400 -130.21031 0.06759400 0.98722500 -0.14428600 117.61529 0.59124200 0.07685400 0.80282500 -305.04439 1437 'point symmetry operation' ? ? 0.56897900 -0.29408900 -0.76796800 -26.76344 0.13181200 0.95440800 -0.26782700 38.74614 0.81172000 0.05116100 0.58180300 -282.56370 1438 'point symmetry operation' ? ? 0.84274500 -0.13321700 -0.52156800 -159.64206 0.06670800 0.98727100 -0.14438000 -20.80369 0.53416300 0.08688300 0.84090500 -305.96089 1439 'point symmetry operation' ? ? 0.66582400 -0.27723300 -0.69269000 -69.12222 -0.57550700 0.40001900 -0.71328500 280.39206 0.47483500 0.87357100 0.10679300 32.95760 1440 'point symmetry operation' ? ? 0.59692000 -0.26058900 -0.75880100 -21.13703 0.11526300 0.96382500 -0.24032600 -4.35400 0.79397800 0.05599400 0.60536300 -237.55905 1441 'point symmetry operation' ? ? 0.48200500 -0.43331100 -0.76152000 -45.79768 0.18955500 0.90013500 -0.39220600 136.94060 0.85541800 0.04469600 0.51600700 -326.07991 1442 'point symmetry operation' ? ? 0.52902500 -0.35910200 -0.76888100 -17.66341 0.16090800 0.93206300 -0.32460400 36.01085 0.83321200 0.04800500 0.55086700 -220.27229 1443 'point symmetry operation' ? ? 0.65224100 -0.15468800 -0.74206000 -41.65919 0.03704600 0.98429100 -0.17262200 105.59727 0.75710500 0.08510100 0.64772700 -297.12422 1444 'point symmetry operation' ? ? 0.63653800 -0.15887400 -0.75470400 -46.20523 0.04736900 0.98475900 -0.16735100 113.28439 0.76978900 0.07077600 0.63436200 -351.60372 1445 'point symmetry operation' ? ? 0.54474300 -0.32942700 -0.77118900 -36.47915 0.14588500 0.94281600 -0.29969200 86.63077 0.82581600 0.05075000 0.56165100 -331.78800 1446 'point symmetry operation' ? ? 0.56216000 -0.42070900 -0.71202500 -4.01427 0.22653100 0.90634800 -0.35667600 -149.08537 0.79539900 0.03921400 0.60481600 -65.25697 1447 'point symmetry operation' ? ? 0.69061500 -0.26782100 -0.67180600 -58.50058 -0.55862700 0.39242300 -0.73071100 210.05188 0.45933200 0.87993000 0.12140200 186.33249 1448 'point symmetry operation' ? ? 0.63067300 -0.26660300 -0.72881700 -21.38679 0.12714800 0.96194500 -0.24185600 -80.58765 0.76556200 0.05986400 0.64057200 -182.09588 1449 'point symmetry operation' ? ? 0.50491600 -0.39837000 -0.76574200 -31.79344 0.17502200 0.91595200 -0.36110900 89.27924 0.84523800 0.04830900 0.53220300 -271.92896 1450 'point symmetry operation' ? ? 0.77461400 -0.14032000 -0.61667100 -102.46914 0.05637500 0.98651400 -0.15366200 -2.15563 0.62991700 0.08426400 0.77207800 -282.91728 1451 'point symmetry operation' ? ? 0.66078100 -0.23935700 -0.71139100 5.62098 0.12406500 0.96958300 -0.21099100 -266.27754 0.74025400 0.05116000 0.67037800 -97.60595 1452 'point symmetry operation' ? ? 0.79528200 -0.15457800 -0.58620100 -119.06448 0.08184500 0.98547000 -0.14882700 -71.28256 0.60068900 0.07038200 0.79637900 -288.91187 1453 'point symmetry operation' ? ? 0.64873300 -0.07526000 -0.75728500 17.73749 -0.64174800 0.48074200 -0.59753400 97.26320 0.40902900 0.87362700 0.26357500 148.01522 1454 'point symmetry operation' ? ? 0.71519100 -0.16149600 -0.68001500 -61.34079 0.06947500 0.98454700 -0.16075100 -51.22514 0.69546700 0.06772400 0.71535900 -254.84663 1455 'point symmetry operation' ? ? 0.65412200 -0.24383000 -0.71601100 -43.48248 -0.59772600 0.41345700 -0.68686000 235.67477 0.46351600 0.87726900 0.12470800 85.33949 1456 'point symmetry operation' ? ? 0.82576900 -0.18526500 -0.53271200 -144.75451 0.10377400 0.97829400 -0.17936500 -173.63106 0.55437900 0.09283300 0.82707100 -280.27910 1457 'point symmetry operation' ? ? 0.86869900 -0.12518000 -0.47926200 -189.29245 0.06759100 0.98844700 -0.13566300 97.65448 0.49070700 0.08545700 0.86712400 -325.58461 1458 'point symmetry operation' ? ? 0.86370000 -0.13476500 -0.48565500 -180.76859 0.07192200 0.98668300 -0.14588900 -87.63679 0.49884900 0.09107500 0.86189100 -310.51388 1459 'point symmetry operation' ? ? 0.54936400 -0.27680600 -0.78840200 55.45344 0.11209100 0.95942000 -0.25874500 -207.10699 0.82803000 0.05377300 0.55809900 -34.67403 1460 'point symmetry operation' ? ? 0.66537800 -0.28667100 -0.68926900 -2.23303 0.14465700 0.95533800 -0.25768900 -280.51664 0.73235700 0.07175300 0.67713000 -80.14825 1461 'point symmetry operation' ? ? 0.62288700 -0.20153600 -0.75590600 -51.50083 0.06626500 0.97636700 -0.20571100 99.85282 0.77950000 0.07804500 0.62152200 -383.53744 1462 'point symmetry operation' ? ? 0.64610900 -0.20714400 -0.73459800 -21.30127 -0.61462600 0.42943100 -0.66168200 193.48843 0.45252300 0.87902300 0.15014400 129.86413 1463 'point symmetry operation' ? ? 0.65320300 -0.17376700 -0.73697400 -39.35125 0.05595100 0.98172700 -0.18188500 49.87406 0.75511300 0.07757300 0.65098900 -273.92560 1464 'point symmetry operation' ? ? 0.64182400 -0.17521000 -0.74656700 -45.97895 0.03649800 0.97942500 -0.19848200 74.75671 0.76598200 0.10014200 0.63501400 -328.68184 1465 'point symmetry operation' ? ? 0.65004400 -0.19156700 -0.73535300 -32.55674 0.09236800 0.98044600 -0.17376500 -21.46066 0.75426100 0.04503200 0.65502900 -251.28066 1466 'point symmetry operation' ? ? 0.75180400 -0.15919700 -0.63988100 -91.22881 0.07233900 0.98447300 -0.15993800 77.01036 0.65540700 0.07395400 0.75164700 -282.06648 1467 'point symmetry operation' ? ? 0.81149500 -0.15809000 -0.56256900 -130.51395 0.07571400 0.98304000 -0.16703400 -122.87431 0.57943300 0.09295300 0.80970200 -281.73682 1468 'point symmetry operation' ? ? 0.69976100 -0.15813900 -0.69665400 -55.24690 0.05295400 0.98399000 -0.17017400 25.69249 0.71241200 0.08219000 0.69693200 -258.35686 1469 'point symmetry operation' ? ? 0.69017500 -0.14468600 -0.70903000 -52.41854 0.04941200 0.98694400 -0.15330000 76.15738 0.72195300 0.07076900 0.68831400 -273.94667 1470 'point symmetry operation' ? ? 0.69396700 0.26163500 -0.67078800 -23.10070 -0.68947700 0.50989300 -0.51442400 -23.57940 0.20743800 0.81948600 0.53424000 -36.83351 1471 'point symmetry operation' ? ? 0.60192000 -0.23412100 -0.76346500 -38.42451 0.10015200 0.97064000 -0.21869300 49.81731 0.79225100 0.05517400 0.60769700 -339.67932 1472 'point symmetry operation' ? ? 0.72956200 -0.14919300 -0.66744300 -76.57574 0.06219400 0.98634500 -0.15249400 136.26655 0.68108000 0.06974300 0.72888000 -278.95695 1473 'point symmetry operation' ? ? 0.36180300 -0.58778500 -0.72360700 0.00000 0.26286500 0.80901700 -0.52573100 0.00000 0.89442700 0.00000000 0.44721400 0.00000 1474 'point symmetry operation' ? ? -0.11943500 -0.35991200 -0.92531000 150.06781 0.88437400 0.38501300 -0.26390700 -164.58008 0.45123900 -0.84984000 0.27231400 -65.26048 1475 'point symmetry operation' ? ? 0.13533900 -0.31193000 -0.94041600 116.02861 0.89590700 0.44386400 -0.01829300 -236.55449 0.42312200 -0.84005100 0.33953300 -219.02466 1476 'point symmetry operation' ? ? -0.00051100 -0.36408700 -0.93136500 142.15764 0.91267300 0.38047000 -0.14923300 -247.20574 0.40869000 -0.85010800 0.33209800 -16.93593 1477 'point symmetry operation' ? ? -0.03080000 -0.33386300 -0.94211800 146.19918 0.90059500 0.39958900 -0.17104700 -213.43652 0.43356500 -0.85373600 0.28836900 -38.29335 1478 'point symmetry operation' ? ? -0.23994200 -0.39562900 -0.88651300 128.14609 0.88752700 0.28061300 -0.36544700 -109.04391 0.39334800 -0.87449100 0.28380100 -59.20189 1479 'point symmetry operation' ? ? 0.22908400 -0.80712200 -0.54412700 -129.08502 0.35734000 0.58969500 -0.72427000 148.07054 0.90544300 -0.02851900 0.42350800 -63.94721 1480 'point symmetry operation' ? ? -0.14913900 -0.33604200 -0.92996400 190.05113 0.88536400 0.37342200 -0.27692200 -178.82487 0.44032600 -0.86465700 0.24182800 -153.74136 1481 'point symmetry operation' ? ? 0.24144000 -0.85195400 -0.46463100 -204.96578 0.41332500 0.52347600 -0.74507400 173.71809 0.87799100 -0.01215300 0.47852300 -53.29521 1482 'point symmetry operation' ? ? 0.10030100 -0.30962500 -0.94555400 114.27668 0.89770000 0.43796300 -0.04818700 -191.17315 0.42903700 -0.84399100 0.32187900 -272.45879 1483 'point symmetry operation' ? ? -0.22709700 -0.38935400 -0.89265400 180.21681 0.88421800 0.30171200 -0.35655000 -147.59775 0.40814800 -0.87027200 0.27575700 -166.72301 1484 'point symmetry operation' ? ? 0.16796900 -0.31262600 -0.93490700 117.68396 0.89414900 0.44763400 0.01096200 -281.11913 0.41506900 -0.83778800 0.35472400 -163.25713 1485 'point symmetry operation' ? ? 0.19655100 -0.88308200 -0.42606700 -115.76930 0.42009600 0.46848400 -0.77720100 109.95359 0.88593800 -0.02622900 0.46306200 -242.88160 1486 'point symmetry operation' ? ? -0.19282700 -0.37190900 -0.90802100 158.42749 0.88584500 0.33201500 -0.32410500 -141.61544 0.42201400 -0.86686200 0.26543300 -108.37804 1487 'point symmetry operation' ? ? -0.32644200 -0.46925200 -0.82051100 182.98423 0.87620900 0.17536500 -0.44889300 -134.47752 0.35453300 -0.86547600 0.35391700 -274.97421 1488 'point symmetry operation' ? ? -0.27417800 -0.42705200 -0.86165700 141.69119 0.88256900 0.24413800 -0.40183100 -109.95432 0.38196600 -0.87064500 0.30996600 -134.02348 1489 'point symmetry operation' ? ? -0.11632800 -0.32525500 -0.93844400 169.89991 0.86542300 0.43043100 -0.25646000 -132.07822 0.48734900 -0.84198500 0.23141300 -234.21874 1490 'point symmetry operation' ? ? -0.13771800 -0.31777300 -0.93811200 205.02321 0.86644600 0.42025300 -0.26955200 -160.00476 0.47990000 -0.84994600 0.21745800 -266.37826 1491 'point symmetry operation' ? ? -0.25584200 -0.41087900 -0.87505600 201.53901 0.88198700 0.27138000 -0.38529400 -156.22043 0.39578200 -0.87036300 0.29296000 -232.15526 1492 'point symmetry operation' ? ? -0.23525000 -0.45784000 -0.85734500 68.74787 0.91830500 0.18426200 -0.35037700 -111.61287 0.31839200 -0.86973000 0.37709000 96.52631 1493 'point symmetry operation' ? ? 0.22165700 -0.88013500 -0.41979700 -208.19972 0.43744600 0.47450600 -0.76386100 162.72713 0.87149800 -0.01432200 0.49019100 -111.51957 1494 'point symmetry operation' ? ? -0.15155400 -0.37843800 -0.91313500 130.51132 0.90007700 0.32897200 -0.28572500 -150.74544 0.40852400 -0.86519500 0.29076700 -18.79495 1495 'point symmetry operation' ? ? -0.30134600 -0.45099600 -0.84011500 160.93762 0.87935700 0.20921900 -0.42773600 -120.20178 0.36867500 -0.86765800 0.33354100 -206.34330 1496 'point symmetry operation' ? ? 0.05465600 -0.31537200 -0.94739300 136.33264 0.89243600 0.44099000 -0.09531300 -220.33449 0.44784900 -0.84027900 0.30555300 -153.01252 1497 'point symmetry operation' ? ? -0.11254400 -0.35510300 -0.92802800 117.65832 0.90595100 0.34696400 -0.24263000 -180.58493 0.40815100 -0.86805400 0.28265800 184.41216 1498 'point symmetry operation' ? ? 0.08553200 -0.31472200 -0.94532200 140.76821 0.90402900 0.42335800 -0.05915000 -269.47026 0.41882500 -0.84954000 0.32073000 -101.47732 1499 'point symmetry operation' ? ? 0.24346500 -0.76074900 -0.60165200 -111.00746 0.34061700 0.64787000 -0.68135400 138.65455 0.90813200 -0.03904700 0.41685900 -11.64010 1500 'point symmetry operation' ? ? -0.03476700 -0.31728900 -0.94769100 151.58207 0.89255400 0.41673800 -0.17226900 -201.80749 0.44959800 -0.85185500 0.26871000 -87.35033 1501 'point symmetry operation' ? ? 0.20050100 -0.86553400 -0.45896700 -129.20877 0.39498300 0.50013500 -0.77061900 132.77876 0.89654200 -0.02677400 0.44214900 -174.33026 1502 'point symmetry operation' ? ? 0.13593100 -0.35038700 -0.92668800 133.91559 0.91162800 0.41045400 -0.02147300 -333.78564 0.38788700 -0.84187700 0.37521700 -17.65431 1503 'point symmetry operation' ? ? 0.21668100 -0.30639300 -0.92691500 92.74906 0.88960600 0.45300300 0.05821800 -252.61198 0.40205700 -0.83720500 0.37072700 -280.99486 1504 'point symmetry operation' ? ? 0.20673200 -0.31660200 -0.92575600 117.66411 0.89261100 0.44847900 0.04595400 -331.46842 0.40063200 -0.83584100 0.37531900 -114.28087 1505 'point symmetry operation' ? ? -0.24885400 -0.38046400 -0.89068400 95.93616 0.86943400 0.31748500 -0.37853300 -83.62016 0.42679700 -0.86859100 0.25178300 175.99602 1506 'point symmetry operation' ? ? -0.10709000 -0.39943000 -0.91048700 102.07047 0.91525800 0.31810700 -0.24720500 -183.93148 0.38837300 -0.85980400 0.33151600 202.16119 1507 'point symmetry operation' ? ? -0.15697200 -0.35028800 -0.92339500 226.76035 0.87160500 0.39051800 -0.29631000 -187.15347 0.46439600 -0.85134800 0.24401400 -270.69754 1508 'point symmetry operation' ? ? 0.20582600 -0.84478800 -0.49393100 -139.69391 0.37523800 0.53429000 -0.75744900 150.35846 0.90378700 -0.02943900 0.42696900 -112.40164 1509 'point symmetry operation' ? ? -0.11731300 -0.33219000 -0.93588800 163.71422 0.87449000 0.41206100 -0.25587600 -146.15529 0.47064200 -0.84844300 0.24215800 -175.80509 1510 'point symmetry operation' ? ? -0.12965100 -0.34911500 -0.92806700 194.84777 0.86264700 0.42178200 -0.27917500 -167.06213 0.48890600 -0.83679000 0.24648000 -223.29113 1511 'point symmetry operation' ? ? -0.12473200 -0.32037600 -0.93904300 163.47510 0.89007700 0.38206300 -0.24857700 -165.24159 0.43841100 -0.86682600 0.23750500 -103.11906 1512 'point symmetry operation' ? ? 0.01831600 -0.32024300 -0.94715800 130.39596 0.89812100 0.42155800 -0.12516500 -172.56871 0.43936500 -0.84837100 0.29533900 -216.86792 1513 'point symmetry operation' ? ? 0.11278500 -0.33301600 -0.93615200 136.27734 0.90094600 0.43159200 -0.04498600 -299.37341 0.41901600 -0.83834900 0.34870700 -57.54652 1514 'point symmetry operation' ? ? -0.05469500 -0.32541500 -0.94398800 145.71399 0.88258300 0.42637500 -0.19811900 -161.00034 0.46696300 -0.84398400 0.26388600 -152.66591 1515 'point symmetry operation' ? ? -0.06745400 -0.30860600 -0.94879500 150.69369 0.87923100 0.43110600 -0.20273000 -142.01749 0.47159400 -0.84788600 0.24225700 -201.78415 1516 'point symmetry operation' ? ? 0.42743600 -0.50031300 -0.75298500 14.98725 0.24190000 0.86583000 -0.43797500 -47.05191 0.87108100 0.00505900 0.49111300 -2.79948 1517 'point symmetry operation' ? ? -0.18576800 -0.35466700 -0.91635200 211.92494 0.88082300 0.35320700 -0.31527100 -180.11465 0.43547800 -0.86571100 0.24678500 -204.90664 1518 'point symmetry operation' ? ? -0.01353300 -0.31078900 -0.95038200 128.34871 0.89124000 0.42716600 -0.15238100 -131.22173 0.45332900 -0.84908100 0.27120800 -261.83363 1519 'point symmetry operation' ? ? -0.44721400 -0.52573200 -0.72360600 0.00000 0.85065100 0.00000000 -0.52573200 0.00000 0.27639400 -0.85065100 0.44721400 0.00000 1520 'point symmetry operation' ? ? -0.55031500 0.31096400 -0.77489000 174.62932 0.59722400 -0.50197000 -0.62558000 -13.32414 -0.58350500 -0.80704900 0.09052600 152.29254 1521 'point symmetry operation' ? ? -0.36093600 0.32650700 -0.87356700 274.75297 0.76354200 -0.43437600 -0.47783000 -153.57556 -0.53547100 -0.83947100 -0.09252000 135.34392 1522 'point symmetry operation' ? ? -0.44434800 0.30909500 -0.84084200 147.77854 0.67084600 -0.50725500 -0.54098000 -34.67501 -0.59373600 -0.80445900 0.01804100 242.00325 1523 'point symmetry operation' ? ? -0.48070400 0.32888900 -0.81286900 160.45786 0.65704100 -0.47880300 -0.58227700 -26.23729 -0.58070800 -0.81399100 0.01406900 204.84315 1524 'point symmetry operation' ? ? -0.58977600 0.32180300 -0.74068000 146.51727 0.48543400 -0.59170900 -0.64361200 2.54281 -0.64538300 -0.73913800 0.19276200 101.70111 1525 'point symmetry operation' ? ? -0.55956400 -0.61660000 -0.55379800 -64.37595 0.81234400 -0.27560100 -0.51394800 -48.41899 0.16427300 -0.73746200 0.65510700 -190.23270 1526 'point symmetry operation' ? ? -0.56250600 0.33958100 -0.75383800 267.79050 0.57153900 -0.49912700 -0.65131900 -39.44752 -0.59743700 -0.79721800 0.08667800 135.89110 1527 'point symmetry operation' ? ? -0.54050700 -0.64775800 -0.53690000 -127.15287 0.83440700 -0.33095900 -0.44071800 -82.21565 0.10778700 -0.68620500 0.71937900 -228.25902 1528 'point symmetry operation' ? ? -0.38901200 0.33186300 -0.85938200 304.87032 0.74343600 -0.43781200 -0.50559400 -160.18253 -0.54403500 -0.83557700 -0.07640500 72.35951 1529 'point symmetry operation' ? ? -0.59133100 0.31953200 -0.74042400 265.51384 0.50039900 -0.57462400 -0.64761800 -37.42671 -0.63240000 -0.75346400 0.17989900 100.80399 1530 'point symmetry operation' ? ? -0.33293400 0.32379000 -0.88561600 242.74971 0.78088500 -0.43178100 -0.45142600 -145.39997 -0.52855900 -0.84185900 -0.10908900 198.65044 1531 'point symmetry operation' ? ? -0.57747000 -0.64952000 -0.49462300 80.22714 0.81107900 -0.38727700 -0.43837100 -152.38514 0.09317400 -0.65432500 0.75045300 -234.15010 1532 'point symmetry operation' ? ? -0.57864000 0.32384300 -0.74853300 207.70643 0.53208700 -0.54567300 -0.64739900 -18.75700 -0.61811000 -0.77289500 0.14343500 115.78542 1533 'point symmetry operation' ? ? -0.61787600 0.28299100 -0.73358400 343.57003 0.39983900 -0.69026100 -0.60305100 -85.87312 -0.67702200 -0.66592600 0.31334400 41.99668 1534 'point symmetry operation' ? ? -0.60370100 0.30386600 -0.73702800 209.89289 0.45340900 -0.62955000 -0.63094200 -27.92682 -0.65571800 -0.71507600 0.24228300 72.75805 1535 'point symmetry operation' ? ? -0.57128300 0.32115000 -0.75531400 304.91209 0.60887100 -0.45128000 -0.65239800 -72.25156 -0.55037600 -0.83259200 0.06226900 54.56572 1536 'point symmetry operation' ? ? -0.58040700 0.33358300 -0.74286600 356.28134 0.59074600 -0.45540500 -0.66605300 -78.95054 -0.56048900 -0.82542700 0.06725700 73.64710 1537 'point symmetry operation' ? ? -0.60130300 0.31008600 -0.73639800 328.56526 0.47300000 -0.60465000 -0.64083600 -61.46406 -0.64397700 -0.73365300 0.21690700 84.76997 1538 'point symmetry operation' ? ? -0.53739000 0.29227800 -0.79106600 -5.59683 0.46464400 -0.68019500 -0.56695800 42.25215 -0.70378900 -0.67224200 0.22972400 157.11300 1539 'point symmetry operation' ? ? -0.55299700 -0.65713800 -0.51221500 -85.40513 0.82944000 -0.37597900 -0.41312300 -120.54708 0.07889700 -0.65330800 0.75297100 -245.84214 1540 'point symmetry operation' ? ? -0.54350400 0.31875200 -0.77653100 125.64007 0.56051500 -0.55081200 -0.61840900 4.56295 -0.62484200 -0.77136500 0.12070300 155.89886 1541 'point symmetry operation' ? ? -0.61178600 0.29131600 -0.73542700 276.79970 0.42611900 -0.66191700 -0.61667600 -57.82612 -0.66644000 -0.69065300 0.28081600 54.45219 1542 'point symmetry operation' ? ? -0.43238900 0.32482900 -0.84114600 237.97138 0.71928100 -0.43830200 -0.53900600 -96.78782 -0.54376100 -0.83808000 -0.04412700 156.67982 1543 'point symmetry operation' ? ? -0.51801900 0.33355100 -0.78765500 -25.17621 0.59010200 -0.52726000 -0.61137400 87.63021 -0.61922300 -0.78150000 0.07630100 268.60648 1544 'point symmetry operation' ? ? -0.39255700 0.33483200 -0.85661300 211.63831 0.73106700 -0.45154000 -0.51152100 -91.20954 -0.55806900 -0.82704300 -0.06753000 222.75045 1545 'point symmetry operation' ? ? -0.54914600 -0.58732500 -0.59454900 -88.56919 0.81529300 -0.22013400 -0.53557300 -13.18667 0.18367500 -0.77884000 0.59972800 -153.83398 1546 'point symmetry operation' ? ? -0.49366000 0.33586000 -0.80218300 197.67749 0.65871900 -0.45783400 -0.59705900 -42.50910 -0.56779500 -0.82315700 0.00477600 174.49971 1547 'point symmetry operation' ? ? -0.57841300 -0.64249600 -0.50263000 17.89927 0.80681500 -0.35966200 -0.46871600 -114.18189 0.12037100 -0.67664100 0.72640800 -226.62380 1548 'point symmetry operation' ? ? -0.33759600 0.30745800 -0.88966200 156.83533 0.75328600 -0.47850700 -0.45121300 -84.01480 -0.56443800 -0.82249700 -0.07006200 313.05322 1549 'point symmetry operation' ? ? -0.29010400 0.32667600 -0.89951200 306.58736 0.80529600 -0.42450100 -0.41388400 -210.20479 -0.51704900 -0.84444200 -0.13992200 114.85497 1550 'point symmetry operation' ? ? -0.29623500 0.31957700 -0.90006500 215.47667 0.79920300 -0.43307100 -0.41680400 -144.83994 -0.52299300 -0.84280500 -0.12711600 263.37750 1551 'point symmetry operation' ? ? -0.61701900 0.32171600 -0.71818300 -49.41093 0.48783900 -0.55973500 -0.66985900 116.73902 -0.61749700 -0.76367300 0.18842100 176.35561 1552 'point symmetry operation' ? ? -0.50156200 0.30253400 -0.81049900 -47.93248 0.58811100 -0.56785700 -0.57590400 84.56073 -0.63447800 -0.76551500 0.10689100 275.08247 1553 'point symmetry operation' ? ? -0.58294200 0.31761600 -0.74786300 378.39912 0.57192400 -0.49338700 -0.65534200 -79.83637 -0.57713300 -0.80974700 0.10596300 100.81754 1554 'point symmetry operation' ? ? -0.57687500 -0.63220000 -0.51724000 -36.80235 0.80441700 -0.32970800 -0.49417400 -80.05000 0.14187800 -0.70115400 0.69875300 -216.78066 1555 'point symmetry operation' ? ? -0.56132700 0.32415500 -0.76147000 260.78109 0.60394300 -0.46863300 -0.64469900 -52.83716 -0.56583200 -0.82177100 0.06728500 90.95412 1556 'point symmetry operation' ? ? -0.58089500 0.30279000 -0.75556500 319.42386 0.59913300 -0.46929400 -0.64869400 -66.82963 -0.55100100 -0.82950700 0.09119800 96.10722 1557 'point symmetry operation' ? ? -0.54551300 0.35025600 -0.76140400 211.12538 0.58968600 -0.48516600 -0.64566700 -24.33155 -0.59555600 -0.80120900 0.05812200 139.63004 1558 'point symmetry operation' ? ? -0.45155100 0.33057400 -0.82874800 272.43503 0.69265400 -0.45562400 -0.55914000 -110.56127 -0.56243500 -0.82651600 -0.02323700 85.84990 1559 'point symmetry operation' ? ? -0.37391400 0.31312400 -0.87300800 181.69524 0.74838100 -0.45412900 -0.48341900 -86.15591 -0.54782800 -0.83409900 -0.06453200 266.59283 1560 'point symmetry operation' ? ? -0.51797400 0.32314800 -0.79200900 234.37426 0.64914900 -0.45446900 -0.60997100 -60.48232 -0.55705500 -0.83008100 0.02563200 108.95512 1561 'point symmetry operation' ? ? -0.52933900 0.33647900 -0.77883400 270.17304 0.64112700 -0.44258700 -0.62695600 -73.38690 -0.55565900 -0.83120400 0.01855300 72.21731 1562 'point symmetry operation' ? ? -0.38288700 -0.47994400 -0.78933600 19.72359 0.87306300 0.09126400 -0.47899200 -14.68365 0.30192700 -0.87254000 0.38407700 42.91516 1563 'point symmetry operation' ? ? -0.58283100 0.33113400 -0.74206300 319.69696 0.54151200 -0.52260700 -0.65851900 -51.93822 -0.60586600 -0.78564200 0.12527800 120.15219 1564 'point symmetry operation' ? ? -0.48190200 0.33651900 -0.80902700 296.88189 0.67463600 -0.44668800 -0.58765400 -114.93654 -0.55914000 -0.82899100 -0.01176800 30.00290 1565 'point symmetry operation' ? ? -0.63819700 0.26286500 -0.72360600 0.00000 0.26286500 -0.80901700 -0.52573100 0.00000 -0.72360600 -0.52573100 0.44721400 0.00000 1566 'point symmetry operation' ? ? -0.04396000 0.87413700 -0.48368500 9.10961 -0.38687600 -0.46127200 -0.79847000 193.58107 -0.92108300 0.15202600 0.35846000 127.70775 1567 'point symmetry operation' ? ? 0.02130300 0.89704200 -0.44143000 111.32388 -0.14813600 -0.43382400 -0.88873600 183.44924 -0.98873700 0.08432400 0.12364200 267.10645 1568 'point symmetry operation' ? ? 0.02256800 0.87186700 -0.48922100 -70.34902 -0.28251800 -0.46383900 -0.83966500 211.59081 -0.95899600 0.15716400 0.23585000 178.56829 1569 'point symmetry operation' ? ? -0.00900400 0.88742000 -0.46087200 -36.32499 -0.30759200 -0.44100200 -0.84315100 204.99927 -0.95147500 0.13416900 0.27693400 158.27674 1570 'point symmetry operation' ? ? -0.00749300 0.84684500 -0.53178600 24.28202 -0.50246000 -0.46297900 -0.73019400 155.57063 -0.86456800 0.26172900 0.42897500 83.81540 1571 'point symmetry operation' ? ? -0.62620900 0.16477900 -0.76204300 102.33506 0.10744700 -0.94984500 -0.29368300 -168.52349 -0.77221500 -0.26578700 0.57709600 -61.68002 1572 'point symmetry operation' ? ? -0.03788300 0.88575800 -0.46259700 87.71617 -0.41543300 -0.43498800 -0.79887400 236.00936 -0.90883400 0.16191400 0.38445200 168.34377 1573 'point symmetry operation' ? ? -0.57613500 0.11578000 -0.80911200 93.22973 0.10189800 -0.97201900 -0.21164900 -248.61590 -0.81097700 -0.20438600 0.54821700 -67.28788 1574 'point symmetry operation' ? ? 0.01193200 0.89837600 -0.43906400 178.17648 -0.18201300 -0.42980900 -0.88438400 167.75944 -0.98322300 0.09046800 0.15838700 252.88344 1575 'point symmetry operation' ? ? -0.02036300 0.85291300 -0.52165500 111.24989 -0.48922100 -0.46353100 -0.73878400 217.00663 -0.87192200 0.24016100 0.42670200 150.30410 1576 'point symmetry operation' ? ? 0.03226700 0.89652600 -0.44181300 42.71824 -0.11655900 -0.43565100 -0.89253700 198.79482 -0.99265900 0.08029700 0.09044100 279.61790 1577 'point symmetry operation' ? ? -0.58656700 0.10067900 -0.80361800 248.00692 0.05711400 -0.98463100 -0.16504500 -144.08066 -0.80788400 -0.14270800 0.57180200 47.08564 1578 'point symmetry operation' ? ? -0.02733700 0.86516200 -0.50074500 58.59780 -0.45713100 -0.45630500 -0.76342500 194.43512 -0.88897900 0.20803600 0.40796600 125.14504 1579 'point symmetry operation' ? ? 0.01045600 0.78384400 -0.62086900 214.03548 -0.58122900 -0.50047500 -0.64163600 215.58425 -0.81367300 0.36757600 0.45035900 186.78984 1580 'point symmetry operation' ? ? -0.00415300 0.82354900 -0.56722800 92.68913 -0.53348800 -0.48159300 -0.69531100 168.73412 -0.84579700 0.29972200 0.44135400 114.30726 1581 'point symmetry operation' ? ? -0.08388900 0.89121800 -0.44575000 176.79497 -0.37806600 -0.44234600 -0.81326200 202.39889 -0.92197000 0.10029900 0.37404700 170.13890 1582 'point symmetry operation' ? ? -0.07974700 0.89504300 -0.43879100 198.53538 -0.39872500 -0.43208500 -0.80890100 244.43292 -0.91359700 0.11044900 0.39133300 198.56895 1583 'point symmetry operation' ? ? -0.01422400 0.83711900 -0.54683600 169.05347 -0.51587000 -0.47463000 -0.71316500 239.94982 -0.85654900 0.27195200 0.43859500 181.00784 1584 'point symmetry operation' ? ? 0.07328900 0.79300900 -0.60478500 -124.30671 -0.50750800 -0.49237200 -0.70711100 99.87341 -0.85852400 0.35875600 0.36637300 32.77428 1585 'point symmetry operation' ? ? -0.56280200 0.09299800 -0.82134300 140.18552 0.07563000 -0.98368900 -0.16320400 -248.29516 -0.82312400 -0.15397000 0.54658900 -31.00587 1586 'point symmetry operation' ? ? -0.00351500 0.86147500 -0.50778700 -29.26884 -0.42227600 -0.46157400 -0.78014900 170.70659 -0.90646000 0.21168400 0.36540200 100.56460 1587 'point symmetry operation' ? ? 0.00261500 0.80271600 -0.59635500 155.67521 -0.55833400 -0.49357500 -0.66681900 190.20522 -0.82961200 0.33470800 0.44689300 150.04706 1588 'point symmetry operation' ? ? -0.01344100 0.89554800 -0.44476000 61.98554 -0.22379800 -0.43621000 -0.87157000 197.74724 -0.97454300 0.08782200 0.20628400 218.17548 1589 'point symmetry operation' ? ? 0.00470900 0.87490900 -0.48426300 -225.49044 -0.38699000 -0.44494100 -0.80763000 167.70355 -0.92207200 0.19120800 0.33648600 38.62318 1590 'point symmetry operation' ? ? 0.02171800 0.89642200 -0.44266700 -4.39458 -0.19801500 -0.43014300 -0.88077600 217.14952 -0.97995800 0.10678300 0.16816300 235.69968 1591 'point symmetry operation' ? ? -0.63373900 0.20534700 -0.74579300 54.04358 0.12629200 -0.92371900 -0.36165400 -148.42102 -0.76316700 -0.32338300 0.55946200 -82.05925 1592 'point symmetry operation' ? ? -0.02731200 0.89532300 -0.44457900 13.24291 -0.30888000 -0.43053900 -0.84807300 206.52513 -0.95070800 0.11415900 0.28830600 168.83563 1593 'point symmetry operation' ? ? -0.60618700 0.11705300 -0.78666100 194.54356 0.06863100 -0.97772100 -0.19836900 -163.91574 -0.79235500 -0.17423800 0.58464900 0.72691 1594 'point symmetry operation' ? ? 0.05958600 0.87915100 -0.47280200 -107.67004 -0.15243100 -0.46007500 -0.87469700 230.50686 -0.98651600 0.12419000 0.10659500 254.81688 1595 'point symmetry operation' ? ? 0.04870500 0.89914900 -0.43492300 156.70492 -0.06882800 -0.43138300 -0.89953900 166.27114 -0.99643800 0.07374700 0.04087600 314.91397 1596 'point symmetry operation' ? ? 0.04988300 0.89459400 -0.44408500 -22.50496 -0.07921800 -0.43969400 -0.89464700 214.33474 -0.99560800 0.07980700 0.04893500 300.55022 1597 'point symmetry operation' ? ? -0.04633800 0.85934600 -0.50928900 -179.72326 -0.50534400 -0.45995100 -0.73011700 117.08075 -0.86167200 0.22353400 0.45557900 -34.09233 1598 'point symmetry operation' ? ? 0.02711100 0.84913100 -0.52748500 -244.94320 -0.38468000 -0.47818100 -0.78953400 153.91277 -0.92265200 0.22431800 0.31367900 37.84070 1599 'point symmetry operation' ? ? -0.06634700 0.87915700 -0.47189000 193.85564 -0.41863000 -0.45382100 -0.78663500 273.49559 -0.90573000 0.14535700 0.39815100 217.58665 1600 'point symmetry operation' ? ? -0.62032900 0.13683100 -0.77231400 145.18101 0.07979700 -0.96854600 -0.23569200 -179.32014 -0.78027100 -0.20783500 0.58989800 -39.02455 1601 'point symmetry operation' ? ? -0.06522600 0.88822200 -0.45475900 117.70608 -0.38180400 -0.44326500 -0.81101200 200.86600 -0.92193900 0.12073000 0.36803900 157.69991 1602 'point symmetry operation' ? ? -0.08830300 0.87959600 -0.46745300 155.58921 -0.38987800 -0.46236600 -0.79637400 236.93635 -0.91662300 0.11192700 0.38376400 188.11560 1603 'point symmetry operation' ? ? -0.03079300 0.89353900 -0.44792800 44.54282 -0.39367600 -0.42275900 -0.81626800 206.53658 -0.91873300 0.15120400 0.36478200 141.49562 1604 'point symmetry operation' ? ? -0.00845600 0.89384800 -0.44828900 138.59505 -0.26011600 -0.43483800 -0.86212300 177.34067 -0.96554000 0.10931700 0.23618100 207.74131 1605 'point symmetry operation' ? ? 0.02400100 0.88738700 -0.46039900 -57.02663 -0.17114300 -0.45008600 -0.87643100 222.11905 -0.98495300 0.09983000 0.14106700 242.73164 1606 'point symmetry operation' ? ? -0.04983900 0.89125900 -0.45074700 88.20825 -0.32475200 -0.44124500 -0.83656300 188.33415 -0.94448500 0.10468700 0.31142900 164.95488 1607 'point symmetry operation' ? ? -0.05717000 0.89908400 -0.43402700 140.90296 -0.33585100 -0.42672000 -0.83971100 187.20409 -0.94017800 0.09776200 0.32635300 169.39707 1608 'point symmetry operation' ? ? -0.61716200 0.29459300 -0.72960600 -15.43721 0.33176400 -0.74338200 -0.58078900 28.79358 -0.71347200 -0.60049800 0.36105200 37.13433 1609 'point symmetry operation' ? ? -0.04054000 0.87552900 -0.48146000 135.95407 -0.44886600 -0.44645500 -0.77407800 257.21115 -0.89267900 0.18473000 0.41109400 186.27693 1610 'point symmetry operation' ? ? -0.02827400 0.89817500 -0.43872600 196.11655 -0.28828000 -0.42758000 -0.85677900 162.61669 -0.95712800 0.10225200 0.27101500 193.24456 1611 'point symmetry operation' ? ? -0.36180300 0.26286500 -0.89442700 0.00000 0.58778500 0.80901700 0.00000000 0.00000 0.72360700 -0.52573100 -0.44721400 0.00000 1612 'point symmetry operation' ? ? 0.15009100 0.71103600 -0.68694900 4.78031 0.98410000 -0.04069700 0.17289100 -206.90521 0.09497500 -0.70197600 -0.70584000 105.03938 1613 'point symmetry operation' ? ? 0.26939300 0.75590500 -0.59668600 61.42401 0.91167700 -0.00055200 0.41090700 -337.02464 0.31027800 -0.65468100 -0.68929100 5.82825 1614 'point symmetry operation' ? ? 0.24054000 0.70705000 -0.66499700 -81.61564 0.95336300 -0.04341600 0.29868600 -246.26577 0.18231500 -0.70582900 -0.68452000 119.57568 1615 'point symmetry operation' ? ? 0.20448200 0.73184700 -0.65006600 -44.85002 0.96463200 -0.03780000 0.26087500 -231.23653 0.16634800 -0.68041900 -0.71369400 113.63923 1616 'point symmetry operation' ? ? 0.15023400 0.65458700 -0.74090800 25.10823 0.98789300 -0.12872900 0.08658400 -153.02784 -0.03870000 -0.74494600 -0.66600200 88.14148 1617 'point symmetry operation' ? ? -0.36226200 0.07523000 -0.92903500 86.60273 0.70489600 0.67424400 -0.22026400 120.10456 0.60982600 -0.73466700 -0.29728300 -144.05527 1618 'point symmetry operation' ? ? 0.14782200 0.72358200 -0.67422400 74.89884 0.98697200 -0.06413900 0.14755700 -275.45687 0.06352600 -0.68725200 -0.72363700 101.23167 1619 'point symmetry operation' ? ? -0.30501900 0.00824500 -0.95231000 66.51618 0.73250800 0.64106100 -0.22906800 166.40037 0.60860000 -0.76744600 -0.20157700 -207.16140 1620 'point symmetry operation' ? ? 0.25349000 0.75612200 -0.60334200 126.12987 0.92544800 -0.00800300 0.37879100 -327.94182 0.28158400 -0.65438100 -0.70178100 -19.63520 1621 'point symmetry operation' ? ? 0.14222700 0.66620600 -0.73207900 99.08917 0.98962000 -0.11109200 0.09116600 -254.43334 -0.02059200 -0.73744700 -0.67509200 86.63001 1622 'point symmetry operation' ? ? 0.28599300 0.75623200 -0.58849000 -4.52520 0.89744400 0.00387100 0.44111200 -344.19462 0.33586100 -0.65429100 -0.67756900 32.24885 1623 'point symmetry operation' ? ? -0.32303100 -0.02515500 -0.94605400 198.49384 0.75396400 0.59735400 -0.27332500 -8.30434 0.57200500 -0.80158300 -0.17399900 -212.16730 1624 'point symmetry operation' ? ? 0.14554900 0.68786200 -0.71109800 52.50325 0.98921700 -0.08936800 0.11602700 -213.19213 0.01626100 -0.72031800 -0.69345300 93.23373 1625 'point symmetry operation' ? ? 0.14037200 0.55956400 -0.81681300 186.13351 0.98106700 -0.18978400 0.03858700 -301.45734 -0.13342700 -0.80676500 -0.57561100 40.69383 1626 'point symmetry operation' ? ? 0.14316900 0.61899600 -0.77223400 83.61512 0.98689700 -0.14795600 0.06437000 -196.66095 -0.07441200 -0.77133200 -0.63206900 66.79533 1627 'point symmetry operation' ? ? 0.11394600 0.74458700 -0.65772700 153.31893 0.98693600 -0.00893300 0.16086500 -274.65043 0.11390200 -0.66746400 -0.73587900 47.21727 1628 'point symmetry operation' ? ? 0.11219800 0.74707300 -0.65520500 172.88271 0.98947000 -0.02331900 0.14284900 -323.38344 0.09144000 -0.66433300 -0.74182300 64.25033 1629 'point symmetry operation' ? ? 0.13946400 0.64065500 -0.75505600 149.08251 0.98887000 -0.13002000 0.07233100 -301.41388 -0.05183300 -0.75674000 -0.65165900 76.43897 1630 'point symmetry operation' ? ? 0.22426100 0.57199900 -0.78900100 -110.57811 0.97215200 -0.18782300 0.14015300 -57.62129 -0.06802500 -0.79846000 -0.59819300 104.65789 1631 'point symmetry operation' ? ? -0.29330000 -0.02916500 -0.95557500 101.01730 0.75380900 0.60771100 -0.24991900 127.74823 0.58800300 -0.79362300 -0.15625800 -236.09267 1632 'point symmetry operation' ? ? 0.17860800 0.68250500 -0.70872100 -27.78625 0.98279000 -0.08923800 0.16174100 -166.14365 0.04714400 -0.72541200 -0.68669800 108.32754 1633 'point symmetry operation' ? ? 0.14106900 0.58764600 -0.79672500 136.88630 0.98445200 -0.16834200 0.05014400 -248.03133 -0.10465500 -0.79141200 -0.60225800 51.66744 1634 'point symmetry operation' ? ? 0.22026900 0.75313500 -0.61989400 30.53718 0.94307800 -0.00209100 0.33256600 -294.53497 0.24917100 -0.65786200 -0.71072700 53.51030 1635 'point symmetry operation' ? ? 0.19644500 0.70359200 -0.68291100 -197.01757 0.97709100 -0.08231900 0.19625700 -80.07341 0.08186900 -0.70582000 -0.70364500 187.70851 1636 'point symmetry operation' ? ? 0.25925600 0.74970800 -0.60887100 -34.03044 0.92908100 -0.02139600 0.36925600 -308.35896 0.26380700 -0.66142200 -0.70208800 80.52484 1637 'point symmetry operation' ? ? -0.36883300 0.13382100 -0.91981100 49.75896 0.68900000 0.70358500 -0.17391800 135.23437 0.62389200 -0.69789700 -0.35170900 -104.49374 1638 'point symmetry operation' ? ? 0.18671900 0.74656300 -0.63857500 -0.56918 0.96759800 -0.02729400 0.25101600 -249.03420 0.16997000 -0.66475400 -0.72747000 96.51487 1639 'point symmetry operation' ? ? -0.34403600 0.00019200 -0.93895600 157.44351 0.73818300 0.61806000 -0.27034600 49.73396 0.58028000 -0.78613100 -0.21277800 -193.53080 1640 'point symmetry operation' ? ? 0.30434400 0.72367400 -0.61941000 -134.96816 0.90571500 -0.01843100 0.42348500 -314.52153 0.29504900 -0.68989500 -0.66105400 111.88247 1641 'point symmetry operation' ? ? 0.31036200 0.76122000 -0.56940200 88.40505 0.87412300 0.00688300 0.48565600 -376.47571 0.37361100 -0.64845600 -0.66326500 -42.70756 1642 'point symmetry operation' ? ? 0.30956000 0.75388000 -0.57951300 -69.56643 0.87842000 0.00662300 0.47784400 -359.17450 0.36407600 -0.65697700 -0.66017400 54.13395 1643 'point symmetry operation' ? ? 0.11217100 0.67747700 -0.72694000 -141.79235 0.99318300 -0.09978400 0.06026000 -0.34185 -0.03171200 -0.72874400 -0.68405200 164.51583 1644 'point symmetry operation' ? ? 0.21820000 0.66462300 -0.71460800 -217.46767 0.97279000 -0.08967500 0.21363100 -69.35210 0.07790200 -0.74177800 -0.66610600 181.70392 1645 'point symmetry operation' ? ? 0.11948300 0.71884600 -0.68482400 167.91514 0.99055300 -0.03956500 0.13129400 -353.33193 0.06728500 -0.69404200 -0.71678300 81.76097 1646 'point symmetry operation' ? ? -0.35895700 0.02970200 -0.93288100 119.17112 0.72461900 0.63883900 -0.25848100 99.27023 0.58828300 -0.76876700 -0.25084000 -175.21366 1647 'point symmetry operation' ? ? 0.13100800 0.73595400 -0.66423500 100.53818 0.98574600 -0.02536700 0.16631400 -253.70315 0.10555000 -0.67655600 -0.72878800 67.80801 1648 'point symmetry operation' ? ? 0.10636700 0.72711300 -0.67822700 133.87487 0.98901100 -0.00692700 0.14768100 -303.76596 0.10268300 -0.68648200 -0.71986000 74.41829 1649 'point symmetry operation' ? ? 0.16080800 0.73589800 -0.65771800 36.63698 0.98336200 -0.06240600 0.17060200 -230.86812 0.08450000 -0.67420900 -0.73369100 100.10034 1650 'point symmetry operation' ? ? 0.21660100 0.74580700 -0.62996500 102.67141 0.95276900 -0.02078600 0.30298300 -287.90185 0.21287300 -0.66583700 -0.71508500 19.64335 1651 'point symmetry operation' ? ? 0.26716600 0.73983100 -0.61747200 -85.02045 0.91952400 -0.00404200 0.39301300 -308.27484 0.28826800 -0.67278000 -0.68137300 96.15455 1652 'point symmetry operation' ? ? 0.16108200 0.74359200 -0.64893900 68.55629 0.97390000 -0.01322400 0.22659300 -248.81643 0.15991200 -0.66850200 -0.72631500 62.05626 1653 'point symmetry operation' ? ? 0.15114500 0.75527800 -0.63773800 117.05804 0.97697700 -0.01586600 0.21275500 -260.59095 0.15057100 -0.65521200 -0.74028800 44.54388 1654 'point symmetry operation' ? ? -0.33348600 0.32424600 -0.88524000 -20.20823 0.54129800 0.83464600 0.10179800 -43.47721 0.77187000 -0.44523100 -0.45385800 12.15304 1655 'point symmetry operation' ? ? 0.13540800 0.70572300 -0.69542700 119.07825 0.99037700 -0.07615100 0.11556000 -309.14937 0.02859600 -0.70438200 -0.70924500 97.91439 1656 'point symmetry operation' ? ? 0.19092900 0.75303700 -0.62966700 158.77128 0.96291500 -0.01910800 0.26912600 -277.55315 0.19063100 -0.65770000 -0.72876000 -2.29705 1657 'point symmetry operation' ? ? 0.13819600 0.42532500 -0.89442700 0.00000 0.95105700 -0.30901700 0.00000000 0.00000 -0.27639300 -0.85065100 -0.44721300 0.00000 1658 'point symmetry operation' ? ? 0.57416100 0.40144300 -0.71356900 -54.85016 0.32105700 -0.91213500 -0.25482000 23.38144 -0.75316700 -0.08278800 -0.65259800 224.30036 1659 'point symmetry operation' ? ? 0.70568100 0.47025800 -0.52997200 -88.79866 0.43108200 -0.87858100 -0.20558200 -125.31379 -0.56230000 -0.08338600 -0.82271800 306.27396 1660 'point symmetry operation' ? ? 0.66317800 0.39578600 -0.63525400 -142.02980 0.34738400 -0.91455700 -0.20714800 60.33014 -0.66296300 -0.08330100 -0.74400400 240.40408 1661 'point symmetry operation' ? ? 0.63248300 0.42656900 -0.64653200 -105.59354 0.35262100 -0.90175400 -0.25000000 44.28720 -0.68965500 -0.06986000 -0.72076000 235.12633 1662 'point symmetry operation' ? ? 0.53895100 0.30347600 -0.78576900 -19.08655 0.20845700 -0.95188100 -0.22465200 17.01026 -0.81613500 -0.04272300 -0.57627900 176.53105 1663 'point symmetry operation' ? ? 0.15616300 0.14855000 -0.97649600 85.90222 0.89065400 -0.44858900 0.07419300 -122.26083 -0.42702400 -0.88130600 -0.20236000 -142.65412 1664 'point symmetry operation' ? ? 0.56473500 0.40635400 -0.71829600 -24.63090 0.29615700 -0.91218900 -0.28320000 -30.86446 -0.77030200 -0.05279600 -0.63549000 300.29129 1665 'point symmetry operation' ? ? 0.21690000 0.06764900 -0.97384700 70.84026 0.87379700 -0.45823700 0.16278500 -153.09261 -0.43524000 -0.88625200 -0.15850200 -215.80936 1666 'point symmetry operation' ? ? 0.68990200 0.46735900 -0.55282000 -36.20967 0.41769300 -0.88072100 -0.22330100 -171.68865 -0.59124200 -0.07685400 -0.80282400 305.04428 1667 'point symmetry operation' ? ? 0.53779000 0.32306400 -0.77872400 1.12245 0.22779900 -0.94499400 -0.23472300 -47.07752 -0.81172000 -0.05116100 -0.58180200 282.56358 1668 'point symmetry operation' ? ? 0.72100400 0.47252800 -0.50682200 -141.38104 0.44138600 -0.87702300 -0.18976400 -77.00480 -0.53416300 -0.08688400 -0.84090500 305.96088 1669 'point symmetry operation' ? ? 0.20038800 0.01083900 -0.97965600 108.88922 0.85695800 -0.48657600 0.16990700 -267.47115 -0.47483500 -0.87357100 -0.10679300 -32.95769 1670 'point symmetry operation' ? ? 0.55066800 0.35570100 -0.75514300 -19.65933 0.25761200 -0.93292100 -0.25158400 -8.90162 -0.79397800 -0.05599500 -0.60536200 237.55897 1671 'point symmetry operation' ? ? 0.50136700 0.17853100 -0.84661500 43.44068 0.12996300 -0.98291900 -0.13030900 -137.70664 -0.85541800 -0.04469600 -0.51600600 326.07973 1672 'point symmetry operation' ? ? 0.52256800 0.25733300 -0.81283500 6.87673 0.18077600 -0.96513000 -0.18932700 -39.51575 -0.83321200 -0.04800500 -0.55086600 220.27219 1673 'point symmetry operation' ? ? 0.54944900 0.45340600 -0.70180300 28.36563 0.35340700 -0.88723200 -0.29651800 -109.91678 -0.75710600 -0.08510100 -0.64772600 297.12406 1674 'point symmetry operation' ? ? 0.54281200 0.45029500 -0.70893500 29.20621 0.33582600 -0.89007100 -0.30821400 -118.80790 -0.76979000 -0.07077600 -0.63436100 351.60354 1675 'point symmetry operation' ? ? 0.52645500 0.28766100 -0.80006000 21.40816 0.20216800 -0.95638700 -0.21083800 -91.52780 -0.82581700 -0.05075000 -0.56165000 331.78783 1676 'point symmetry operation' ? ? 0.58794800 0.19237700 -0.78568900 -90.87773 0.14716200 -0.98053800 -0.12996100 118.25315 -0.79539900 -0.03921400 -0.60481500 65.25702 1677 'point symmetry operation' ? ? 0.23036600 0.01398900 -0.97300300 76.13734 0.85787300 -0.47489800 0.19628100 -204.32143 -0.45933200 -0.87992900 -0.12140100 -186.33247 1678 'point symmetry operation' ? ? 0.58496100 0.34973100 -0.73178400 -64.67041 0.26783600 -0.93493600 -0.23272300 52.62595 -0.76556200 -0.05986500 -0.64057100 182.09585 1679 'point symmetry operation' ? ? 0.51136000 0.21609500 -0.83175300 26.75569 0.15518700 -0.97517700 -0.15794800 -90.91626 -0.84523800 -0.04830900 -0.53220200 271.92882 1680 'point symmetry operation' ? ? 0.65981200 0.46633700 -0.58921800 -84.16616 0.40969800 -0.88058500 -0.23815500 -58.48599 -0.62991700 -0.08426400 -0.77207800 282.91723 1681 'point symmetry operation' ? ? 0.60750600 0.37626200 -0.69954400 -151.96645 0.28802600 -0.92510000 -0.24745000 218.72713 -0.74025500 -0.05116000 -0.67037700 97.60604 1682 'point symmetry operation' ? ? 0.69150400 0.45418800 -0.56172500 -138.22384 0.40124100 -0.88812200 -0.22415700 -12.31559 -0.60068900 -0.07038200 -0.79637800 288.91186 1683 'point symmetry operation' ? ? 0.14762600 0.22168600 -0.96387800 71.51971 0.90050100 -0.43316500 0.03829500 -68.26178 -0.40902900 -0.87362700 -0.26357400 -148.01522 1684 'point symmetry operation' ? ? 0.61943700 0.44804900 -0.64463100 -79.73499 0.36417300 -0.89144100 -0.26965300 5.38676 -0.69546800 -0.06772400 -0.71535900 254.84659 1685 'point symmetry operation' ? ? 0.17786100 0.04576100 -0.98299100 103.34803 0.86805400 -0.47781300 0.13482100 -216.22340 -0.46351600 -0.87726900 -0.12470700 -85.33954 1686 'point symmetry operation' ? ? 0.72905800 0.42514400 -0.53640100 -219.16642 0.40142000 -0.90035300 -0.16801100 55.38593 -0.55437900 -0.09283300 -0.82707000 280.27917 1687 'point symmetry operation' ? ? 0.74252000 0.47972100 -0.46747200 -95.74075 0.45592700 -0.87325000 -0.17194900 -190.26763 -0.49070800 -0.08545700 -0.86712300 325.58455 1688 'point symmetry operation' ? ? 0.74102200 0.47093000 -0.47865500 -197.75624 0.44948400 -0.87745700 -0.16743400 -35.35352 -0.49884900 -0.09107600 -0.86189000 310.51391 1689 'point symmetry operation' ? ? 0.51033000 0.33999200 -0.78991700 -76.87162 0.23222500 -0.93889000 -0.25408200 200.14793 -0.82803100 -0.05377300 -0.55809800 34.67408 1690 'point symmetry operation' ? ? 0.62332900 0.32961100 -0.70909600 -166.69000 0.27407000 -0.94138700 -0.19666700 225.63035 -0.73235700 -0.07175400 -0.67712900 80.14836 1691 'point symmetry operation' ? ? 0.54287500 0.41084800 -0.73245500 17.02712 0.31251500 -0.90835800 -0.27788700 -111.05421 -0.77950000 -0.07804500 -0.62152100 383.53725 1692 'point symmetry operation' ? ? 0.16144500 0.08483000 -0.98322900 96.49647 0.87701700 -0.46917400 0.10352600 -169.05610 -0.45252300 -0.87902200 -0.15014300 -129.86416 1693 'point symmetry operation' ? ? 0.56133900 0.43646300 -0.70313400 -2.52048 0.33867700 -0.89637200 -0.28603400 -63.47914 -0.75511300 -0.07757400 -0.65098900 273.92548 1694 'point symmetry operation' ? ? 0.54069900 0.43394300 -0.72065000 6.74327 0.34772800 -0.89535800 -0.27824600 -87.50532 -0.76598300 -0.10014300 -0.63501300 328.68168 1695 'point symmetry operation' ? ? 0.58018900 0.42131000 -0.69704900 -38.95310 0.30736000 -0.90579800 -0.29165100 -1.77438 -0.75426200 -0.04503200 -0.65502800 251.28058 1696 'point symmetry operation' ? ? 0.65074100 0.44986600 -0.61168300 -28.53997 0.38337600 -0.89003000 -0.24672000 -115.92577 -0.65540700 -0.07395400 -0.75164600 282.06638 1697 'point symmetry operation' ? ? 0.70101600 0.44991900 -0.55330800 -177.81151 0.41573200 -0.88821900 -0.19553600 22.69322 -0.57943400 -0.09295400 -0.80970100 281.73686 1698 'point symmetry operation' ? ? 0.59724400 0.45043700 -0.66363100 -29.59389 0.36846800 -0.88901700 -0.27180900 -53.25906 -0.71241200 -0.08219100 -0.69693100 258.35678 1699 'point symmetry operation' ? ? 0.58740700 0.46305700 -0.66372500 2.35681 0.36570000 -0.88349900 -0.29273500 -92.42358 -0.72195300 -0.07076900 -0.68831300 273.94654 1700 'point symmetry operation' ? ? 0.15616700 0.51137400 -0.84504900 -32.54845 0.96570300 -0.25872700 0.02189800 5.49788 -0.20743800 -0.81948600 -0.53423900 36.83352 1701 'point symmetry operation' ? ? 0.54583100 0.38112000 -0.74620100 -1.80406 0.27277600 -0.92287800 -0.27182700 -62.88852 -0.79225100 -0.05517400 -0.60769600 339.67917 1702 'point symmetry operation' ? ? 0.62678400 0.45906000 -0.62960700 18.14451 0.37851000 -0.88566400 -0.26894300 -155.25221 -0.68108100 -0.06974400 -0.72887900 278.95681 1703 'point symmetry operation' ? ? 0.44721300 0.00000000 -0.89442800 0.00000 0.00000000 -1.00000000 0.00000000 0.00000 -0.89442800 0.00000000 -0.44721300 0.00000 1704 'point symmetry operation' ? ? 0.42319800 -0.06487000 -0.90371300 24.66975 -0.78567600 -0.52303300 -0.33037800 221.35576 -0.45124000 0.84984100 -0.27231300 65.26047 1705 'point symmetry operation' ? ? 0.63609300 0.00854000 -0.77156600 -45.17405 -0.64525400 -0.54244100 -0.53796400 259.57658 -0.42312300 0.84005100 -0.33953200 219.02481 1706 'point symmetry operation' ? ? 0.53604200 -0.07091700 -0.84120800 -30.29590 -0.73866900 -0.52181100 -0.42671000 283.55186 -0.40869100 0.85010800 -0.33209700 16.93598 1707 'point symmetry operation' ? ? 0.50443900 -0.03522800 -0.86272900 -7.17716 -0.74670100 -0.51951400 -0.41538300 258.60754 -0.43356600 0.85373600 -0.28836800 38.29337 1708 'point symmetry operation' ? ? 0.32755800 -0.15513000 -0.93200900 39.57804 -0.85905900 -0.45956500 -0.22542600 163.54078 -0.39334900 0.87449100 -0.28380000 59.20186 1709 'point symmetry operation' ? ? 0.39537200 -0.30636200 -0.86592400 -17.39833 -0.15444200 -0.95148800 0.26611800 -195.66587 -0.90544400 0.02852000 -0.42350700 63.94726 1710 'point symmetry operation' ? ? 0.39974800 -0.05237100 -0.91512800 48.64410 -0.80393700 -0.49962500 -0.32258400 256.38165 -0.44032700 0.86465800 -0.24182700 153.74136 1711 'point symmetry operation' ? ? 0.43827500 -0.38155400 -0.81383800 -63.71195 -0.19247300 -0.92426700 0.32967400 -261.01676 -0.87799200 0.01215300 -0.47852200 53.29532 1712 'point symmetry operation' ? ? 0.60880100 0.00693700 -0.79329400 -19.91688 -0.66729900 -0.53631300 -0.51679800 221.83254 -0.42903800 0.84399100 -0.32187800 272.45894 1713 'point symmetry operation' ? ? 0.33600500 -0.13765200 -0.93174800 59.04281 -0.84883200 -0.47294600 -0.23623300 225.33790 -0.40814800 0.87027300 -0.27575600 166.72300 1714 'point symmetry operation' ? ? 0.66145800 0.01019300 -0.74991300 -70.02930 -0.62465200 -0.54590000 -0.55839300 296.60313 -0.41507000 0.83778800 -0.35472300 163.25730 1715 'point symmetry operation' ? ? 0.40593900 -0.43906100 -0.80152300 -29.03022 -0.22433500 -0.89807400 0.37833300 -157.00180 -0.88593900 0.02623000 -0.46306100 242.88175 1716 'point symmetry operation' ? ? 0.36468600 -0.10572700 -0.92510900 44.93116 -0.83000500 -0.48720900 -0.27151400 207.69067 -0.42201500 0.86686200 -0.26543200 108.37802 1717 'point symmetry operation' ? ? 0.25092500 -0.27655500 -0.92766100 68.99361 -0.90074600 -0.41769300 -0.11912200 216.35007 -0.35453300 0.86547700 -0.35391600 274.97424 1718 'point symmetry operation' ? ? 0.29694600 -0.20199100 -0.93328600 50.00116 -0.87517100 -0.44852700 -0.18138100 172.23893 -0.38196700 0.87064600 -0.30996500 134.02347 1719 'point symmetry operation' ? ? 0.41457100 -0.01013600 -0.90996100 59.81843 -0.76851800 -0.53940600 -0.34412300 206.71822 -0.48735000 0.84198500 -0.23141200 234.21876 1720 'point symmetry operation' ? ? 0.39786800 -0.01006500 -0.91738800 71.81900 -0.78191800 -0.52677400 -0.33333600 249.95623 -0.47990100 0.84994600 -0.21745700 266.37829 1721 'point symmetry operation' ? ? 0.31143800 -0.17289400 -0.93440600 71.22458 -0.86392300 -0.46106000 -0.20263500 244.84668 -0.39578200 0.87036300 -0.29295900 232.15527 1722 'point symmetry operation' ? ? 0.34944500 -0.26209400 -0.89955300 -9.98621 -0.88120100 -0.41818200 -0.22047400 130.70571 -0.31839200 0.86973000 -0.37708900 -96.52634 1723 'point symmetry operation' ? ? 0.43644900 -0.43313700 -0.78861000 -72.78857 -0.22361500 -0.90121400 0.37122700 -254.02574 -0.87149800 0.01432300 -0.49019000 111.51971 1724 'point symmetry operation' ? ? 0.40644300 -0.11279800 -0.90668700 16.97998 -0.81725900 -0.48858400 -0.30557100 198.66828 -0.40852500 0.86519500 -0.29076600 18.79494 1725 'point symmetry operation' ? ? 0.27307900 -0.24188800 -0.93108500 59.54857 -0.88854200 -0.43435000 -0.14776100 191.84208 -0.36867500 0.86765800 -0.33353900 206.34332 1726 'point symmetry operation' ? ? 0.56877900 0.00406600 -0.82248100 -19.21386 -0.68987000 -0.54214000 -0.47975300 258.38872 -0.44785000 0.84027900 -0.30555200 153.01261 1727 'point symmetry operation' ? ? 0.44145500 -0.08334400 -0.89340500 -10.95760 -0.79908100 -0.48942400 -0.34918900 215.25412 -0.40815100 0.86805400 -0.28265700 -184.41222 1728 'point symmetry operation' ? ? 0.60057200 -0.00577200 -0.79955000 -44.50671 -0.68110100 -0.52749300 -0.50779300 300.74756 -0.41882600 0.84954000 -0.32072900 101.47743 1729 'point symmetry operation' ? ? 0.39717700 -0.23465100 -0.88723700 -8.30786 -0.13246000 -0.97129500 0.19758500 -177.42246 -0.90813300 0.03904700 -0.41685800 11.64012 1730 'point symmetry operation' ? ? 0.49650300 -0.01174000 -0.86795600 4.01308 -0.74252700 -0.52364600 -0.41767000 252.36344 -0.44959800 0.85185500 -0.26870900 87.35036 1731 'point symmetry operation' ? ? 0.39437400 -0.40626000 -0.82427100 -26.48670 -0.20169600 -0.91336500 0.35367000 -183.36728 -0.89654300 0.02677400 -0.44214800 174.33037 1732 'point symmetry operation' ? ? 0.64581200 -0.04221000 -0.76232900 -87.85427 -0.65762400 -0.53801700 -0.52732100 348.75194 -0.38788800 0.84187700 -0.37521600 17.65443 1733 'point symmetry operation' ? ? 0.69819600 0.01839100 -0.71567100 -73.44594 -0.59234500 -0.54658100 -0.59192700 258.88400 -0.40205800 0.83720500 -0.37072600 280.99508 1734 'point symmetry operation' ? ? 0.69191400 0.00747300 -0.72194200 -99.63995 -0.60062400 -0.54892100 -0.58132400 337.32490 -0.40063300 0.83584100 -0.37531800 114.28105 1735 'point symmetry operation' ? ? 0.30971300 -0.12118900 -0.94307600 28.46329 -0.84966000 -0.48048200 -0.21729100 124.03998 -0.42679800 0.86859100 -0.25178100 -175.99614 1736 'point symmetry operation' ? ? 0.45133700 -0.13616700 -0.88190400 -25.53550 -0.80340600 -0.49213300 -0.33517800 208.79923 -0.38837400 0.85980500 -0.33151500 -202.16125 1737 'point symmetry operation' ? ? 0.38532400 -0.05384800 -0.92120900 73.44711 -0.79740900 -0.52183000 -0.30303800 284.69677 -0.46439700 0.85134800 -0.24401300 270.69757 1738 'point symmetry operation' ? ? 0.38707700 -0.36940000 -0.84481700 -24.63629 -0.18259300 -0.92880400 0.32246400 -203.75258 -0.90378800 0.02943900 -0.42696800 112.40173 1739 'point symmetry operation' ? ? 0.41910400 -0.02654400 -0.90755100 46.53979 -0.77643200 -0.52862100 -0.34309300 214.47095 -0.47064300 0.84844300 -0.24215700 175.80511 1740 'point symmetry operation' ? ? 0.40216200 -0.03452200 -0.91491800 59.43865 -0.77410300 -0.54643400 -0.31964700 249.68479 -0.48890700 0.83679100 -0.24647900 223.29115 1741 'point symmetry operation' ? ? 0.42226400 -0.03461800 -0.90581200 35.12767 -0.79340300 -0.49740700 -0.35085200 229.77154 -0.43841200 0.86682600 -0.23750300 103.11905 1742 'point symmetry operation' ? ? 0.54272100 -0.01129600 -0.83983800 4.05931 -0.71583000 -0.52928200 -0.45546500 216.25589 -0.43936600 0.84837100 -0.29533800 216.86801 1743 'point symmetry operation' ? ? 0.62080800 -0.01573200 -0.78380500 -65.71655 -0.66258800 -0.54490700 -0.51386100 322.30006 -0.41901700 0.83834900 -0.34870600 57.54663 1744 'point symmetry operation' ? ? 0.47452000 -0.01264900 -0.88015400 23.25157 -0.74617400 -0.53621900 -0.39458000 215.90059 -0.46696400 0.84398500 -0.26388500 152.66595 1745 'point symmetry operation' ? ? 0.46222800 0.00373000 -0.88675400 38.43809 -0.75096200 -0.53016600 -0.39367600 203.47013 -0.47159500 0.84788600 -0.24225600 201.78419 1746 'point symmetry operation' ? ? 0.48798800 0.10416100 -0.86661300 -15.53147 0.05553900 -0.99454800 -0.08826400 46.87509 -0.87108200 -0.00505900 -0.49111300 2.79950 1747 'point symmetry operation' ? ? 0.36744500 -0.07932200 -0.92665700 65.58230 -0.82179200 -0.49421800 -0.28355800 270.28221 -0.43547900 0.86571200 -0.24678400 204.90664 1748 'point symmetry operation' ? ? 0.51290900 -0.00035200 -0.85844300 26.70622 -0.72898300 -0.52826200 -0.43534200 181.60213 -0.45333000 0.84908200 -0.27120700 261.83371 1749 'point symmetry operation' ? ? 0.13819600 -0.42532500 -0.89442700 0.00000 -0.95105700 -0.30901700 0.00000000 0.00000 -0.27639300 0.85065100 -0.44721300 0.00000 1750 'point symmetry operation' ? ? -0.09417400 -0.04347400 -0.99460600 133.44612 -0.80663100 0.58888300 0.05063500 113.42394 0.58350500 0.80704800 -0.09052500 -152.29264 1751 'point symmetry operation' ? ? 0.15679600 0.00883000 -0.98759100 132.01016 -0.82987100 0.54333400 -0.12689800 285.74094 0.53547200 0.83947000 0.09252100 -135.34419 1752 'point symmetry operation' ? ? 0.03482900 -0.04809200 -0.99823500 99.17359 -0.80390600 0.59206000 -0.05657300 114.91455 0.59373600 0.80445800 -0.01804100 -242.00326 1753 'point symmetry operation' ? ? -0.00269800 -0.01535600 -0.99987800 114.39096 -0.81410700 0.58067600 -0.00672100 115.54105 0.58070900 0.81399000 -0.01406800 -204.84320 1754 'point symmetry operation' ? ? -0.19180700 -0.08745300 -0.97752800 120.02941 -0.73938500 0.66785400 0.08533100 84.06350 0.64538400 0.73913700 -0.19276100 -101.70121 1755 'point symmetry operation' ? ? 0.02478700 -0.66083300 -0.75012300 -80.54096 -0.98610400 -0.13946200 0.09027700 1.33267 -0.16427200 0.73746200 -0.65510600 190.23262 1756 'point symmetry operation' ? ? -0.11913400 -0.01865200 -0.99270300 193.46015 -0.79301700 0.60340400 0.08383200 189.31703 0.59743700 0.79721700 -0.08667700 -135.89133 1757 'point symmetry operation' ? ? 0.05317300 -0.71857900 -0.69340900 -151.19365 -0.99275200 -0.11299200 0.04096500 -8.22462 -0.10778600 0.68620500 -0.71937800 228.25897 1758 'point symmetry operation' ? ? 0.12226400 0.01114400 -0.99243500 152.49218 -0.83010700 0.54926200 -0.09609800 308.78870 0.54403600 0.83557600 0.07640600 -72.35986 1759 'point symmetry operation' ? ? -0.18426900 -0.07924800 -0.97967500 192.80613 -0.75240700 0.65269700 0.08872300 186.34401 0.63240000 0.75346300 -0.17989800 -100.80424 1760 'point symmetry operation' ? ? 0.18964400 0.00815800 -0.98181900 110.92441 -0.82744200 0.53963800 -0.15534200 260.31562 0.52855900 0.84185800 0.10909000 -198.65062 1761 'point symmetry operation' ? ? 0.00955700 -0.75310800 -0.65782700 -24.66436 -0.99560400 -0.06846500 0.06391600 170.43870 -0.09317300 0.65432500 -0.75045200 234.14979 1762 'point symmetry operation' ? ? -0.15537600 -0.05874300 -0.98610700 157.01274 -0.77058300 0.63181000 0.08377900 137.26152 0.61811100 0.77289400 -0.14343400 -115.78559 1763 'point symmetry operation' ? ? -0.26485200 -0.17678000 -0.94794600 227.47887 -0.68665500 0.72477100 0.05668800 271.41834 0.67702300 0.66592500 -0.31334300 -41.99708 1764 'point symmetry operation' ? ? -0.22189600 -0.12420600 -0.96712700 153.39178 -0.72166200 0.68792500 0.07722800 145.96526 0.65571900 0.71507500 -0.24228300 -72.75825 1765 'point symmetry operation' ? ? -0.10429100 -0.00543900 -0.99453100 204.21049 -0.82837800 0.55386100 0.08383800 237.67567 0.55037600 0.83259100 -0.06226900 -54.56606 1766 'point symmetry operation' ? ? -0.12232700 0.00219400 -0.99248700 241.83148 -0.81907800 0.56450600 0.10220100 273.28935 0.56049000 0.82542600 -0.06725700 -73.64749 1767 'point symmetry operation' ? ? -0.20844100 -0.10453900 -0.97243100 229.68699 -0.73610200 0.67143700 0.08560200 242.85138 0.64397700 0.73365200 -0.21690600 -84.77031 1768 'point symmetry operation' ? ? -0.16164600 -0.16335000 -0.97323500 20.30708 -0.69177400 0.72208700 -0.00629900 -37.47258 0.70378900 0.67224100 -0.22972300 -157.11286 1769 'point symmetry operation' ? ? 0.04014800 -0.75262900 -0.65721900 -139.94966 -0.99607500 -0.08208300 0.03315000 47.32489 -0.07889600 0.65330800 -0.75297000 245.84203 1770 'point symmetry operation' ? ? -0.11024100 -0.06588300 -0.99171900 104.32677 -0.77292900 0.63297400 0.04386900 70.15781 0.62484200 0.77136400 -0.12070200 -155.89889 1771 'point symmetry operation' ? ? -0.24447800 -0.15338500 -0.95744600 189.94616 -0.70433600 0.70673400 0.06662700 209.48118 0.66644000 0.69065200 -0.28081500 -54.45250 1772 'point symmetry operation' ? ? 0.07297300 0.00516600 -0.99732000 135.63220 -0.83606200 0.54552400 -0.05834900 218.17900 0.54376100 0.83807900 0.04412800 -156.68002 1773 'point symmetry operation' ? ? -0.07223200 -0.04006700 -0.99658200 31.13947 -0.78188600 0.62261900 0.03163900 -85.69277 0.61922400 0.78149900 -0.07630000 -268.60622 1774 'point symmetry operation' ? ? 0.11212500 0.00547700 -0.99367900 117.60707 -0.82218500 0.56211300 -0.08967700 198.18781 0.55806900 0.82704200 0.06753000 -222.75056 1775 'point symmetry operation' ? ? 0.03494900 -0.60454700 -0.79580200 -79.40470 -0.98236600 -0.16712800 0.08382000 -41.39134 -0.18367400 0.77884000 -0.59972700 153.83397 1776 'point symmetry operation' ? ? -0.01219400 0.00260900 -0.99992200 134.93797 -0.82308000 0.56781000 0.01151800 150.58243 0.56779500 0.82315600 -0.00477600 -174.49983 1777 'point symmetry operation' ? ? 0.00628800 -0.73119300 -0.68214100 -52.63335 -0.99271000 -0.08667700 0.08375900 102.89619 -0.12037000 0.67664100 -0.72640700 226.62358 1778 'point symmetry operation' ? ? 0.16964900 -0.03252000 -0.98496700 77.49942 -0.80785400 0.56784000 -0.15789200 160.15463 0.56443900 0.82249600 0.07006300 -313.05321 1779 'point symmetry operation' ? ? 0.23864200 0.01477300 -0.97099500 124.47892 -0.82201600 0.53544500 -0.19388200 350.26674 0.51705000 0.84444100 0.13992300 -114.85531 1780 'point symmetry operation' ? ? 0.23010100 0.00399100 -0.97315800 89.18918 -0.82069000 0.53820500 -0.19184400 243.83178 0.52299300 0.84280400 0.12711700 -263.37761 1781 'point symmetry operation' ? ? -0.21243300 -0.06873000 -0.97475500 28.64299 -0.75734400 0.64193600 0.11978900 -123.48701 0.61749700 0.76367200 -0.18842100 -176.35539 1782 'point symmetry operation' ? ? -0.06008800 -0.08902200 -0.99421500 10.92506 -0.77060200 0.63723200 -0.01048400 -96.58533 0.63447900 0.76551400 -0.10689000 -275.08219 1783 'point symmetry operation' ? ? -0.13544100 -0.03304800 -0.99023400 259.20442 -0.80534100 0.58584900 0.09060000 287.00649 0.57713300 0.80974600 -0.10596200 -100.81793 1784 'point symmetry operation' ? ? 0.00612200 -0.70525700 -0.70892500 -76.82567 -0.98986600 -0.10485900 0.09576700 43.13008 -0.14187700 0.70115400 -0.69875200 216.78052 1785 'point symmetry operation' ? ? -0.09913300 -0.01320800 -0.99498600 179.91924 -0.81853900 0.56966600 0.07399100 196.02948 0.56583300 0.82177000 -0.06728400 -90.95438 1786 'point symmetry operation' ? ? -0.11779200 -0.03088100 -0.99255800 219.13764 -0.82615000 0.55764300 0.08069400 241.81901 0.55100100 0.82950600 -0.09119800 -96.10755 1787 'point symmetry operation' ? ? -0.09472000 -0.00180900 -0.99550200 156.50206 -0.79771000 0.59838400 0.07481200 143.78100 0.59555700 0.80120800 -0.05812200 -139.63020 1788 'point symmetry operation' ? ? 0.04182000 -0.00036800 -0.99912500 155.41811 -0.82578300 0.56291500 -0.03477200 249.57926 0.56243500 0.82651400 0.02323700 -85.85020 1789 'point symmetry operation' ? ? 0.13738600 -0.01360700 -0.99042400 96.35304 -0.82523300 0.55144800 -0.12204800 176.49918 0.54782800 0.83409800 0.06453200 -266.59288 1790 'point symmetry operation' ? ? -0.03748900 -0.00569700 -0.99928000 154.06195 -0.82962900 0.55761600 0.02794500 186.69296 0.55705500 0.83008000 -0.02563100 -108.95533 1791 'point symmetry operation' ? ? -0.05139900 0.01207200 -0.99860500 175.43867 -0.82982000 0.55583900 0.04943100 218.17503 0.55566000 0.83120300 -0.01855200 -72.21760 1792 'point symmetry operation' ? ? 0.20341100 -0.33463800 -0.92013100 7.32584 -0.93137800 -0.35593700 -0.07644800 23.47252 -0.30192600 0.87254000 -0.38407600 -42.91516 1793 'point symmetry operation' ? ? -0.15322700 -0.03928700 -0.98740900 228.11150 -0.78067200 0.61743400 0.09657800 229.93212 0.60586600 0.78564100 -0.12527800 -120.15249 1794 'point symmetry operation' ? ? 0.00667500 0.00969400 -0.99993000 172.62436 -0.82904700 0.55918000 -0.00011300 267.48850 0.55914000 0.82898900 0.01176900 -30.00326 1795 'point symmetry operation' ? ? -0.36180300 -0.26286500 -0.89442700 0.00000 -0.58778500 0.80901700 0.00000000 0.00000 0.72360700 0.52573100 -0.44721400 0.00000 1796 'point symmetry operation' ? ? -0.26296300 0.43606200 -0.86063900 121.15368 0.28715100 0.88698200 0.36167300 -151.25594 0.92108400 -0.15202700 -0.35846000 -127.70779 1797 'point symmetry operation' ? ? -0.06983600 0.47072700 -0.87951000 197.89121 0.13236600 0.87824000 0.45953700 -82.97909 0.98873800 -0.08432500 -0.12364200 -267.10666 1798 'point symmetry operation' ? ? -0.14780000 0.43271800 -0.88933100 67.45608 0.24182800 0.88772400 0.39174600 -212.53078 0.95899700 -0.15716400 -0.23585000 -178.56832 1799 'point symmetry operation' ? ? -0.18808100 0.45872300 -0.86844500 91.10772 0.24355500 0.87839100 0.41122900 -187.19926 0.95147600 -0.13417000 -0.27693400 -158.27678 1800 'point symmetry operation' ? ? -0.30139900 0.41298000 -0.85942200 111.08652 0.40209400 0.87232200 0.27816400 -111.58670 0.86456800 -0.26173000 -0.42897500 -83.81544 1801 'point symmetry operation' ? ? -0.44345600 -0.42499500 -0.78912900 -16.26468 -0.45500300 0.86529500 -0.21032400 196.48947 0.77221600 0.26578700 -0.57709600 61.67996 1802 'point symmetry operation' ? ? -0.27483200 0.46091400 -0.84381600 209.68637 0.31382500 0.87254900 0.37439500 -139.37736 0.90883500 -0.16191500 -0.38445200 -168.34389 1803 'point symmetry operation' ? ? -0.40620800 -0.47767000 -0.77899000 -70.70816 -0.42108100 0.85443400 -0.30435700 255.93362 0.81097800 0.20438600 -0.54821700 67.28780 1804 'point symmetry operation' ? ? -0.09733000 0.47416600 -0.87503900 242.75389 0.15426600 0.87577500 0.45740600 -30.99077 0.98322400 -0.09046900 -0.15838700 -252.88369 1805 'point symmetry operation' ? ? -0.30402900 0.41756400 -0.85627400 217.55606 0.38382000 0.87633500 0.29106700 -110.17104 0.87192200 -0.24016200 -0.42670200 -150.30423 1806 'point symmetry operation' ? ? -0.04240600 0.46923600 -0.88205400 151.40797 0.11326500 0.87941400 0.46238600 -135.71933 0.99266000 -0.08029800 -0.09044100 -279.61807 1807 'point symmetry operation' ? ? -0.44097100 -0.49730000 -0.74715200 115.95328 -0.39098200 0.85576100 -0.33883100 262.33859 0.80788500 0.14270800 -0.57180200 -47.08587 1808 'point symmetry operation' ? ? -0.29081000 0.43172200 -0.85384100 161.69247 0.35375900 0.87768800 0.32329300 -122.85843 0.88897900 -0.20803700 -0.40796600 -125.14512 1809 'point symmetry operation' ? ? -0.33317700 0.33997100 -0.87943900 299.87523 0.47637000 0.86562500 0.15415700 -48.60443 0.81367300 -0.36757700 -0.45035900 -186.79005 1810 'point symmetry operation' ? ? -0.31693500 0.38319200 -0.86759200 174.16629 0.42916000 0.87368800 0.22911000 -82.02749 0.84579800 -0.29972300 -0.44135400 -114.30736 1811 'point symmetry operation' ? ? -0.29008800 0.46100500 -0.83864300 261.99690 0.25655300 0.88171100 0.39593800 -59.82668 0.92197000 -0.10030000 -0.37404700 -170.13909 1812 'point symmetry operation' ? ? -0.29888000 0.47013200 -0.83044900 304.29219 0.27570100 0.87565800 0.39650000 -81.05424 0.91359700 -0.11045000 -0.39133300 -198.56915 1813 'point symmetry operation' ? ? -0.31472700 0.39826300 -0.86158800 277.80575 0.40898700 0.87603000 0.25554100 -94.75637 0.85654900 -0.27195300 -0.43859500 -181.00801 1814 'point symmetry operation' ? ? -0.23901300 0.35214800 -0.90491100 -41.86220 0.45366100 0.86445600 0.21658000 -153.86499 0.85852500 -0.35875700 -0.36637300 -32.77420 1815 'point symmetry operation' ? ? -0.41086100 -0.50296000 -0.76041000 -32.53165 -0.39199300 0.85048400 -0.35073900 283.27406 0.82312500 0.15397000 -0.54658900 31.00574 1816 'point symmetry operation' ? ? -0.25104900 0.42564100 -0.86936900 76.65963 0.33956200 0.87978300 0.33268400 -155.30838 0.90646100 -0.21168500 -0.36540200 -100.56461 1817 'point symmetry operation' ? ? -0.32606400 0.35929500 -0.87440800 237.74343 0.45323900 0.87113500 0.18893900 -62.37568 0.82961300 -0.33470900 -0.44689300 -150.04722 1818 'point symmetry operation' ? ? -0.14241700 0.46811600 -0.87211500 166.37989 0.17315600 0.87929200 0.44369200 -123.54676 0.97454300 -0.08782300 -0.20628400 -218.17562 1819 'point symmetry operation' ? ? -0.22365600 0.44628600 -0.86649000 -83.85202 0.31585000 0.87422400 0.36874300 -268.21508 0.92207200 -0.19120900 -0.33648600 -38.62302 1820 'point symmetry operation' ? ? -0.09881900 0.47238900 -0.87583200 124.08158 0.17296300 0.87489700 0.45236900 -178.26082 0.97995900 -0.10678400 -0.16816300 -235.69979 1821 'point symmetry operation' ? ? -0.43847200 -0.37681800 -0.81593500 -43.51735 -0.47467500 0.86800400 -0.14578200 151.84120 0.76316800 0.32338300 -0.55946200 82.05924 1822 'point symmetry operation' ? ? -0.20365000 0.47126700 -0.85815700 132.10585 0.23383600 0.87457100 0.42478900 -159.29843 0.95070900 -0.11416000 -0.28830600 -168.83570 1823 'point symmetry operation' ? ? -0.45007400 -0.47999200 -0.75302100 61.04183 -0.41183100 0.85979600 -0.30190400 246.96053 0.79235600 0.17423800 -0.58464900 -0.72708 1824 'point symmetry operation' ? ? -0.04138900 0.44082300 -0.89663900 48.38120 0.15834300 0.88896100 0.42973900 -249.77097 0.98651600 -0.12419000 -0.10659500 -254.81694 1825 'point symmetry operation' ? ? -0.00105200 0.47386600 -0.88059600 224.50814 0.08431100 0.87750300 0.47210100 -42.40741 0.99643900 -0.07374800 -0.04087600 -314.91425 1826 'point symmetry operation' ? ? -0.00620600 0.46529600 -0.88513300 107.77539 0.09341000 0.88155000 0.46275800 -186.62866 0.99560900 -0.07980800 -0.04893500 -300.55036 1827 'point symmetry operation' ? ? -0.33452100 0.42487300 -0.84117700 -76.58081 0.38159600 0.87722000 0.29132400 -200.35905 0.86167300 -0.22353500 -0.45557900 34.09250 1828 'point symmetry operation' ? ? -0.20417500 0.40589400 -0.89082100 -107.69565 0.32714800 0.88596300 0.32869800 -268.49215 0.92265200 -0.22431800 -0.31367900 -37.84053 1829 'point symmetry operation' ? ? -0.29973900 0.44450400 -0.84414000 317.58877 0.29968100 0.88390500 0.35903100 -107.31712 0.90573000 -0.14535700 -0.39815100 -217.58686 1830 'point symmetry operation' ? ? -0.45495200 -0.45859800 -0.76335200 12.05228 -0.42917700 0.86399800 -0.26327700 230.40838 0.78027200 0.20783500 -0.58989800 39.02444 1831 'point symmetry operation' ? ? -0.27718600 0.45804200 -0.84460900 213.29199 0.27054800 0.88069400 0.38882200 -93.31814 0.92193900 -0.12073100 -0.36803900 -157.70005 1832 'point symmetry operation' ? ? -0.30060200 0.43983600 -0.84627500 265.14165 0.26351500 0.89107600 0.36951800 -100.23252 0.91662300 -0.11192800 -0.38376400 -188.11577 1833 'point symmetry operation' ? ? -0.25630700 0.47439600 -0.84217200 157.43478 0.30039200 0.86722800 0.39708900 -140.91004 0.91873400 -0.15120400 -0.36478300 -141.49570 1834 'point symmetry operation' ? ? -0.15973200 0.46754700 -0.86941600 216.36362 0.20546800 0.87718200 0.43397400 -62.00753 0.96554100 -0.10931700 -0.23618100 -207.74150 1835 'point symmetry operation' ? ? -0.08117700 0.45335700 -0.88762400 84.42236 0.15256600 0.88572100 0.43843200 -213.21762 0.98495400 -0.09983100 -0.14106700 -242.73172 1836 'point symmetry operation' ? ? -0.23120400 0.46168600 -0.85638200 182.06170 0.23343500 0.88084400 0.41185100 -100.51806 0.94448500 -0.10468800 -0.31142900 -164.95500 1837 'point symmetry operation' ? ? -0.24365800 0.47655400 -0.84470500 224.02839 0.23810500 0.87369200 0.42422500 -68.63064 0.94017900 -0.09776300 -0.32635300 -169.39723 1838 'point symmetry operation' ? ? -0.30428800 -0.19861700 -0.93164300 4.43542 -0.63116100 0.77456600 0.04101600 -32.36828 0.71347300 0.60049800 -0.36105200 -37.13434 1839 'point symmetry operation' ? ? -0.29663300 0.44589800 -0.84450200 261.17372 0.33931100 0.87581300 0.34324700 -128.17643 0.89267900 -0.18473000 -0.41109400 -186.27708 1840 'point symmetry operation' ? ? -0.19231900 0.47531400 -0.85853900 254.24497 0.21660500 0.87385400 0.43527200 -16.28527 0.95712900 -0.10225200 -0.27101500 -193.24479 1841 'point symmetry operation' ? ? -0.13819600 0.95105700 0.27639300 0.00000 -0.42532500 -0.30901700 0.85065100 0.00000 0.89442700 0.00000000 0.44721300 0.00000 1842 'point symmetry operation' ? ? 0.61644800 0.51748000 0.59347100 -218.14531 -0.64527200 -0.09993000 0.75738900 44.94040 0.45123900 -0.84984000 0.27231300 -65.26043 1843 'point symmetry operation' ? ? 0.41711000 0.51325300 0.75006100 -232.91264 -0.80435500 -0.17574500 0.56756200 123.17672 0.42312200 -0.84005000 0.33953200 -219.02460 1844 'point symmetry operation' ? ? 0.53687000 0.51818700 0.66577300 -260.31205 -0.73806700 -0.09380200 0.66817500 116.43545 0.40869000 -0.85010800 0.33209700 -16.93595 1845 'point symmetry operation' ? ? 0.55427500 0.50497300 0.66165100 -243.73266 -0.71049300 -0.12703400 0.69214300 86.74002 0.43356600 -0.85373500 0.28836800 -38.29333 1846 'point symmetry operation' ? ? 0.71579300 0.48501000 0.50240000 -167.76688 -0.57699000 0.00552400 0.81673200 12.89597 0.39334800 -0.87449000 0.28380000 -59.20183 1847 'point symmetry operation' ? ? 0.02470700 0.99959000 0.01449200 191.46575 -0.42374700 -0.00265800 0.90577700 -43.91727 0.90544300 -0.02851900 0.42350700 -63.94719 1848 'point symmetry operation' ? ? 0.64106100 0.49135500 0.58958600 -258.86541 -0.62861300 -0.10458400 0.77065400 32.96308 0.44032600 -0.86465700 0.24182700 -153.74125 1849 'point symmetry operation' ? ? 0.04761800 0.99693700 -0.06205000 267.92984 -0.47630200 0.07726500 0.87588000 -20.06496 0.87799100 -0.01215300 0.47852200 -53.29525 1850 'point symmetry operation' ? ? 0.44651100 0.50792000 0.73664500 -204.82079 -0.78521000 -0.17232700 0.59476700 87.49220 0.42903800 -0.84399100 0.32187800 -272.45869 1851 'point symmetry operation' ? ? 0.70345700 0.49233500 0.51259700 -232.55441 -0.58186300 -0.01523300 0.81314400 13.48029 0.40814800 -0.87027200 0.27575600 -166.72288 1852 'point symmetry operation' ? ? 0.38967900 0.51603200 0.76279900 -260.44631 -0.82211200 -0.17838700 0.54065700 158.25727 0.41506900 -0.83778800 0.35472300 -163.25712 1853 'point symmetry operation' ? ? 0.08791400 0.98979700 -0.11213300 158.28843 -0.45539500 0.14005100 0.87920500 -20.90676 0.88593800 -0.02622900 0.46306100 -242.88152 1854 'point symmetry operation' ? ? 0.67668800 0.49603400 0.54410000 -211.41015 -0.60332300 -0.05000300 0.79592800 21.44794 0.42201400 -0.86686200 0.26543200 -108.37795 1855 'point symmetry operation' ? ? 0.77912100 0.48270900 0.39995400 -227.08145 -0.51699000 0.13394600 0.84544700 1.23917 0.35453300 -0.86547600 0.35391600 -274.97402 1856 'point symmetry operation' ? ? 0.74057600 0.48899300 0.46090400 -179.26024 -0.55285500 0.05350300 0.83155800 5.67091 0.38196600 -0.87064500 0.30996500 -134.02338 1857 'point symmetry operation' ? ? 0.60279600 0.51613800 0.60847300 -215.08573 -0.63176600 -0.15704500 0.75908400 6.98886 0.48735000 -0.84198400 0.23141200 -234.21858 1858 'point symmetry operation' ? ? 0.62070100 0.50410200 0.60050900 -259.91592 -0.62002100 -0.15320900 0.76948100 8.93694 0.47990100 -0.84994500 0.21745700 -266.37808 1859 'point symmetry operation' ? ? 0.72540100 0.49192100 0.48146500 -254.87275 -0.56316200 0.02195700 0.82605500 7.92331 0.39578200 -0.87036200 0.29295900 -232.15509 1860 'point symmetry operation' ? ? 0.73008800 0.47870600 0.48766000 -121.22266 -0.60464800 0.12004100 0.78739500 49.88769 0.31839200 -0.86973000 0.37708900 96.52625 1861 'point symmetry operation' ? ? 0.07780000 0.99095300 -0.10936500 264.08580 -0.48418900 0.13344700 0.86472700 -9.27221 0.87149800 -0.01432300 0.49019000 -111.51958 1862 'point symmetry operation' ? ? 0.65166200 0.49952700 0.57079700 -194.19195 -0.63909700 -0.04370300 0.76788400 45.24297 0.40852500 -0.86519500 0.29076600 -18.79493 1863 'point symmetry operation' ? ? 0.76066800 0.48783900 0.42825000 -200.85427 -0.53428800 0.09582800 0.83985300 2.64852 0.36867500 -0.86765700 0.33354000 -206.34316 1864 'point symmetry operation' ? ? 0.48034400 0.51434900 0.71043300 -239.80503 -0.75412200 -0.17139700 0.63397400 98.12003 0.44785000 -0.84027800 0.30555200 -153.01247 1865 'point symmetry operation' ? ? 0.62355500 0.49122500 0.60817600 -201.33283 -0.66677800 -0.07197500 0.74177300 76.93840 0.40815100 -0.86805400 0.28265700 184.41206 1866 'point symmetry operation' ? ? 0.46217900 0.50345900 0.73001400 -272.27479 -0.78165000 -0.15751400 0.60350000 135.26453 0.41882500 -0.84954000 0.32072900 -101.47732 1867 'point symmetry operation' ? ? 0.00324300 0.99626800 0.08625600 171.30614 -0.41867100 -0.07698100 0.90486900 -46.92531 0.90813200 -0.03904700 0.41685900 -11.64011 1868 'point symmetry operation' ? ? 0.55275800 0.50164500 0.66544100 -241.25214 -0.70165600 -0.15065000 0.69640800 74.16796 0.44959800 -0.85185500 0.26870900 -87.35029 1869 'point symmetry operation' ? ? 0.06995700 0.99420300 -0.08164700 182.57753 -0.43739900 0.10413100 0.89321800 -31.47320 0.89654200 -0.02677400 0.44214800 -174.33020 1870 'point symmetry operation' ? ? 0.42587200 0.52472800 0.73708500 -304.53457 -0.81742100 -0.12611200 0.56206600 191.32462 0.38788700 -0.84187600 0.37521600 -17.65438 1871 'point symmetry operation' ? ? 0.34760000 0.51414600 0.78411000 -223.51749 -0.84706800 -0.18639300 0.49772800 149.85088 0.40205700 -0.83720400 0.37072600 -280.99480 1872 'point symmetry operation' ? ? 0.35741500 0.51974600 0.77596400 -290.02485 -0.84365200 -0.17673200 0.50696800 199.00235 0.40063200 -0.83584100 0.37531800 -114.28091 1873 'point symmetry operation' ? ? 0.71236800 0.49441500 0.49808200 -126.76468 -0.55711400 -0.03321900 0.82977100 11.26021 0.42679700 -0.86859000 0.25178200 175.99597 1874 'point symmetry operation' ? ? 0.62461400 0.51012400 0.59129600 -190.68905 -0.67751300 -0.02257500 0.73516400 88.80812 0.38837300 -0.85980400 0.33151500 202.16108 1875 'point symmetry operation' ? ? 0.63931000 0.51293000 0.57287500 -293.45926 -0.61287800 -0.11004100 0.78247800 18.12393 0.46439600 -0.85134800 0.24401300 -270.69736 1876 'point symmetry operation' ? ? 0.05404300 0.99749600 -0.04561900 201.39332 -0.42455600 0.06430400 0.90311500 -39.53247 0.90378700 -0.02943900 0.42696800 -112.40162 1877 'point symmetry operation' ? ? 0.60892200 0.51095100 0.60674900 -218.35569 -0.63852200 -0.13810800 0.75711000 22.01329 0.47064200 -0.84844300 0.24215700 -175.80497 1878 'point symmetry operation' ? ? 0.61194200 0.53035800 0.58672700 -255.83202 -0.62169000 -0.13602400 0.77136200 20.62744 0.48890700 -0.83679000 0.24647900 -223.29098 1879 'point symmetry operation' ? ? 0.62408500 0.48376000 0.61359100 -229.38087 -0.64677200 -0.12078300 0.75305900 37.59497 0.43841100 -0.86682600 0.23750400 -103.11898 1880 'point symmetry operation' ? ? 0.51308500 0.50686800 0.69269700 -206.92611 -0.73736100 -0.15281400 0.65798600 62.96620 0.43936600 -0.84837000 0.29533800 -216.86782 1881 'point symmetry operation' ? ? 0.43831900 0.52309900 0.73092000 -286.21825 -0.79517400 -0.15342300 0.58665100 162.09634 0.41901700 -0.83834800 0.34870600 -57.54655 1882 'point symmetry operation' ? ? 0.56302000 0.51388400 0.64725100 -212.51891 -0.68187600 -0.15367000 0.71514400 44.60347 0.46696400 -0.84398400 0.26388500 -152.66582 1883 'point symmetry operation' ? ? 0.57137200 0.50306500 0.64842900 -205.38972 -0.67166500 -0.16737800 0.72170000 26.31904 0.47159400 -0.84788600 0.24225600 -201.78403 1884 'point symmetry operation' ? ? -0.20361700 0.91368400 0.35174200 -39.78140 -0.44694200 -0.40639500 0.79692300 29.25650 0.87108100 0.00505900 0.49111200 -2.79949 1885 'point symmetry operation' ? ? 0.66802500 0.49454200 0.55603200 -277.31983 -0.60340900 -0.07728200 0.79367800 21.14944 0.43547800 -0.86571100 0.24678400 -204.90649 1886 'point symmetry operation' ? ? 0.53480700 0.50251600 0.67930800 -180.96668 -0.71307400 -0.16290700 0.68190000 30.71914 0.45332900 -0.84908100 0.27120700 -261.83349 1887 'point symmetry operation' ? ? 0.86180400 0.42532500 0.27639300 0.00000 -0.42532500 0.30901700 0.85065100 0.00000 0.27639300 -0.85065100 0.44721300 0.00000 1888 'point symmetry operation' ? ? 0.79625300 -0.54662700 0.25919300 -149.10963 -0.15969800 0.22332200 0.96157400 -91.86498 -0.58350500 -0.80704800 0.09052500 152.29264 1889 'point symmetry operation' ? ? 0.74080100 -0.51947100 0.42586900 -312.54908 -0.40556600 0.15950100 0.90004200 -37.25044 -0.53547200 -0.83947000 -0.09252100 135.34419 1890 'point symmetry operation' ? ? 0.75379700 -0.54822100 0.36227600 -139.93648 -0.28154500 0.22869500 0.93189600 -58.80924 -0.59373600 -0.80445800 0.01804100 242.00326 1891 'point symmetry operation' ? ? 0.77509600 -0.54751100 0.31537100 -145.23475 -0.24900600 0.19404300 0.94886400 -73.08823 -0.58070900 -0.81399000 0.01406800 204.84320 1892 'point symmetry operation' ? ? 0.76246900 -0.60814300 0.22091800 -117.04021 -0.04606300 0.28955100 0.95605400 -88.17779 -0.64538400 -0.73913700 0.19276100 101.70121 1893 'point symmetry operation' ? ? 0.93018100 0.33684500 0.14594200 23.62102 -0.32829600 0.58539400 0.74130700 77.01089 0.16427200 -0.73746200 0.65510600 -190.23262 1894 'point symmetry operation' ? ? 0.79101800 -0.56810800 0.22703300 -239.83358 -0.13175300 0.20420100 0.97002200 -125.48949 -0.59743700 -0.79721700 0.08667700 135.89133 1895 'point symmetry operation' ? ? 0.92773100 0.32951400 0.17531500 54.54341 -0.35734800 0.64849300 0.67213000 141.25227 0.10778600 -0.68620500 0.71937800 -228.25897 1896 'point symmetry operation' ? ? 0.75169700 -0.52582300 0.39807400 -340.79809 -0.37279700 0.15913300 0.91416600 -49.60785 -0.54403600 -0.83557600 -0.07640600 72.35986 1897 'point symmetry operation' ? ? 0.77252300 -0.59626300 0.21835500 -236.80397 -0.05725600 0.27706400 0.95914400 -125.78620 -0.63240000 -0.75346300 0.17989800 100.80424 1898 'point symmetry operation' ? ? 0.72834100 -0.51574700 0.45113700 -281.85230 -0.43605600 0.15899800 0.88576200 -25.05355 -0.52855900 -0.84185800 -0.10909000 198.65062 1899 'point symmetry operation' ? ? 0.94392300 0.29783700 0.14249200 -154.47516 -0.31674800 0.69509200 0.64538200 76.12569 0.09317300 -0.65432500 0.75045200 -234.14979 1900 'point symmetry operation' ? ? 0.78088100 -0.58273500 0.22504500 -179.06299 -0.09035200 0.25110800 0.96373300 -106.91196 -0.61811100 -0.77289400 0.14343400 115.78559 1901 'point symmetry operation' ? ? 0.73489100 -0.63467000 0.23901800 -328.42892 0.03970200 0.39209400 0.91906800 -132.47253 -0.67702300 -0.66592500 0.31334300 41.99708 1902 'point symmetry operation' ? ? 0.75491000 -0.61587400 0.22541100 -186.22181 -0.01197000 0.33070800 0.94365700 -100.77861 -0.65571900 -0.71507500 0.24228300 72.75825 1903 'point symmetry operation' ? ? 0.82006200 -0.52507300 0.22759200 -289.14741 -0.15679600 0.17632600 0.97176400 -120.77003 -0.55037600 -0.83259100 0.06226900 54.56606 1904 'point symmetry operation' ? ? 0.81679000 -0.53755600 0.20949600 -334.64355 -0.13676900 0.17235500 0.97549400 -145.54451 -0.56049000 -0.82542600 0.06725700 73.64749 1905 'point symmetry operation' ? ? 0.76448600 -0.60627000 0.21908500 -301.94247 -0.02922800 0.30690800 0.95129000 -143.40026 -0.64397700 -0.73365200 0.21690600 84.77031 1906 'point symmetry operation' ? ? 0.70786700 -0.63626800 0.30673700 29.36333 -0.06003600 0.37849200 0.92365600 -30.89288 -0.70378900 -0.67224100 0.22972300 157.11286 1907 'point symmetry operation' ? ? 0.93491700 0.31064000 0.17156400 -1.76189 -0.34598700 0.69042800 0.63529600 147.72433 0.07889600 -0.65330800 0.75297000 -245.84203 1908 'point symmetry operation' ? ? 0.76916600 -0.58163600 0.26473600 -98.96272 -0.13400300 0.25825800 0.95673700 -77.54078 -0.62484200 -0.77136400 0.12070200 155.89889 1909 'point symmetry operation' ? ? 0.74541100 -0.62474500 0.23250100 -257.92495 0.01486100 0.36427100 0.93117400 -115.91641 -0.66644000 -0.69065200 0.28081500 54.45250 1910 'point symmetry operation' ? ? 0.77259200 -0.52042100 0.36368200 -249.41313 -0.32775900 0.16366400 0.93047700 -61.57299 -0.54376100 -0.83807900 -0.04412800 156.68002 1911 'point symmetry operation' ? ? 0.76593800 -0.57976500 0.27787000 71.87608 -0.17291900 0.23050600 0.95758400 -56.09597 -0.61922400 -0.78149900 0.07630000 268.60622 1912 'point symmetry operation' ? ? 0.74729500 -0.53629400 0.39235100 -224.83030 -0.36070700 0.16849400 0.91733300 -50.60769 -0.55806900 -0.82704200 -0.06753000 222.75056 1913 'point symmetry operation' ? ? 0.92348600 0.34576300 0.16619900 63.90285 -0.33680600 0.52331300 0.78275500 62.72780 0.18367400 -0.77884000 0.59972700 -153.83397 1914 'point symmetry operation' ? ? 0.78656300 -0.54082500 0.29803800 -184.91044 -0.24274900 0.17298100 0.95454200 -81.80122 -0.56779500 -0.82315600 0.00477600 174.49983 1915 'point symmetry operation' ? ? 0.94218000 0.30838600 0.13113400 -81.59553 -0.31274400 0.66862200 0.67463800 81.85402 0.12037000 -0.67664100 0.72640700 -226.62358 1916 'point symmetry operation' ? ? 0.71589000 -0.52999900 0.45453600 -176.26465 -0.41098700 0.20640100 0.88796900 -24.21594 -0.56443900 -0.82249600 -0.07006300 313.05321 1917 'point symmetry operation' ? ? 0.70803900 -0.51380300 0.48444600 -371.58947 -0.48097900 0.15141200 0.86355900 -10.14823 -0.51705000 -0.84444100 -0.13992300 114.85531 1918 'point symmetry operation' ? ? 0.70941700 -0.51309700 0.48317600 -259.45867 -0.47244600 0.16251900 0.86624600 -9.47591 -0.52299300 -0.84280400 -0.12711700 263.37761 1919 'point symmetry operation' ? ? 0.78592200 -0.58927900 0.18729000 108.59197 -0.03199600 0.26373500 0.96406400 -65.40072 -0.61749700 -0.76367200 0.18842100 176.35539 1920 'point symmetry operation' ? ? 0.75145400 -0.57853400 0.31720000 88.48211 -0.18098100 0.28158000 0.94231500 -40.23690 -0.63447900 -0.76551400 0.10689000 275.08219 1921 'point symmetry operation' ? ? 0.80777800 -0.54696300 0.21983400 -353.05785 -0.12005200 0.21246700 0.96976500 -157.82835 -0.57713300 -0.80974600 0.10596200 100.81793 1922 'point symmetry operation' ? ? 0.93952600 0.31766300 0.12798900 -17.27876 -0.31170800 0.63833700 0.70382100 86.39355 0.14187700 -0.70115400 0.69875200 -216.78052 1923 'point symmetry operation' ? ? 0.80911100 -0.53770400 0.23709800 -242.03313 -0.15866100 0.18859800 0.96915300 -110.53705 -0.56583300 -0.82177000 0.06728400 90.95438 1924 'point symmetry operation' ? ? 0.82211500 -0.52080800 0.22997300 -297.70070 -0.14326700 0.20169000 0.96891500 -133.68625 -0.55100100 -0.82950600 0.09119800 96.10755 1925 'point symmetry operation' ? ? 0.78793700 -0.56853800 0.23647600 -185.10557 -0.15642200 0.18663100 0.96989700 -104.41165 -0.59555700 -0.80120800 0.05812200 139.63020 1926 'point symmetry operation' ? ? 0.77244300 -0.53525100 0.34181700 -285.39074 -0.29495400 0.17430100 0.93947900 -70.68729 -0.56243500 -0.82651400 -0.02323700 85.85020 1927 'point symmetry operation' ? ? 0.74238900 -0.52025400 0.42213200 -197.63533 -0.38567200 0.18334800 0.90423500 -37.09605 -0.54782800 -0.83409800 -0.06453200 266.59288 1928 'point symmetry operation' ? ? 0.80060900 -0.52856400 0.28221700 -225.16324 -0.22071500 0.17773100 0.95900800 -88.83044 -0.55705500 -0.83008000 0.02563100 108.95533 1929 'point symmetry operation' ? ? 0.80508900 -0.53236400 0.26157400 -261.71024 -0.20754500 0.16028300 0.96500500 -99.43242 -0.55566000 -0.83120300 0.01855200 72.21760 1930 'point symmetry operation' ? ? 0.82293600 0.44192500 0.35704300 -24.58749 -0.48126700 0.20827000 0.85147300 0.28610 0.30192600 -0.87254000 0.38407600 42.91516 1931 'point symmetry operation' ? ? 0.78981200 -0.57507500 0.21327400 -289.16866 -0.09551300 0.22816200 0.96892700 -145.89416 -0.60586600 -0.78564100 0.12527800 120.15249 1932 'point symmetry operation' ? ? 0.78640700 -0.53480800 0.30910300 -307.74046 -0.26253700 0.16357700 0.95095600 -81.51715 -0.55914000 -0.82898900 -0.01176900 30.00326 1933 'point symmetry operation' ? ? 0.67082000 -0.68819100 0.27639300 0.00000 0.16246000 0.50000000 0.85065100 0.00000 -0.72360700 -0.52573100 0.44721400 0.00000 1934 'point symmetry operation' ? ? -0.19183700 -0.97832100 -0.07801900 106.41438 0.33882800 -0.14062800 0.93028000 -161.96481 -0.92108400 0.15202700 0.35846000 127.70779 1935 'point symmetry operation' ? ? -0.10430700 -0.98071800 -0.16526200 17.76604 0.10732200 -0.17629700 0.97846900 -213.84793 -0.98873800 0.08432500 0.12364200 267.10666 1936 'point symmetry operation' ? ? -0.18431900 -0.97799300 -0.09775400 181.28367 0.21529600 -0.13721700 0.96686100 -129.83032 -0.95899700 0.15716400 0.23585000 178.56832 1937 'point symmetry operation' ? ? -0.17351400 -0.97715300 -0.12273800 149.88321 0.25413900 -0.16483400 0.95301800 -144.49650 -0.95147600 0.13417000 0.27693400 158.27678 1938 'point symmetry operation' ? ? -0.28927700 -0.95724500 0.00102600 71.79762 0.41090200 -0.12320500 0.90331600 -140.13187 -0.86456800 0.26173000 0.42897500 83.81544 1939 'point symmetry operation' ? ? 0.56976900 -0.69161400 0.44388400 -181.84650 0.28114900 0.67158600 0.68551300 76.18729 -0.77221600 -0.26578700 0.57709600 -61.67996 1940 'point symmetry operation' ? ? -0.21353800 -0.97227300 -0.09531800 67.75907 0.35835900 -0.16872300 0.91821100 -242.49379 -0.90883500 0.16191500 0.38445200 168.34389 1941 'point symmetry operation' ? ? 0.52599700 -0.66500700 0.53018100 -221.55729 0.25620600 0.71832600 0.64681300 146.33541 -0.81097800 -0.20438600 0.54821700 -67.28780 1942 'point symmetry operation' ? ? -0.11663900 -0.97943700 -0.16461700 -45.54111 0.14023700 -0.18033000 0.97355800 -240.44962 -0.98322400 0.09046900 0.15838700 252.88369 1943 'point symmetry operation' ? ? -0.27108400 -0.96247800 -0.01221800 37.55035 0.40775700 -0.12632500 0.90431000 -240.95306 -0.87192200 0.24016200 0.42670200 150.30423 1944 'point symmetry operation' ? ? -0.09461700 -0.98137400 -0.16718600 82.28908 0.07533100 -0.17451600 0.98176900 -185.93735 -0.99266000 0.08029800 0.09044100 279.61807 1945 'point symmetry operation' ? ? 0.50811300 -0.66020300 0.55313000 -285.33032 0.29856900 0.73740500 0.60588000 -29.21110 -0.80788500 -0.14270800 0.57180200 47.08587 1946 'point symmetry operation' ? ? -0.24657900 -0.96814000 -0.04361800 66.87958 0.38589400 -0.13937100 0.91195500 -191.74420 -0.88897900 0.20803700 0.40796600 125.14512 1947 'point symmetry operation' ? ? -0.35009700 -0.92831500 0.12515000 -46.44098 0.46407700 -0.05583900 0.88403300 -300.21817 -0.81367300 0.36757700 0.45035900 186.79005 1948 'point symmetry operation' ? ? -0.31021700 -0.94933900 0.05020400 24.19243 0.43404100 -0.09445300 0.89592800 -190.99005 -0.84579800 0.29972300 0.44135400 114.30736 1949 'point symmetry operation' ? ? -0.15435400 -0.98101500 -0.11740400 -24.06294 0.35517000 -0.16597900 0.91994900 -267.66157 -0.92197000 0.10030000 0.37404700 170.13909 1950 'point symmetry operation' ? ? -0.16984800 -0.97807900 -0.12047100 -16.94430 0.36944900 -0.17652900 0.91233000 -314.44650 -0.91359700 0.11045000 0.39133300 198.56915 1951 'point symmetry operation' ? ? -0.29171400 -0.95622400 0.02321200 4.27196 0.42570700 -0.10806200 0.89838500 -293.49057 -0.85654900 0.27195300 0.43859500 181.00801 1952 'point symmetry operation' ? ? -0.35759800 -0.93096600 0.07365200 159.27041 0.36750400 -0.06778200 0.92754900 -7.73360 -0.85852500 0.35875700 0.36637300 32.77420 1953 'point symmetry operation' ? ? 0.49977000 -0.65343500 0.56855200 -259.35677 0.26962000 0.74115800 0.61480900 118.47602 -0.82312500 -0.15397000 0.54658900 -31.00574 1954 'point symmetry operation' ? ? -0.24536400 -0.96825400 -0.04775100 124.01789 0.34369300 -0.13294100 0.92962500 -120.90069 -0.90646100 0.21168500 0.36540200 100.56461 1955 'point symmetry operation' ? ? -0.33029600 -0.93952700 0.09051500 -14.14397 0.45016400 -0.07251400 0.88999700 -245.38281 -0.82961300 0.33470900 0.44689300 150.04722 1956 'point symmetry operation' ? ? -0.12067200 -0.98091200 -0.15247800 66.08572 0.18895500 -0.17348900 0.96653900 -196.41495 -0.97454300 0.08782300 0.20628400 218.17562 1957 'point symmetry operation' ? ? -0.23127700 -0.96934600 -0.08293600 280.99935 0.31031300 -0.15429400 0.93803000 -3.13501 -0.92207200 0.19120900 0.33648600 38.62302 1958 'point symmetry operation' ? ? -0.13396100 -0.97805300 -0.15958200 131.19276 0.14743100 -0.17891100 0.97275700 -173.09443 -0.97995900 0.10678400 0.16816300 235.69979 1959 'point symmetry operation' ? ? 0.58693800 -0.70907800 0.39078400 -130.96194 0.27032900 0.62660400 0.73095100 88.30906 -0.76316800 -0.32338300 0.55946200 -82.05924 1960 'point symmetry operation' ? ? -0.15946000 -0.97739600 -0.13881300 110.67883 0.26594200 -0.17794400 0.94742300 -174.86623 -0.95070900 0.11416000 0.28830600 168.83570 1961 'point symmetry operation' ? ? 0.53075600 -0.66938800 0.51982400 -253.73635 0.30078400 0.72219100 0.62287200 18.26077 -0.79235600 -0.17423800 0.58464900 0.72708 1962 'point symmetry operation' ? ? -0.13780400 -0.98167400 -0.13162900 222.59564 0.08829400 -0.14454300 0.98555100 -123.19691 -0.98651600 0.12419000 0.10659500 254.81694 1963 'point symmetry operation' ? ? -0.07986000 -0.98098800 -0.17687600 -29.04501 0.02705400 -0.17951100 0.98338400 -226.62482 -0.99643900 0.07374800 0.04087600 314.91425 1964 'point symmetry operation' ? ? -0.08692000 -0.98218800 -0.16658800 144.18993 0.03476800 -0.17010900 0.98481200 -160.17215 -0.99560900 0.07980800 0.04893500 300.55036 1965 'point symmetry operation' ? ? -0.25954600 -0.96557800 -0.01712800 214.21753 0.43606800 -0.13300300 0.89003100 10.91836 -0.86167300 0.22353500 0.45557900 -34.09250 1966 'point symmetry operation' ? ? -0.24804300 -0.96802900 -0.03733200 288.63095 0.29527600 -0.11225000 0.94879500 19.45602 -0.92265200 0.22431800 0.31367900 37.84053 1967 'point symmetry operation' ? ? -0.19239000 -0.97800200 -0.08060500 3.92431 0.37767600 -0.14960700 0.91377200 -335.20800 -0.90573000 0.14535700 0.39815100 217.58686 1968 'point symmetry operation' ? ? 0.54876000 -0.67999600 0.48627900 -222.85571 0.30006200 0.70314300 0.64463400 59.73775 -0.78027200 -0.20783500 0.58989800 -39.02444 1969 'point symmetry operation' ? ? -0.17165100 -0.97913200 -0.10879300 22.83997 0.34722400 -0.16347500 0.92342400 -231.68985 -0.92193900 0.12073100 0.36803900 157.70005 1970 'point symmetry operation' ? ? -0.15772600 -0.98338000 -0.08991900 13.39351 0.36732100 -0.14295200 0.91904300 -283.13852 -0.91662300 0.11192800 0.38376400 188.11577 1971 'point symmetry operation' ? ? -0.20648600 -0.97138000 -0.11740800 85.36337 0.33658900 -0.18319000 0.92366100 -193.27315 -0.91873400 0.15120400 0.36478300 141.49570 1972 'point symmetry operation' ? ? -0.14605200 -0.97873000 -0.14407000 -7.88738 0.21540800 -0.17360000 0.96097000 -224.93565 -0.96554100 0.10931700 0.23618100 207.74150 1973 'point symmetry operation' ? ? -0.12001400 -0.98246500 -0.14268300 176.69401 0.12434900 -0.15746600 0.97966400 -146.17850 -0.98495400 0.09983100 0.14106700 242.73172 1974 'point symmetry operation' ? ? -0.15056400 -0.98040100 -0.12705700 39.33819 0.29202400 -0.16689400 0.94173700 -204.21296 -0.94448500 0.10468800 0.31142900 164.95500 1975 'point symmetry operation' ? ? -0.15115700 -0.97819400 -0.14243400 -3.95697 0.30531200 -0.18324400 0.93445500 -234.27192 -0.94017900 0.09776300 0.32635300 169.39723 1976 'point symmetry operation' ? ? 0.69430000 -0.67528000 0.24888500 29.41344 0.09435600 0.42825100 0.89872000 -14.22070 -0.71347300 -0.60049800 0.36105200 37.13434 1977 'point symmetry operation' ? ? -0.23103900 -0.97073800 -0.06548200 41.19590 0.38696800 -0.15343300 0.90923800 -287.99993 -0.89267900 0.18473000 0.41109400 186.27708 1978 'point symmetry operation' ? ? -0.14657300 -0.97796400 -0.14866500 -63.07780 0.24984100 -0.18201500 0.95102600 -246.83401 -0.95712900 0.10225200 0.27101500 193.24479 1979 'point symmetry operation' ? ? -0.44721400 -0.85065100 0.27639400 0.00000 0.52573200 0.00000000 0.85065100 0.00000 -0.72360600 0.52573200 0.44721400 0.00000 1980 'point symmetry operation' ? ? -0.98231600 -0.18101700 0.04785100 195.30141 0.16135900 -0.68881300 0.70675400 -68.48354 -0.09497400 0.70197500 0.70584000 -105.03964 1981 'point symmetry operation' ? ? -0.95030400 -0.23306300 -0.20640900 301.54858 0.02551600 -0.71908000 0.69446000 -162.56423 -0.31027600 0.65468100 0.68929100 -5.82872 1982 'point symmetry operation' ? ? -0.98103400 -0.17720000 -0.07857100 259.43342 0.06583900 -0.68586200 0.72474800 1.52090 -0.18231300 0.70582900 0.68452000 -119.57600 1983 'point symmetry operation' ? ? -0.98060900 -0.19020300 -0.04722500 233.77853 0.10361400 -0.70771100 0.69886400 -28.80103 -0.16634700 0.68041800 0.71369400 -113.63952 1984 'point symmetry operation' ? ? -0.98596700 -0.07985000 0.14660800 137.77928 0.16239500 -0.66233000 0.73140100 -71.16753 0.03870100 0.74494500 0.66600200 -88.14168 1985 'point symmetry operation' ? ? -0.55845100 -0.66449200 0.49657200 -140.98798 0.56235700 0.13680400 0.81550000 -45.24994 -0.60982500 0.73466700 0.29728300 144.05540 1986 'point symmetry operation' ? ? -0.98434600 -0.16260000 0.06801200 238.83009 0.16440500 -0.70798800 0.68682200 -156.35395 -0.06352500 0.68725100 0.72363700 -101.23205 1987 'point symmetry operation' ? ? -0.60240100 -0.61223300 0.51213700 -178.81081 0.51644900 0.19025700 0.83491500 -11.84034 -0.60859900 0.76744600 0.20157600 207.16158 1988 'point symmetry operation' ? ? -0.95848600 -0.22604400 -0.17380800 272.91505 0.04489600 -0.72158900 0.69086500 -221.29649 -0.28158300 0.65438100 0.70178100 19.63473 1989 'point symmetry operation' ? ? -0.98513500 -0.10021400 0.13952200 211.36029 0.17054300 -0.66793000 0.72442100 -172.86372 0.02059400 0.73744600 0.67509200 -86.63036 1990 'point symmetry operation' ? ? -0.94189700 -0.23737000 -0.23766800 328.74709 0.00533000 -0.71802400 0.69599800 -102.05835 -0.33586000 0.65429100 0.67757000 -32.24932 1991 'point symmetry operation' ? ? -0.61724100 -0.56034400 0.55229500 -53.44008 0.54021000 0.20851600 0.81528900 -191.34547 -0.57200400 0.80158400 0.17399800 212.16722 1992 'point symmetry operation' ? ? -0.98577900 -0.12756700 0.10939400 186.53341 0.16726000 -0.68181300 0.71214900 -115.81358 -0.01626000 0.72031800 0.69345400 -93.23402 1993 'point symmetry operation' ? ? -0.97642800 0.00758100 0.21571200 229.18458 0.16966500 -0.59082500 0.78875900 -270.17917 0.13342800 0.80676400 0.57561100 -40.69426 1994 'point symmetry operation' ? ? -0.98283700 -0.05056600 0.17741500 161.19721 0.16880600 -0.63442200 0.75433000 -140.29436 0.07441300 0.77133100 0.63206900 -66.79560 1995 'point symmetry operation' ? ? -0.97384400 -0.22159400 0.05025800 213.82996 0.19661200 -0.71090700 0.67524600 -230.68681 -0.11390100 0.66746400 0.73587900 -47.21766 1996 'point symmetry operation' ? ? -0.97571300 -0.20868000 0.06661300 254.13227 0.19905700 -0.71771600 0.66727900 -264.35242 -0.09143800 0.66433200 0.74182300 -64.25078 1997 'point symmetry operation' ? ? -0.98356800 -0.07431700 0.16453600 240.59264 0.17294000 -0.64947900 0.74045200 -234.92807 0.05183400 0.75673900 0.65165900 -76.43939 1998 'point symmetry operation' ? ? -0.99387300 0.00187300 0.11052200 88.97167 0.08712700 -0.60204600 0.79369500 87.36027 0.06802600 0.79846000 0.59819300 -104.65794 1999 'point symmetry operation' ? ? -0.62628100 -0.56895500 0.53297700 -152.71186 0.51188600 0.21553000 0.83157700 -56.59710 -0.58800100 0.79362300 0.15625800 236.09280 2000 'point symmetry operation' ? ? -0.98988300 -0.12603500 0.06518300 166.59848 0.13383300 -0.67667800 0.72401500 -24.91484 -0.04714300 0.72541200 0.68669900 -108.32775 2001 'point symmetry operation' ? ? -0.97986300 -0.02149000 0.19851300 193.59165 0.17004800 -0.61090600 0.77322600 -206.83267 0.10465700 0.79141200 0.60225800 -51.66779 2002 'point symmetry operation' ? ? -0.96498800 -0.23074300 -0.12473000 270.68302 0.08194000 -0.71692200 0.69232300 -120.05898 -0.24916900 0.65786200 0.71072700 -53.51070 2003 'point symmetry operation' ? ? -0.98997400 -0.13913200 0.02438000 137.03619 0.11510800 -0.69459500 0.71013400 162.63116 -0.08186700 0.70582000 0.70364500 -187.70857 2004 'point symmetry operation' ? ? -0.96372400 -0.21132300 -0.16303200 303.78294 0.04053500 -0.71962800 0.69317700 -62.92328 -0.26380600 0.66142200 0.70208800 -80.52525 2005 'point symmetry operation' ? ? -0.54130300 -0.71050200 0.44964400 -143.99195 0.56369500 0.09014800 0.82104900 -5.53397 -0.62389000 0.69789800 0.35170900 104.49390 2006 'point symmetry operation' ? ? -0.97794100 -0.20474300 -0.04139900 237.02158 0.12142400 -0.71845900 0.68488900 -76.41446 -0.16996900 0.66475300 0.72747100 -96.51519 2007 'point symmetry operation' ? ? -0.59574100 -0.58787000 0.54726900 -95.95256 0.55531000 0.19080800 0.80945900 -134.36938 -0.58027900 0.78613100 0.21277700 193.53082 2008 'point symmetry operation' ? ? -0.95543500 -0.20609800 -0.21135000 340.83542 -0.00956700 -0.69395200 0.71995800 31.16999 -0.29504800 0.68989400 0.66105400 -111.88288 2009 'point symmetry operation' ? ? -0.92724800 -0.24177600 -0.28593100 330.73120 -0.02505300 -0.72183800 0.69160900 -200.41586 -0.37361000 0.64845600 0.66326500 42.70702 2010 'point symmetry operation' ? ? -0.93108700 -0.23926100 -0.27537600 363.09268 -0.02296200 -0.71493800 0.69881200 -44.82942 -0.36407400 0.65697700 0.66017500 -54.13443 2011 'point symmetry operation' ? ? -0.97923600 -0.11445200 0.16732700 44.14137 0.20023000 -0.67515500 0.70998200 134.74722 0.03171300 0.72874400 0.68405200 -164.51578 2012 'point symmetry operation' ? ? -0.99260600 -0.12009300 0.01765100 133.15906 0.09308800 -0.65980600 0.74564800 185.39345 -0.07790000 0.74177700 0.66610700 -181.70396 2013 'point symmetry operation' ? ? -0.97899500 -0.18450700 0.08675500 284.15006 0.19246300 -0.69589100 0.69187800 -268.88256 -0.06728400 0.69404200 0.71678400 -81.76147 2014 'point symmetry operation' ? ? -0.57823000 -0.61675000 0.53410700 -131.23754 0.56531000 0.16916300 0.80734800 -82.66255 -0.58828200 0.76876800 0.25083900 175.21375 2015 'point symmetry operation' ? ? -0.97798500 -0.20329700 0.04708700 210.21807 0.18001700 -0.70777400 0.68311900 -174.01619 -0.10554900 0.67655500 0.72878800 -67.80836 2016 'point symmetry operation' ? ? -0.97347500 -0.21810200 0.06913100 247.52903 0.20446000 -0.69366700 0.69066800 -221.19157 -0.10268100 0.68648200 0.71986000 -74.41872 2017 'point symmetry operation' ? ? -0.98492600 -0.16805300 0.04099400 208.24724 0.15093800 -0.71916700 0.67824600 -106.18603 -0.08449900 0.67420900 0.73369100 -100.10065 2018 'point symmetry operation' ? ? -0.97307100 -0.21069800 -0.09348400 242.08381 0.08842200 -0.71572900 0.69275900 -186.61306 -0.21287200 0.66583700 0.71508500 -19.64376 2019 'point symmetry operation' ? ? -0.95707900 -0.22477600 -0.18296800 319.45975 0.03005900 -0.70487200 0.70869900 -14.40284 -0.28826700 0.67278000 0.68137400 -96.15495 2020 'point symmetry operation' ? ? -0.97601200 -0.21720600 -0.01496900 215.45350 0.14775300 -0.71128600 0.68719900 -142.08950 -0.15991000 0.66850200 0.72631600 -62.05661 2021 'point symmetry operation' ? ? -0.97586700 -0.21830400 -0.00527000 211.66385 0.15815500 -0.72321600 0.67227000 -191.85600 -0.15057000 0.65521200 0.74028800 -44.54425 2022 'point symmetry operation' ? ? -0.41175300 -0.89399300 0.17674000 47.59400 0.48443600 -0.05045700 0.87337100 5.78399 -0.77186900 0.44523200 0.45385800 -12.15309 2023 'point symmetry operation' ? ? -0.98374900 -0.14565600 0.10499500 257.22137 0.17726300 -0.69471600 0.69710000 -208.78268 -0.02859500 0.70438200 0.70924500 -97.91481 2024 'point symmetry operation' ? ? -0.97478800 -0.21452800 -0.06137600 214.90577 0.11597300 -0.72208700 0.68201300 -236.76936 -0.19062900 0.65769900 0.72876100 2.29664 2025 'point symmetry operation' ? ? -0.94721300 0.16246000 0.27639400 0.00000 0.16246000 -0.50000000 0.85065100 0.00000 0.27639400 0.85065100 0.44721300 0.00000 2026 'point symmetry operation' ? ? -0.48276800 0.74343800 0.46285400 -5.28753 -0.44684900 -0.66366000 0.59990100 59.39095 0.75316800 0.08278800 0.65259800 -224.30041 2027 'point symmetry operation' ? ? -0.62805000 0.69026200 0.35929100 146.62055 -0.53793200 -0.71873800 0.44050500 45.72865 0.56230100 0.08338500 0.82271800 -306.27418 2028 'point symmetry operation' ? ? -0.53531500 0.74749000 0.39331500 -13.48776 -0.52337300 -0.65902900 0.54015000 153.72154 0.66296300 0.08330000 0.74400300 -240.40411 2029 'point symmetry operation' ? ? -0.53081000 0.72580100 0.43755400 -9.48948 -0.49256200 -0.68434800 0.53763500 114.11104 0.68965500 0.06985900 0.72076000 -235.12636 2030 'point symmetry operation' ? ? -0.36479900 0.81151300 0.45647300 -10.27973 -0.44815700 -0.58277000 0.67789000 23.40891 0.81613600 0.04272200 0.57627900 -176.53108 2031 'point symmetry operation' ? ? -0.89531800 0.38072900 0.23119300 89.73166 0.12670700 -0.27990200 0.95163100 -119.47858 0.42702500 0.88130600 0.20236000 142.65405 2032 'point symmetry operation' ? ? -0.45617400 0.74197200 0.49130600 36.96501 -0.44557800 -0.66834800 0.59562700 13.88786 0.77030200 0.05279500 0.63549000 -300.29140 2033 'point symmetry operation' ? ? -0.89805500 0.41490500 0.14611800 123.70885 0.06373300 -0.20594100 0.97648700 -114.68135 0.43524100 0.88625200 0.15850300 215.80929 2034 'point symmetry operation' ? ? -0.61044100 0.69319300 0.38320300 174.47470 -0.52706200 -0.71664200 0.45676000 -18.61708 0.59124300 0.07685300 0.80282400 -305.04453 2035 'point symmetry operation' ? ? -0.38283600 0.79890900 0.46387500 44.42631 -0.44107600 -0.59927100 0.66807700 -15.61516 0.81172000 0.05116000 0.58180200 -282.56370 2036 'point symmetry operation' ? ? -0.64258500 0.68807800 0.33709400 116.92489 -0.54932100 -0.72041600 0.42337600 110.66578 0.53416400 0.08688300 0.84090500 -305.96105 2037 'point symmetry operation' ? ? -0.87693800 0.45941200 0.14114000 220.73130 0.07423400 -0.16066900 0.98421300 -186.21290 0.47483600 0.87357100 0.10679300 32.95746 2038 'point symmetry operation' ? ? -0.41516900 0.77734300 0.47262300 14.54087 -0.44411000 -0.62658000 0.64044000 15.94647 0.79397800 0.05599400 0.60536200 -237.55904 2039 'point symmetry operation' ? ? -0.27853300 0.87964200 0.38555000 117.54254 -0.43666800 -0.47353100 0.76491100 -83.86810 0.85541800 0.04469500 0.51600600 -326.07994 2040 'point symmetry operation' ? ? -0.33341100 0.83837200 0.43124100 35.45651 -0.44113000 -0.54298000 0.71454700 -18.75112 0.83321200 0.04800400 0.55086600 -220.27229 2041 'point symmetry operation' ? ? -0.50589900 0.70369700 0.49887500 95.77131 -0.41334900 -0.70538500 0.57582600 -60.94335 0.75710600 0.08510000 0.64772600 -297.12424 2042 'point symmetry operation' ? ? -0.48712700 0.70735800 0.51220300 103.96747 -0.41247000 -0.70330300 0.57899400 -64.49027 0.76979000 0.07077500 0.63436100 -351.60375 2043 'point symmetry operation' ? ? -0.35495700 0.82068500 0.44775100 80.43233 -0.43821600 -0.56912200 0.69575000 -48.64389 0.82581700 0.05074900 0.56165000 -331.78801 2044 'point symmetry operation' ? ? -0.32164500 0.87309800 0.36639200 -84.38255 -0.51369700 -0.48596400 0.70707500 122.97211 0.79540000 0.03921300 0.60481500 -65.25694 2045 'point symmetry operation' ? ? -0.88707200 0.44733300 0.11400100 170.79340 0.04600600 -0.16005600 0.98603500 -135.54972 0.45933300 0.87992900 0.12140100 186.33234 2046 'point symmetry operation' ? ? -0.43548900 0.78110300 0.44746700 -30.06603 -0.47356500 -0.62152500 0.62405300 77.76759 0.76556200 0.05986400 0.64057100 -182.09586 2047 'point symmetry operation' ? ? -0.30561000 0.86067100 0.40724400 78.19827 -0.43837800 -0.50686400 0.74223600 -53.54073 0.84523900 0.04830800 0.53220100 -271.92898 2048 'point symmetry operation' ? ? -0.59353900 0.69337900 0.40857800 81.63208 -0.50091500 -0.71562800 0.48678600 61.97377 0.62991800 0.08426400 0.77207800 -282.91738 2049 'point symmetry operation' ? ? -0.46165900 0.76355000 0.45151100 -161.06143 -0.48876800 -0.64371800 0.58884000 212.11911 0.74025500 0.05115900 0.67037700 -97.60588 2050 'point symmetry operation' ? ? -0.59528900 0.70430100 0.38676900 54.42623 -0.53367000 -0.70640300 0.46496400 127.65313 0.60069000 0.07038100 0.79637800 -288.91197 2051 'point symmetry operation' ? ? -0.90204600 0.34346000 0.26143500 42.81999 0.13786900 -0.34469100 0.92853700 -89.11340 0.40903000 0.87362700 0.26357400 148.01520 2052 'point symmetry operation' ? ? -0.53776500 0.70935500 0.45565700 19.51624 -0.47658500 -0.70159000 0.52975300 77.49721 0.69546800 0.06772400 0.71535800 -254.84667 2053 'point symmetry operation' ? ? -0.88053000 0.44028700 0.17553900 173.70419 0.09908700 -0.19117400 0.97654200 -165.10651 0.46351700 0.87726900 0.12470700 85.33938 2054 'point symmetry operation' ? ? -0.60706400 0.72490900 0.32554500 15.05101 -0.56933000 -0.68256000 0.45823000 225.55503 0.55438000 0.09283200 0.82707000 -280.27922 2055 'point symmetry operation' ? ? -0.66306300 0.68226700 0.30799100 210.54048 -0.56529100 -0.72609100 0.39145700 32.25918 0.49070800 0.08545700 0.86712300 -325.58484 2056 'point symmetry operation' ? ? -0.65647300 0.68898500 0.30715300 94.73313 -0.56585600 -0.71903000 0.40348800 177.15275 0.49885000 0.09107500 0.86189000 -310.51406 2057 'point symmetry operation' ? ? -0.37856000 0.78787300 0.48574400 -166.59717 -0.41359100 -0.61348500 0.67274000 134.95834 0.82803100 0.05377200 0.55809800 -34.67391 2058 'point symmetry operation' ? ? -0.45327500 0.79345500 0.40616500 -163.07693 -0.50812900 -0.60438300 0.61361700 228.25525 0.73235800 0.07175300 0.67712900 -80.14819 2059 'point symmetry operation' ? ? -0.46497600 0.73694000 0.49062800 100.35681 -0.41973300 -0.67143700 0.61073400 -50.51123 0.77950100 0.07804400 0.62152100 -383.53746 2060 'point symmetry operation' ? ? -0.88398100 0.41999700 0.20537600 130.96274 0.11747000 -0.22566100 0.96709800 -144.01483 0.45252400 0.87902200 0.15014300 129.86404 2061 'point symmetry operation' ? ? -0.49556400 0.71762500 0.48931600 61.15090 -0.42920900 -0.69209500 0.58033100 -17.21890 0.75511400 0.07757300 0.65098800 -273.92561 2062 'point symmetry operation' ? ? -0.49779300 0.71743900 0.48732200 81.13843 -0.40678200 -0.68938500 0.59939700 -33.45373 0.76598300 0.10014200 0.63501300 -328.68186 2063 'point symmetry operation' ? ? -0.47160400 0.73127200 0.49277700 13.72456 -0.45681400 -0.68059700 0.57280800 36.49839 0.75426200 0.04503200 0.65502700 -251.28066 2064 'point symmetry operation' ? ? -0.56570200 0.70745100 0.42366600 119.07104 -0.50042200 -0.70288200 0.50550500 -8.67976 0.65540800 0.07395300 0.75164600 -282.06657 2065 'point symmetry operation' ? ? -0.61201000 0.70571300 0.35694800 33.36420 -0.53823800 -0.70237300 0.46580300 176.12156 0.57943400 0.09295300 0.80970100 -281.73694 2066 'point symmetry operation' ? ? -0.53499200 0.70631200 0.46358000 59.79720 -0.45415000 -0.70311300 0.54715700 11.68763 0.71241300 0.08219000 0.69693100 -258.35690 2067 'point symmetry operation' ? ? -0.52931900 0.69716400 0.48351100 87.17150 -0.44565000 -0.71341000 0.54078000 -30.80179 0.72195400 0.07076900 0.68831300 -273.94670 2068 'point symmetry operation' ? ? -0.96669500 0.08804100 0.24030900 4.82923 0.14989400 -0.56629700 0.81045700 32.65439 0.20743900 0.81948600 0.53423900 -36.83353 2069 'point symmetry operation' ? ? -0.42809600 0.75993600 0.48911200 60.36775 -0.43482400 -0.64765200 0.62568000 -17.71772 0.79225100 0.05517300 0.60769500 -339.67933 2070 'point symmetry operation' ? ? -0.55367100 0.70045800 0.45034000 142.04635 -0.47914200 -0.71027700 0.51568400 -65.23188 0.68108100 0.06974300 0.72887900 -278.95703 2071 'point symmetry operation' ? ? 0.05278600 -0.68819100 -0.72360700 0.00000 0.68819100 -0.50000000 0.52573100 0.00000 -0.72360700 -0.52573100 0.44721400 0.00000 2072 'point symmetry operation' ? ? -0.38152500 -0.16857300 -0.90885800 186.92154 -0.07774400 -0.97389500 0.21327200 51.15618 -0.92108400 0.15202700 0.35846000 127.70779 2073 'point symmetry operation' ? ? -0.13430200 -0.13539000 -0.98164800 208.87151 -0.06603700 -0.98719700 0.14519000 -49.18623 -0.98873800 0.08432500 0.12364200 267.10666 2074 'point symmetry operation' ? ? -0.26171600 -0.17171500 -0.94974700 179.49572 -0.10876700 -0.97252900 0.20580700 132.29122 -0.95899700 0.15716400 0.23585000 178.56832 2075 'point symmetry operation' ? ? -0.29532000 -0.14519000 -0.94430200 183.74081 -0.08648800 -0.98026400 0.17776800 97.89551 -0.95147600 0.13417000 0.27693400 158.27678 2076 'point symmetry operation' ? ? -0.48018300 -0.17863000 -0.85878800 155.46002 -0.14814200 -0.94846600 0.28011600 24.98045 -0.86456800 0.26173000 0.42897500 83.81544 2077 'point symmetry operation' ? ? -0.09132000 -0.85243700 -0.51479400 -128.65207 0.62876300 -0.45023200 0.63399400 -149.40315 -0.77221600 -0.26578700 0.57709600 -61.67996 2078 'point symmetry operation' ? ? -0.40680600 -0.13998400 -0.90272600 251.56402 -0.09234700 -0.97682500 0.19309000 -10.49205 -0.90883500 0.16191500 0.38445200 168.34389 2079 'point symmetry operation' ? ? -0.08112500 -0.88866700 -0.45132000 -207.63821 0.57942500 -0.41048400 0.70410900 -165.49339 -0.81097800 -0.20438600 0.54821700 -67.28780 2080 'point symmetry operation' ? ? -0.16941700 -0.13115900 -0.97677800 214.60823 -0.06759400 -0.98722500 0.14428600 -117.61529 -0.98322400 0.09046900 0.15838700 252.88369 2081 'point symmetry operation' ? ? -0.47156900 -0.17728000 -0.86382600 240.76369 -0.13181200 -0.95440800 0.26782700 -38.74614 -0.87192200 0.24016200 0.42670200 150.30423 2082 'point symmetry operation' ? ? -0.10088300 -0.13728700 -0.98538100 202.26569 -0.06670800 -0.98727100 0.14438000 20.80369 -0.99266000 0.08029800 0.09044100 279.61807 2083 'point symmetry operation' ? ? -0.12694000 -0.90532800 -0.40529900 -60.39049 0.57550700 -0.40001900 0.71328500 -280.39206 -0.80788500 -0.14270800 0.57180200 47.08587 2084 'point symmetry operation' ? ? -0.44320500 -0.16662200 -0.88079900 203.02651 -0.11526300 -0.96382500 0.24032600 4.35400 -0.88897900 0.20803700 0.40796600 125.14512 2085 'point symmetry operation' ? ? -0.54955000 -0.23375900 -0.80209200 271.17342 -0.18955500 -0.90013500 0.39220600 -136.94060 -0.81367300 0.36757700 0.45035900 186.79005 2086 'point symmetry operation' ? ? -0.50866000 -0.20353200 -0.83656400 189.11822 -0.16090800 -0.93206300 0.32460400 -36.01085 -0.84579800 0.29972300 0.44135400 114.30736 2087 'point symmetry operation' ? ? -0.38548500 -0.14529500 -0.91120300 247.12545 -0.03704600 -0.98429100 0.17262200 -105.59727 -0.92197000 0.10030000 0.37404700 170.13909 2088 'point symmetry operation' ? ? -0.40385300 -0.13435400 -0.90490500 293.82035 -0.04736900 -0.98475900 0.16735100 -113.28439 -0.91359700 0.11045000 0.39133300 198.56915 2089 'point symmetry operation' ? ? -0.49501600 -0.19271600 -0.84724200 280.44625 -0.14588500 -0.94281600 0.29969200 -86.63077 -0.85654900 0.27195300 0.43859500 181.00801 2090 'point symmetry operation' ? ? -0.46002100 -0.22322000 -0.85939100 56.57234 -0.22653100 -0.90634800 0.35667600 149.08537 -0.85852500 0.35875700 0.36637300 32.77420 2091 'point symmetry operation' ? ? -0.10198700 -0.90680600 -0.40902500 -192.82302 0.55862700 -0.39242300 0.73071100 -210.05188 -0.82312500 -0.15397000 0.54658900 -31.00574 2092 'point symmetry operation' ? ? -0.40269400 -0.17277200 -0.89888100 153.30703 -0.12714800 -0.96194500 0.24185600 80.58765 -0.90646100 0.21168500 0.36540200 100.56461 2093 'point symmetry operation' ? ? -0.53019900 -0.22136500 -0.81846600 229.00222 -0.17502200 -0.91595200 0.36110900 -89.27924 -0.82961300 0.33470900 0.44689300 150.04722 2094 'point symmetry operation' ? ? -0.21699700 -0.13812100 -0.96635200 207.22335 -0.05637500 -0.98651400 0.15366200 2.15563 -0.97454300 0.08782300 0.20628400 218.17562 2095 'point symmetry operation' ? ? -0.36659400 -0.15280200 -0.91774800 89.81514 -0.12406500 -0.96958300 0.21099100 266.27754 -0.92207200 0.19120900 0.33648600 38.62302 2096 'point symmetry operation' ? ? -0.18161200 -0.13208100 -0.97446000 205.16340 -0.08184500 -0.98547000 0.14882700 71.28256 -0.97995900 0.10678400 0.16816300 235.69979 2097 'point symmetry operation' ? ? -0.07572500 -0.81505300 -0.57441700 -124.45638 0.64174800 -0.48074200 0.59753400 -97.26320 -0.76316800 -0.32338300 0.55946200 -82.05924 2098 'point symmetry operation' ? ? -0.30220200 -0.13279700 -0.94394900 200.50933 -0.06947500 -0.98454700 0.16075100 51.22514 -0.95070900 0.11416000 0.28830600 168.83570 2099 'point symmetry operation' ? ? -0.12205000 -0.89369700 -0.43175200 -95.77585 0.59772600 -0.41345700 0.68686000 -235.67477 -0.79235600 -0.17423800 0.58464900 0.72708 2100 'point symmetry operation' ? ? -0.12655700 -0.16588500 -0.97799100 185.95308 -0.10377400 -0.97829400 0.17936500 173.63106 -0.98651600 0.12419000 0.10659500 254.81694 2101 'point symmetry operation' ? ? -0.05040800 -0.13241700 -0.98991200 206.55766 -0.06759100 -0.98844700 0.13566300 -97.65448 -0.99643900 0.07374800 0.04087600 314.91425 2102 'point symmetry operation' ? ? -0.05992600 -0.14172900 -0.98809000 196.88993 -0.07192200 -0.98668300 0.14588900 87.63679 -0.99560900 0.07980800 0.04893500 300.55036 2103 'point symmetry operation' ? ? -0.49493000 -0.17188700 -0.85176300 55.81286 -0.11209100 -0.95942000 0.25874500 207.10699 -0.86167300 0.22353500 0.45557900 -34.09250 2104 'point symmetry operation' ? ? -0.35747400 -0.19238100 -0.91389400 70.68808 -0.14465700 -0.95533800 0.25768900 280.51664 -0.92265200 0.22431800 0.31367900 37.84053 2105 'point symmetry operation' ? ? -0.41864300 -0.15993500 -0.89395700 320.01446 -0.06626500 -0.97636700 0.20571100 -99.85282 -0.90573000 0.14535700 0.39815100 217.58686 2106 'point symmetry operation' ? ? -0.11580000 -0.87885900 -0.46281500 -125.68017 0.61462600 -0.42943100 0.66168200 -193.48843 -0.78027200 -0.20783500 0.58989800 -39.02444 2107 'point symmetry operation' ? ? -0.38327300 -0.14709500 -0.91184700 227.40810 -0.05595100 -0.98172700 0.18188500 -49.87406 -0.92193900 0.12073100 0.36803900 157.70005 2108 'point symmetry operation' ? ? -0.39808300 -0.16792600 -0.90184900 273.41958 -0.03649800 -0.97942500 0.19848200 -74.75671 -0.91662300 0.11192800 0.38376400 188.11577 2109 'point symmetry operation' ? ? -0.38392300 -0.12594900 -0.91473500 210.19244 -0.09236800 -0.98044600 0.17376500 21.46066 -0.91873400 0.15120400 0.36478300 141.49570 2110 'point symmetry operation' ? ? -0.24999700 -0.13734100 -0.95845700 211.48921 -0.07233900 -0.98447300 0.15993800 -77.01036 -0.96554100 0.10931700 0.23618100 207.74150 2111 'point symmetry operation' ? ? -0.15535000 -0.15384000 -0.97580700 193.62548 -0.07571400 -0.98304000 0.16703400 122.87431 -0.98495400 0.09983100 0.14106700 242.73172 2112 'point symmetry operation' ? ? -0.32425800 -0.14423500 -0.93490800 206.37426 -0.05295400 -0.98399000 0.17017400 -25.69249 -0.94448500 0.10468800 0.31142900 164.95500 2113 'point symmetry operation' ? ? -0.33707900 -0.12800300 -0.93273400 221.58309 -0.04941200 -0.98694400 0.15330000 -76.15738 -0.94017900 0.09776300 0.32635300 169.39723 2114 'point symmetry operation' ? ? 0.12481300 -0.61596400 -0.77782400 22.61395 0.68947700 -0.50989300 0.51442400 23.57940 -0.71347300 -0.60049800 0.36105200 37.13434 2115 'point symmetry operation' ? ? -0.43942400 -0.15405100 -0.88497200 286.63447 -0.10015200 -0.97064000 0.21869300 -49.81731 -0.89267900 0.18473000 0.41109400 186.27708 2116 'point symmetry operation' ? ? -0.28290700 -0.12910100 -0.95041900 215.26101 -0.06219400 -0.98634500 0.15249400 -136.26655 -0.95712900 0.10225200 0.27101500 193.24479 2117 'point symmetry operation' ? ? -0.63819700 -0.26286500 -0.72360600 0.00000 -0.26286500 -0.80901700 0.52573100 0.00000 -0.72360600 0.52573100 0.44721400 0.00000 2118 'point symmetry operation' ? ? -0.45701300 0.59916300 -0.65737500 125.48297 -0.88437400 -0.38501300 0.26390700 164.58008 -0.09497400 0.70197500 0.70584000 -105.03942 2119 'point symmetry operation' ? ? -0.31792700 0.61186500 -0.72425300 247.79108 -0.89590700 -0.44386400 0.01829300 236.55449 -0.31027700 0.65468000 0.68929000 -5.82846 2120 'point symmetry operation' ? ? -0.36577200 0.59753500 -0.71355500 78.72270 -0.91267300 -0.38047000 0.14923300 247.20574 -0.18231400 0.70582800 0.68452000 -119.57571 2121 'point symmetry operation' ? ? -0.40156700 0.61429600 -0.67925200 99.63276 -0.90059500 -0.39958900 0.17104700 213.43652 -0.16634800 0.68041800 0.71369400 -113.63926 2122 'point symmetry operation' ? ? -0.45912700 0.60523800 -0.65029900 110.26032 -0.88752700 -0.28061300 0.36544700 109.04391 0.03870000 0.74494500 0.66600200 -88.14151 2123 'point symmetry operation' ? ? -0.70740400 -0.33544700 -0.62213700 -0.53236 -0.35734000 -0.58969500 0.72427000 -148.07054 -0.60982500 0.73466600 0.29728300 144.05521 2124 'point symmetry operation' ? ? -0.46053700 0.62309100 -0.63218900 222.50369 -0.88536400 -0.37342200 0.27692200 178.82487 -0.06352500 0.68725100 0.72363700 -101.23179 2125 'point symmetry operation' ? ? -0.67732400 -0.37013400 -0.63579200 -43.99461 -0.41332500 -0.52347600 0.74507400 -173.71809 -0.60859900 0.76744600 0.20157700 207.16132 2126 'point symmetry operation' ? ? -0.33888700 0.61642000 -0.71076100 294.80050 -0.89770000 -0.43796300 0.04818700 191.17315 -0.28158300 0.65438100 0.70178100 19.63495 2127 'point symmetry operation' ? ? -0.46661900 0.60427100 -0.64585000 229.71679 -0.88421800 -0.30171200 0.35655000 147.59775 0.02059300 0.73744600 0.67509200 -86.63014 2128 'point symmetry operation' ? ? -0.29613100 0.60953000 -0.73537600 198.65141 -0.89414900 -0.44763400 -0.01096200 281.11913 -0.33586100 0.65429100 0.67756900 -32.24902 2129 'point symmetry operation' ? ? -0.70450700 -0.37146600 -0.60471700 165.46636 -0.42009600 -0.46848400 0.77720100 -109.95359 -0.57200400 0.80158300 0.17399900 212.16707 2130 'point symmetry operation' ? ? -0.46369600 0.60902200 -0.64348800 167.78702 -0.88584500 -0.33201500 0.32410500 141.61544 -0.01626100 0.72031700 0.69345300 -93.23381 2131 'point symmetry operation' ? ? -0.46309300 0.56425000 -0.68349500 327.77720 -0.87620900 -0.17536500 0.44889300 134.47752 0.13342700 0.80676400 0.57561100 -40.69404 2132 'point symmetry operation' ? ? -0.46425700 0.58774500 -0.66258600 183.24030 -0.88256900 -0.24413800 0.40183100 109.95432 0.07441200 0.77133100 0.63206900 -66.79543 2133 'point symmetry operation' ? ? -0.48792200 0.60763600 -0.62666600 285.47294 -0.86542300 -0.43043100 0.25646000 132.07822 -0.11390200 0.66746400 0.73587900 -47.21745 2134 'point symmetry operation' ? ? -0.49082500 0.61810200 -0.61403500 329.94487 -0.86644600 -0.42025300 0.26955200 160.00476 -0.09143900 0.66433200 0.74182300 -64.25053 2135 'point symmetry operation' ? ? -0.46841400 0.59472600 -0.65336700 297.77671 -0.88198700 -0.27138000 0.38529400 156.22043 0.05183400 0.75673900 0.65165900 -76.43914 2136 'point symmetry operation' ? ? -0.38998500 0.57315800 -0.72069500 -55.59079 -0.91830500 -0.18426200 0.35037700 111.61287 0.06802500 0.79845900 0.59819300 -104.65781 2137 'point symmetry operation' ? ? -0.68036300 -0.38079700 -0.62617800 6.63657 -0.43744600 -0.47450600 0.76386100 -162.72713 -0.58800200 0.79362200 0.15625800 236.09254 2138 'point symmetry operation' ? ? -0.43317200 0.60461100 -0.66843500 75.17704 -0.90007700 -0.32897200 0.28572500 150.74544 -0.04714400 0.72541200 0.68669800 -108.32755 2139 'point symmetry operation' ? ? -0.46451900 0.57436500 -0.67403700 256.53235 -0.87935700 -0.20921900 0.42773600 120.20178 0.10465600 0.79141100 0.60225800 -51.66759 2140 'point symmetry operation' ? ? -0.37612600 0.61052900 -0.69698100 197.82825 -0.89243600 -0.44099000 0.09531300 220.33449 -0.24917000 0.65786100 0.71072700 -53.51044 2141 'point symmetry operation' ? ? -0.41539200 0.61760400 -0.66784300 -112.32489 -0.90595100 -0.34696400 0.24263000 180.58493 -0.08186800 0.70581900 0.70364500 -187.70835 2142 'point symmetry operation' ? ? -0.33635700 0.61910400 -0.70962900 153.71743 -0.90402900 -0.42335800 0.05915000 269.47026 -0.26380600 0.66142100 0.70208800 -80.52495 2143 'point symmetry operation' ? ? -0.70337700 -0.30529200 -0.64191600 -39.23273 -0.34061700 -0.64787000 0.68135400 -138.65455 -0.62389100 0.69789700 0.35170900 104.49372 2144 'point symmetry operation' ? ? -0.41768100 0.62002600 -0.66416100 145.91794 -0.89255400 -0.41673800 0.17226900 201.80749 -0.16996900 0.66475300 0.72747000 -96.51494 2145 'point symmetry operation' ? ? -0.71222500 -0.36313000 -0.60072600 98.14188 -0.39498300 -0.50013500 0.77061900 -132.77876 -0.58027900 0.78613000 0.21277800 193.53064 2146 'point symmetry operation' ? ? -0.28614700 0.59630000 -0.75003100 75.67932 -0.91162800 -0.41045400 0.02147300 333.78564 -0.29504900 0.68989400 0.66105400 -111.88253 2147 'point symmetry operation' ? ? -0.26270900 0.61179500 -0.74611600 292.80801 -0.88960600 -0.45300300 -0.05821800 252.61198 -0.37361000 0.64845500 0.66326500 42.70728 2148 'point symmetry operation' ? ? -0.26588300 0.60601000 -0.74970500 154.83686 -0.89261100 -0.44847900 -0.04595400 331.46842 -0.36407500 0.65697700 0.66017400 -54.13410 2149 'point symmetry operation' ? ? -0.49303000 0.60674300 -0.62352600 -114.51173 -0.86943400 -0.31748500 0.37853300 83.62016 0.03171200 0.72874300 0.68405200 -164.51566 2150 'point symmetry operation' ? ? -0.39526400 0.59040200 -0.70369800 -135.17118 -0.91525800 -0.31810700 0.24720500 183.93148 -0.07790100 0.74177700 0.66610600 -181.70375 2151 'point symmetry operation' ? ? -0.48556900 0.60481500 -0.63120600 343.52928 -0.87160500 -0.39051800 0.29631000 187.15347 -0.06728500 0.69404100 0.71678300 -81.76118 2152 'point symmetry operation' ? ? -0.71632300 -0.35146900 -0.60278500 38.06217 -0.37523800 -0.53429000 0.75744900 -150.35846 -0.58828200 0.76876700 0.25084000 175.21355 2153 'point symmetry operation' ? ? -0.47341900 0.61031100 -0.63513300 230.45989 -0.87449000 -0.41206100 0.25587600 146.15529 -0.10554900 0.67655500 0.72878800 -67.80814 2154 'point symmetry operation' ? ? -0.49527300 0.59231900 -0.63550100 286.85600 -0.86264700 -0.42178200 0.27917500 167.06213 -0.10268200 0.68648200 0.71986000 -74.41847 2155 'point symmetry operation' ? ? -0.44790800 0.63203700 -0.63238200 165.34061 -0.89007700 -0.38206300 0.24857700 165.24159 -0.08450000 0.67420900 0.73369000 -100.10042 2156 'point symmetry operation' ? ? -0.38478900 0.61558900 -0.68774000 252.28726 -0.89812100 -0.42155800 0.12516500 172.56871 -0.21287200 0.66583700 0.71508500 -19.64354 2157 'point symmetry operation' ? ? -0.32434100 0.60091300 -0.73055200 112.41618 -0.90094600 -0.43159200 0.04498600 299.37341 -0.28826700 0.67277900 0.68137300 -96.15463 2158 'point symmetry operation' ? ? -0.44212500 0.60935200 -0.65819000 201.71366 -0.88258300 -0.42637500 0.19811900 161.00034 -0.15991100 0.66850100 0.72631500 -62.05639 2159 'point symmetry operation' ? ? -0.45197300 0.62036000 -0.64099400 247.87332 -0.87923100 -0.43110600 0.20273000 142.01749 -0.15057000 0.65521100 0.74028800 -44.54404 2160 'point symmetry operation' ? ? -0.58796400 -0.22827100 -0.77600900 9.20643 -0.24190000 -0.86583000 0.43797500 47.05191 -0.77186900 0.44523100 0.45385800 -12.15305 2161 'point symmetry operation' ? ? -0.47258100 0.61570400 -0.63053500 278.04954 -0.88082300 -0.35320700 0.31527100 180.11465 -0.02859500 0.70438100 0.70924500 -97.91454 2162 'point symmetry operation' ? ? -0.41152200 0.62045200 -0.66759800 291.59024 -0.89124000 -0.42716600 0.15238100 131.22173 -0.19063000 0.65769900 0.72876000 2.29682 2163 'point symmetry operation' ? ? -0.44721400 0.52573200 -0.72360600 0.00000 -0.85065100 0.00000000 0.52573200 0.00000 0.27639400 0.85065100 0.44721400 0.00000 2164 'point symmetry operation' ? ? 0.27579500 0.86091400 -0.42750900 -58.11829 -0.59722400 0.50197000 0.62558000 13.32414 0.75316800 0.08278700 0.65259900 -224.30046 2165 'point symmetry operation' ? ? 0.31752500 0.89686400 -0.30791700 1.81754 -0.76354200 0.43437600 0.47783000 153.57556 0.56230100 0.08338500 0.82271900 -306.27424 2166 'point symmetry operation' ? ? 0.33233600 0.85776100 -0.39217200 -150.36603 -0.67084600 0.50725500 0.54098000 34.67501 0.66296300 0.08330000 0.74400400 -240.40409 2167 'point symmetry operation' ? ? 0.30442500 0.87513900 -0.37610800 -111.45866 -0.65704100 0.47880300 0.58227700 26.23729 0.68965500 0.06985900 0.72076100 -235.12638 2168 'point symmetry operation' ? ? 0.31349400 0.80501900 -0.50365200 -25.43998 -0.48543400 0.59170900 0.64361200 -2.54281 0.81613600 0.04272200 0.57628000 -176.53114 2169 'point symmetry operation' ? ? -0.39717400 0.38385500 -0.83361100 141.35967 -0.81234400 0.27560100 0.51394800 48.41899 0.42702500 0.88130600 0.20236100 142.65404 2170 'point symmetry operation' ? ? 0.28280400 0.86491900 -0.41465200 -1.78557 -0.57153900 0.49912700 0.65131900 39.44752 0.77030200 0.05279500 0.63549100 -300.29152 2171 'point symmetry operation' ? ? -0.33812900 0.32407500 -0.88354100 147.29686 -0.83440700 0.33095900 0.44071800 82.21565 0.43524100 0.88625200 0.15850300 215.80932 2172 'point symmetry operation' ? ? 0.31262900 0.89577600 -0.31598700 71.62139 -0.74343600 0.43781200 0.50559400 160.18253 0.59124200 0.07685300 0.80282400 -305.04464 2173 'point symmetry operation' ? ? 0.30118500 0.81681800 -0.49203300 28.57915 -0.50039900 0.57462400 0.64761800 37.42671 0.81172000 0.05116000 0.58180300 -282.56383 2174 'point symmetry operation' ? ? 0.32386500 0.89778500 -0.29848600 -69.11781 -0.78088500 0.43178100 0.45142600 145.39997 0.53416400 0.08688200 0.84090500 -305.96106 2175 'point symmetry operation' ? ? -0.34158900 0.29477300 -0.89242700 245.30888 -0.81107900 0.38727700 0.43837100 152.38514 0.47483600 0.87357100 0.10679400 32.95737 2176 'point symmetry operation' ? ? 0.29408000 0.83612600 -0.46304500 -10.67283 -0.53208700 0.54567300 0.64739900 18.75700 0.79397800 0.05599400 0.60536300 -237.55913 2177 'point symmetry operation' ? ? 0.32922600 0.72218000 -0.60833100 116.08572 -0.39983900 0.69026100 0.60305100 85.87312 0.85541800 0.04469500 0.51600700 -326.08013 2178 'point symmetry operation' ? ? 0.31651000 0.77547600 -0.54631300 28.78986 -0.45340900 0.62955000 0.63094200 27.92682 0.83321200 0.04800400 0.55086700 -220.27239 2179 'point symmetry operation' ? ? 0.23678700 0.88831600 -0.39348100 87.55532 -0.60887100 0.45128000 0.65239800 72.25156 0.75710600 0.08510000 0.64772600 -297.12440 2180 'point symmetry operation' ? ? 0.24175200 0.88746700 -0.39237600 93.46136 -0.59074600 0.45540500 0.66605300 78.95054 0.76979000 0.07077500 0.63436200 -351.60393 2181 'point symmetry operation' ? ? 0.30708100 0.79487300 -0.52333400 71.11779 -0.47300000 0.60465000 0.64083600 61.46406 0.82581700 0.05074900 0.56165100 -331.78818 2182 'point symmetry operation' ? ? 0.38916100 0.73198200 -0.55924600 -143.02918 -0.46464400 0.68019500 0.56695800 -42.25215 0.79540000 0.03921300 0.60481600 -65.25689 2183 'point symmetry operation' ? ? -0.31787500 0.29045700 -0.90254700 181.69379 -0.82944000 0.37597900 0.41312300 120.54708 0.45933300 0.87993000 0.12140200 186.33236 2184 'point symmetry operation' ? ? 0.31581400 0.83248000 -0.45523400 -83.25247 -0.56051500 0.55081200 0.61840900 -4.56295 0.76556200 0.05986400 0.64057200 -182.09589 2185 'point symmetry operation' ? ? 0.32248400 0.74801900 -0.58006200 75.08466 -0.42611900 0.66191700 0.61667600 57.82612 0.84523800 0.04830800 0.53220200 -271.92912 2186 'point symmetry operation' ? ? 0.29298500 0.89487000 -0.33670200 -33.71505 -0.71928100 0.43830200 0.53900600 96.78782 0.62991700 0.08426300 0.77207800 -282.91743 2187 'point symmetry operation' ? ? 0.32218600 0.84816300 -0.42049500 -251.50816 -0.59010200 0.52726000 0.61137400 -87.63021 0.74025500 0.05115900 0.67037800 -97.60579 2188 'point symmetry operation' ? ? 0.32359600 0.88947100 -0.32268800 -104.58692 -0.73106700 0.45154000 0.51152100 91.20954 0.60068900 0.07038100 0.79637900 -288.91198 2189 'point symmetry operation' ? ? -0.40986900 0.43395700 -0.80230200 97.98414 -0.81529300 0.22013400 0.53557300 13.18667 0.40903000 0.87362700 0.26357500 148.01521 2190 'point symmetry operation' ? ? 0.28708100 0.88645500 -0.36301800 -67.67358 -0.65871900 0.45783400 0.59705900 42.50910 0.69546800 0.06772300 0.71535900 -254.84671 2191 'point symmetry operation' ? ? -0.36633700 0.31787400 -0.87450200 210.70336 -0.80681500 0.35966200 0.46871600 114.18189 0.46351700 0.87726900 0.12470800 85.33932 2192 'point symmetry operation' ? ? 0.35387200 0.87316300 -0.33520300 -209.86478 -0.75328600 0.47850700 0.45121300 84.01480 0.55437900 0.09283200 0.82707100 -280.27915 2193 'point symmetry operation' ? ? 0.33272500 0.90138600 -0.27712300 34.38015 -0.80529600 0.42450100 0.41388400 210.20479 0.49070800 0.08545600 0.86712400 -325.58490 2194 'point symmetry operation' ? ? 0.33530000 0.89674700 -0.28882400 -139.20832 -0.79920300 0.43307100 0.41680400 144.83994 0.49884900 0.09107500 0.86189100 -310.51402 2195 'point symmetry operation' ? ? 0.27636800 0.82692500 -0.48971000 -179.83450 -0.48783900 0.55973500 0.66985900 -116.73902 0.82803100 0.05377200 0.55809900 -34.67386 2196 'point symmetry operation' ? ? 0.34319000 0.81999400 -0.45807200 -267.47735 -0.58811100 0.56785700 0.57590400 -84.56073 0.73235700 0.07175200 0.67713000 -80.14808 2197 'point symmetry operation' ? ? 0.25550500 0.86630200 -0.42922900 79.05071 -0.57192400 0.49338700 0.65534200 79.83637 0.77950100 0.07804400 0.62152200 -383.53765 2198 'point symmetry operation' ? ? -0.38488600 0.34440400 -0.85630000 177.43615 -0.80441700 0.32970800 0.49417400 80.05000 0.45252400 0.87902200 0.15014400 129.86402 2199 'point symmetry operation' ? ? 0.25506400 0.87998100 -0.40072000 35.27261 -0.60394300 0.46863300 0.64469900 52.83716 0.75511400 0.07757300 0.65098900 -273.92574 2200 'point symmetry operation' ? ? 0.23304700 0.87734600 -0.41946800 56.88929 -0.59913300 0.46929400 0.64869400 66.82963 0.76598300 0.10014200 0.63501400 -328.68201 2201 'point symmetry operation' ? ? 0.28872200 0.87326200 -0.39249600 -30.47112 -0.58968600 0.48516600 0.64566700 24.33155 0.75426200 0.04503100 0.65502800 -251.28074 2202 'point symmetry operation' ? ? 0.30111800 0.88709500 -0.34984300 45.04974 -0.69265400 0.45562400 0.55914000 110.56127 0.65540800 0.07395300 0.75164700 -282.06667 2203 'point symmetry operation' ? ? 0.32277400 0.88607400 -0.33270100 -157.19167 -0.74838100 0.45412900 0.48341900 86.15591 0.57943400 0.09295200 0.80970200 -281.73690 2204 'point symmetry operation' ? ? 0.26660100 0.88696300 -0.37712200 7.36257 -0.64914900 0.45446900 0.60997100 60.48232 0.71241200 0.08219000 0.69693200 -258.35699 2205 'point symmetry operation' ? ? 0.26027000 0.89392900 -0.36489800 56.23153 -0.64112700 0.44258700 0.62695600 73.38690 0.72195400 0.07076800 0.68831400 -273.94683 2206 'point symmetry operation' ? ? -0.44128400 0.56578700 -0.69653000 -29.56388 -0.87306300 -0.09126400 0.47899200 14.68365 0.20743900 0.81948600 0.53424000 -36.83352 2207 'point symmetry operation' ? ? 0.28125400 0.85078700 -0.44391200 35.50495 -0.54151200 0.52260700 0.65851900 51.93822 0.79225100 0.05517300 0.60769600 -339.67948 2208 'point symmetry operation' ? ? 0.28459700 0.89196800 -0.35128100 105.93378 -0.67463600 0.44668800 0.58765400 114.93654 0.68108100 0.06974200 0.72888000 -278.95717 2209 'point symmetry operation' ? ? 0.36180300 0.58778500 -0.72360700 0.00000 -0.26286500 0.80901700 0.52573100 0.00000 0.89442700 0.00000000 0.44721400 0.00000 2210 'point symmetry operation' ? ? 0.80418300 0.25494900 -0.53692700 -110.15138 0.38687600 0.46127200 0.79847000 -193.58107 0.45123900 -0.84984000 0.27231400 -65.26048 2211 'point symmetry operation' ? ? 0.89388100 0.32574800 -0.30800200 -189.12184 0.14813600 0.43382400 0.88873600 -183.44924 0.42312200 -0.84005100 0.33953300 -219.02466 2212 'point symmetry operation' ? ? 0.86784500 0.24933900 -0.42973700 -191.17742 0.28251800 0.46383900 0.83966500 -211.59081 0.40869000 -0.85010800 0.33209800 -16.93593 2213 'point symmetry operation' ? ? 0.84699900 0.27686200 -0.45380600 -157.81209 0.30759200 0.44100200 0.84315100 -204.99927 0.43356500 -0.85373600 0.28836900 -38.29335 2214 'point symmetry operation' ? ? 0.76994200 0.14462300 -0.62150900 -64.10754 0.50246000 0.46297900 0.73019400 -155.57063 0.39334800 -0.87449100 0.28380100 -59.20189 2215 'point symmetry operation' ? ? 0.41064200 0.31141800 -0.85696700 100.93391 -0.10744700 0.94984500 0.29368300 168.52349 0.90544300 -0.02851900 0.42350800 -63.94721 2216 'point symmetry operation' ? ? 0.79594500 0.25130300 -0.55074400 -111.34344 0.41543300 0.43498800 0.79887400 -236.00936 0.44032600 -0.86465700 0.24182800 -153.74136 2217 'point symmetry operation' ? ? 0.46770500 0.23458700 -0.85218600 101.87770 -0.10189800 0.97201900 0.21164900 248.61590 0.87799100 -0.01215300 0.47852300 -53.29521 2218 'point symmetry operation' ? ? 0.88475800 0.32084800 -0.33802100 -146.50300 0.18201300 0.42980900 0.88438400 -167.75944 0.42903700 -0.84399100 0.32187900 -272.45879 2219 'point symmetry operation' ? ? 0.77076400 0.16662800 -0.61494500 -84.68367 0.48922100 0.46353100 0.73878400 -217.00663 0.40814800 -0.87027200 0.27575700 -166.72301 2220 'point symmetry operation' ? ? 0.90229200 0.32911800 -0.27847800 -230.99378 0.11655900 0.43565100 0.89253700 -198.79482 0.41506900 -0.83778800 0.35472400 -163.25713 2221 'point symmetry operation' ? ? 0.46027300 0.17266700 -0.87082400 68.79731 -0.05711400 0.98463100 0.16504500 144.08066 0.88593800 -0.02622900 0.46306200 -242.88160 2222 'point symmetry operation' ? ? 0.78290200 0.20083900 -0.58883600 -85.72743 0.45713100 0.45630500 0.76342500 -194.43512 0.42201400 -0.86686200 0.26543300 -108.37804 2223 'point symmetry operation' ? ? 0.73244800 0.02177500 -0.68047500 -71.35042 0.58122900 0.50047500 0.64163600 -215.58425 0.35453300 -0.86547600 0.35391700 -274.97421 2224 'point symmetry operation' ? ? 0.75464700 0.10022300 -0.64843100 -60.78773 0.53348800 0.48159300 0.69531100 -168.73412 0.38196600 -0.87064500 0.30996600 -134.02348 2225 'point symmetry operation' ? ? 0.78711900 0.30885400 -0.53390300 -73.11183 0.37806600 0.44234600 0.81326200 -202.39889 0.48734900 -0.84198500 0.23141300 -234.21874 2226 'point symmetry operation' ? ? 0.78148200 0.30148700 -0.54625200 -88.81783 0.39872500 0.43208500 0.80890100 -244.43292 0.47990000 -0.84994600 0.21745800 -266.37826 2227 'point symmetry operation' ? ? 0.75976000 0.13112900 -0.63684400 -86.29540 0.51587000 0.47463000 0.71316500 -239.94982 0.39578200 -0.87036300 0.29296000 -232.15526 2228 'point symmetry operation' ? ? 0.80066300 0.03376200 -0.59816200 -84.90584 0.50750800 0.49237200 0.70711100 -99.87341 0.31839200 -0.86973000 0.37709000 96.52631 2229 'point symmetry operation' ? ? 0.48453200 0.17930500 -0.85620000 90.42532 -0.07563000 0.98368900 0.16320400 248.29516 0.87149800 -0.01432200 0.49019100 -111.51957 2230 'point symmetry operation' ? ? 0.80919100 0.19592700 -0.55391500 -103.03715 0.42227600 0.46157400 0.78014900 -170.70659 0.40852400 -0.86519500 0.29076700 -18.79495 2231 'point symmetry operation' ? ? 0.74319700 0.05961300 -0.66641100 -64.58617 0.55833400 0.49357500 0.66681900 -190.20522 0.36867500 -0.86765800 0.33354100 -206.34330 2232 'point symmetry operation' ? ? 0.86564700 0.32195100 -0.38340900 -167.42139 0.22379800 0.43621000 0.87157000 -197.74724 0.44784900 -0.84027900 0.30555300 -153.01252 2233 'point symmetry operation' ? ? 0.82683200 0.22024900 -0.51753100 -135.38797 0.38699000 0.44494100 0.80763000 -167.70355 0.40815100 -0.86805400 0.28265800 184.41216 2234 'point symmetry operation' ? ? 0.88621400 0.30538200 -0.34837600 -212.78160 0.19801500 0.43014300 0.88077600 -217.14952 0.41882500 -0.84954000 0.32073000 -101.47732 2235 'point symmetry operation' ? ? 0.39918200 0.38107600 -0.83392700 97.56506 -0.12629200 0.92371900 0.36165400 148.42102 0.90813200 -0.03904700 0.41685900 -11.64010 2236 'point symmetry operation' ? ? 0.83812600 0.29829300 -0.45669100 -145.08882 0.30888000 0.43053900 0.84807300 -206.52513 0.44959800 -0.85185500 0.26871000 -87.35033 2237 'point symmetry operation' ? ? 0.43760900 0.20819100 -0.87473100 86.35231 -0.06863100 0.97772100 0.19836900 163.91574 0.89654200 -0.02677400 0.44214900 -174.33026 2238 'point symmetry operation' ? ? 0.90901500 0.28209000 -0.30678500 -276.06673 0.15243100 0.46007500 0.87469700 -230.50686 0.38788700 -0.84187700 0.37521700 -17.65431 2239 'point symmetry operation' ? ? 0.91302400 0.33615000 -0.23106400 -211.58720 0.06882800 0.43138300 0.89953900 -166.27114 0.40205700 -0.83720500 0.37072700 -280.99486 2240 'point symmetry operation' ? ? 0.91280800 0.32869300 -0.24237000 -278.88492 0.07921800 0.43969400 0.89464700 -214.33474 0.40063200 -0.83584100 0.37531900 -114.28087 2241 'point symmetry operation' ? ? 0.74998100 0.18437600 -0.63524300 -49.88152 0.50534400 0.45995100 0.73011700 -117.08075 0.42679700 -0.86859100 0.25178300 175.99602 2242 'point symmetry operation' ? ? 0.83736900 0.17910700 -0.51646200 -143.38764 0.38468000 0.47818100 0.78953400 -153.91277 0.38837300 -0.85980400 0.33151600 202.16119 2243 'point symmetry operation' ? ? 0.78043900 0.26316000 -0.56715300 -107.92063 0.41863000 0.45382100 0.78663500 -273.49559 0.46439600 -0.85134800 0.24401400 -270.69754 2244 'point symmetry operation' ? ? 0.42047700 0.24708600 -0.87301100 99.83151 -0.07979700 0.96854600 0.23569200 179.32014 0.90378700 -0.02943900 0.42696900 -112.40164 2245 'point symmetry operation' ? ? 0.79543800 0.28924000 -0.53255900 -88.41139 0.38180400 0.44326500 0.81101200 -200.86600 0.47064200 -0.84844300 0.24215800 -175.80509 2246 'point symmetry operation' ? ? 0.78036200 0.29325600 -0.55230000 -98.67418 0.38987800 0.46236600 0.79637400 -236.93635 0.48890600 -0.83679000 0.24648000 -223.29113 2247 'point symmetry operation' ? ? 0.80796900 0.26436200 -0.52659100 -106.63743 0.39367600 0.42275900 0.81626800 -206.53658 0.43841100 -0.86682600 0.23750500 -103.11906 2248 'point symmetry operation' ? ? 0.85982400 0.30196500 -0.41172700 -123.82798 0.26011600 0.43483800 0.86212300 -177.34067 0.43936500 -0.84837100 0.29533900 -216.86792 2249 'point symmetry operation' ? ? 0.89170300 0.30756100 -0.33207100 -242.60894 0.17114300 0.45008600 0.87643100 -222.11905 0.41901600 -0.83834900 0.34870700 -57.54652 2250 'point symmetry operation' ? ? 0.82248500 0.30494800 -0.48013100 -108.09226 0.32475200 0.44124500 0.83656300 -188.33415 0.46696300 -0.84398400 0.26388600 -152.66591 2251 'point symmetry operation' ? ? 0.81535400 0.31464100 -0.48600200 -88.49970 0.33585100 0.42672000 0.83971100 -187.20409 0.47159400 -0.84788600 0.24225700 -201.78415 2252 'point symmetry operation' ? ? 0.36214600 0.66884800 -0.64922400 -40.11770 -0.33176400 0.74338200 0.58078900 -28.79358 0.87108100 0.00505900 0.49111300 -2.79948 2253 'point symmetry operation' ? ? 0.78030600 0.22632100 -0.58301000 -105.81072 0.44886600 0.44645500 0.77407800 -257.21115 0.43547800 -0.86571100 0.24678500 -204.90664 2254 'point symmetry operation' ? ? 0.84343800 0.31021900 -0.43860700 -85.13731 0.28828000 0.42758000 0.85677900 -162.61669 0.45332900 -0.84908100 0.27120800 -261.83363 2255 'point symmetry operation' ? ? 0.67082000 -0.16246000 -0.72360700 0.00000 0.68819100 0.50000000 0.52573100 0.00000 0.27639300 -0.85065100 0.44721400 0.00000 2256 'point symmetry operation' ? ? 0.39793700 -0.38130800 -0.83441600 41.29139 0.70793200 -0.45086200 0.54365000 -170.19958 -0.58350500 -0.80704900 0.09052600 152.29259 2257 'point symmetry operation' ? ? 0.61463600 -0.31222000 -0.72439000 -61.15566 0.57921700 -0.44475700 0.68315400 -308.76281 -0.53547200 -0.83947000 -0.09252000 135.34413 2258 'point symmetry operation' ? ? 0.50070100 -0.38691200 -0.77433700 12.68817 0.62990100 -0.45071800 0.63251700 -151.26064 -0.59373600 -0.80445800 0.01804200 242.00328 2259 'point symmetry operation' ? ? 0.47633700 -0.35373600 -0.80496800 24.63104 0.66021200 -0.46075100 0.59315100 -160.71203 -0.58070900 -0.81399000 0.01406900 204.84319 2260 'point symmetry operation' ? ? 0.27942400 -0.46330600 -0.84099300 47.69465 0.71091700 -0.48890100 0.50554300 -138.56033 -0.64538400 -0.73913700 0.19276200 101.70115 2261 'point symmetry operation' ? ? 0.59967000 -0.45265200 -0.65992600 -65.94241 0.78320500 0.50125500 0.36787600 46.26272 0.16427200 -0.73746200 0.65510700 -190.23263 2262 'point symmetry operation' ? ? 0.36974200 -0.36976200 -0.85238900 45.23497 0.71158900 -0.47720000 0.51567500 -266.87370 -0.59743700 -0.79721800 0.08667800 135.89121 2263 'point symmetry operation' ? ? 0.62654200 -0.51492800 -0.58505800 -117.48404 0.77189800 0.51378200 0.37443400 95.52337 0.10778600 -0.68620400 0.71937900 -228.25894 2264 'point symmetry operation' ? ? 0.58683800 -0.31383200 -0.74641200 -58.13249 0.59970500 -0.45091200 0.66108400 -339.44783 -0.54403600 -0.83557600 -0.07640500 72.35976 2265 'point symmetry operation' ? ? 0.29317600 -0.44775800 -0.84472500 46.45335 0.71702000 -0.48146200 0.50406000 -264.08404 -0.63240000 -0.75346300 0.17989900 100.80412 2266 'point symmetry operation' ? ? 0.63978300 -0.31059100 -0.70300100 -63.26977 0.55794500 -0.44137100 0.70277300 -275.79944 -0.52855900 -0.84185800 -0.10908900 198.65061 2267 'point symmetry operation' ? ? 0.59293300 -0.56903500 -0.56976200 -120.13524 0.79984300 0.49805500 0.33495200 -123.39026 0.09317300 -0.65432400 0.75045300 -234.14987 2268 'point symmetry operation' ? ? 0.32723500 -0.41889300 -0.84702200 46.34582 0.71474200 -0.47661600 0.51184100 -203.33667 -0.61811100 -0.77289400 0.14343500 115.78550 2269 'point symmetry operation' ? ? 0.18933500 -0.56902700 -0.80022500 24.49878 0.71119100 -0.48244300 0.51132800 -353.29067 -0.67702300 -0.66592500 0.31334400 41.99690 2270 'point symmetry operation' ? ? 0.24466400 -0.50483700 -0.82781600 38.30047 0.71426400 -0.48353600 0.50598500 -208.24978 -0.65571900 -0.71507500 0.24228300 72.75814 2271 'point symmetry operation' ? ? 0.40253400 -0.32995200 -0.85387200 25.50769 0.73147200 -0.44488500 0.51674500 -312.31549 -0.55037700 -0.83259200 0.06227000 54.56590 2272 'point symmetry operation' ? ? 0.38247700 -0.33003300 -0.86301200 35.01055 0.73454900 -0.45798500 0.50068700 -363.24062 -0.56049000 -0.82542600 0.06725800 73.64731 2273 'point symmetry operation' ? ? 0.26403700 -0.47923400 -0.83703000 43.07643 0.71803800 -0.48175600 0.50232700 -331.47745 -0.64397700 -0.73365200 0.21690700 84.77015 2274 'point symmetry operation' ? ? 0.27584000 -0.55658500 -0.78366200 38.45463 0.65467000 -0.48816500 0.57715000 18.37966 -0.70379000 -0.67224100 0.22972400 157.11292 2275 'point symmetry operation' ? ? 0.61795800 -0.56064300 -0.55118600 -141.03862 0.78224200 0.50879100 0.35948500 43.97386 0.07889600 -0.65330800 0.75297100 -245.84201 2276 'point symmetry operation' ? ? 0.36512900 -0.42535300 -0.82810300 43.16451 0.69011100 -0.47336100 0.54742700 -118.08063 -0.62484200 -0.77136500 0.12070300 155.89886 2277 'point symmetry operation' ? ? 0.21621100 -0.53949900 -0.81375300 30.53989 0.71352000 -0.48160100 0.50887000 -281.12132 -0.66644000 -0.69065200 0.28081600 54.45235 2278 'point symmetry operation' ? ? 0.55046100 -0.31647200 -0.77255300 -18.51347 0.63349500 -0.44437400 0.63341500 -256.23309 -0.54376100 -0.83807900 -0.04412700 156.67997 2279 'point symmetry operation' ? ? 0.40114300 -0.39838100 -0.82484900 75.56134 0.67501600 -0.48015800 0.56018000 51.02342 -0.61922400 -0.78149900 0.07630100 268.60632 2280 'point symmetry operation' ? ? 0.57397900 -0.32597100 -0.75119300 -21.34558 0.59925500 -0.45797800 0.65662000 -229.46500 -0.55806900 -0.82704200 -0.06752900 222.75056 2281 'point symmetry operation' ? ? 0.60569400 -0.39085300 -0.69308600 -39.91062 0.77420800 0.49055400 0.39994900 80.15926 0.18367400 -0.77884000 0.59972800 -153.83396 2282 'point symmetry operation' ? ? 0.47392900 -0.33163900 -0.81572500 20.65713 0.67305300 -0.46090100 0.57842100 -201.13830 -0.56779500 -0.82315600 0.00477700 174.49979 2283 'point symmetry operation' ? ? 0.58858700 -0.54060000 -0.60109600 -103.06217 0.79942200 0.49990800 0.33319000 -52.30749 0.12037000 -0.67664100 0.72640800 -226.62363 2284 'point symmetry operation' ? ? 0.61209400 -0.36007700 -0.70404900 -31.43803 0.55385000 -0.44027700 0.70668700 -175.12088 -0.56443900 -0.82249700 -0.07006200 313.05328 2285 'point symmetry operation' ? ? 0.67623400 -0.30277500 -0.67159100 -105.17586 0.52475400 -0.44186600 0.72759000 -356.53848 -0.51705000 -0.84444200 -0.13992200 114.85525 2286 'point symmetry operation' ? ? 0.66854500 -0.31312100 -0.67453900 -71.16498 0.52870200 -0.43776200 0.72721300 -249.68811 -0.52299400 -0.84280500 -0.12711600 263.37765 2287 'point symmetry operation' ? ? 0.27329300 -0.43292400 -0.85900400 95.75651 0.73756900 -0.47893800 0.47603600 83.06701 -0.61749700 -0.76367200 0.18842200 176.35544 2288 'point symmetry operation' ? ? 0.40433500 -0.44657500 -0.79817500 65.61002 0.65874900 -0.46320500 0.59286700 71.71741 -0.63447900 -0.76551400 0.10689100 275.08230 2289 'point symmetry operation' ? ? 0.36379300 -0.37108900 -0.85436900 41.00284 0.73114400 -0.45453600 0.50874800 -384.54959 -0.57713400 -0.80974600 0.10596300 100.81775 2290 'point symmetry operation' ? ? 0.58678100 -0.50893100 -0.62982300 -87.50456 0.79721900 0.49937300 0.33921800 10.26415 0.14187700 -0.70115400 0.69875300 -216.78054 2291 'point symmetry operation' ? ? 0.40092400 -0.34552700 -0.84845200 30.33465 0.72048100 -0.45310600 0.52497800 -264.34501 -0.56583300 -0.82177000 0.06728500 90.95426 2292 'point symmetry operation' ? ? 0.39030300 -0.35275700 -0.85042700 35.14863 0.73760500 -0.43299100 0.51812800 -324.44150 -0.55100100 -0.82950700 0.09119900 96.10740 2293 'point symmetry operation' ? ? 0.39225200 -0.35318500 -0.84935200 42.10063 0.70103500 -0.48303800 0.52461700 -208.31088 -0.59555700 -0.80120800 0.05812300 139.63012 2294 'point symmetry operation' ? ? 0.51921600 -0.33117100 -0.78787100 -20.96294 0.64349100 -0.45519100 0.61540200 -293.26625 -0.56243600 -0.82651500 -0.02323600 85.85010 2295 'point symmetry operation' ? ? 0.59620700 -0.33514100 -0.72953200 -25.79221 0.58687400 -0.43813300 0.68089500 -199.42575 -0.54782900 -0.83409800 -0.06453200 266.59291 2296 'point symmetry operation' ? ? 0.45731400 -0.33236800 -0.82486100 14.90352 0.69322000 -0.44777100 0.56475400 -241.59308 -0.55705600 -0.83008000 0.02563200 108.95524 2297 'point symmetry operation' ? ? 0.44617300 -0.31694700 -0.83694300 13.69297 0.70155000 -0.45677800 0.54697500 -279.62751 -0.55566000 -0.83120300 0.01855300 72.21747 2298 'point symmetry operation' ? ? 0.71201300 -0.06151400 -0.69946600 -7.87005 0.63393800 0.48465500 0.60268700 -23.29569 0.30192600 -0.87254000 0.38407700 42.91517 2299 'point symmetry operation' ? ? 0.33490400 -0.39470300 -0.85559900 49.39559 0.72164100 -0.47642200 0.50225100 -320.09952 -0.60586600 -0.78564100 0.12527800 120.15234 2300 'point symmetry operation' ? ? 0.49270100 -0.32083500 -0.80889400 -17.56957 0.66678900 -0.45808400 0.58783600 -317.86868 -0.55914000 -0.82899000 -0.01176800 30.00312 2301 'point symmetry operation' ? ? -0.36180300 0.58778500 0.72360700 0.00000 0.26286500 0.80901700 -0.52573100 0.00000 -0.89442700 0.00000000 -0.44721400 0.00000 2302 'point symmetry operation' ? ? 0.11943500 0.35991200 0.92531000 -150.06781 0.88437400 0.38501300 -0.26390700 -164.58008 -0.45123900 0.84984000 -0.27231400 65.26048 2303 'point symmetry operation' ? ? -0.13533900 0.31193000 0.94041600 -116.02861 0.89590700 0.44386400 -0.01829300 -236.55449 -0.42312200 0.84005100 -0.33953300 219.02466 2304 'point symmetry operation' ? ? 0.00051100 0.36408700 0.93136500 -142.15764 0.91267300 0.38047000 -0.14923300 -247.20574 -0.40869000 0.85010800 -0.33209800 16.93593 2305 'point symmetry operation' ? ? 0.03080000 0.33386300 0.94211800 -146.19918 0.90059500 0.39958900 -0.17104700 -213.43652 -0.43356500 0.85373600 -0.28836900 38.29335 2306 'point symmetry operation' ? ? 0.23994200 0.39562900 0.88651300 -128.14609 0.88752700 0.28061300 -0.36544700 -109.04391 -0.39334800 0.87449100 -0.28380100 59.20189 2307 'point symmetry operation' ? ? -0.22908400 0.80712200 0.54412700 129.08502 0.35734000 0.58969500 -0.72427000 148.07054 -0.90544300 0.02851900 -0.42350800 63.94721 2308 'point symmetry operation' ? ? 0.14913900 0.33604200 0.92996400 -190.05113 0.88536400 0.37342200 -0.27692200 -178.82487 -0.44032600 0.86465700 -0.24182800 153.74136 2309 'point symmetry operation' ? ? -0.24144000 0.85195400 0.46463100 204.96578 0.41332500 0.52347600 -0.74507400 173.71809 -0.87799100 0.01215300 -0.47852300 53.29521 2310 'point symmetry operation' ? ? -0.10030100 0.30962500 0.94555400 -114.27668 0.89770000 0.43796300 -0.04818700 -191.17315 -0.42903700 0.84399100 -0.32187900 272.45879 2311 'point symmetry operation' ? ? 0.22709700 0.38935400 0.89265400 -180.21681 0.88421800 0.30171200 -0.35655000 -147.59775 -0.40814800 0.87027200 -0.27575700 166.72301 2312 'point symmetry operation' ? ? -0.16796900 0.31262600 0.93490700 -117.68396 0.89414900 0.44763400 0.01096200 -281.11913 -0.41506900 0.83778800 -0.35472400 163.25713 2313 'point symmetry operation' ? ? -0.19655100 0.88308200 0.42606700 115.76930 0.42009600 0.46848400 -0.77720100 109.95359 -0.88593800 0.02622900 -0.46306200 242.88160 2314 'point symmetry operation' ? ? 0.19282700 0.37190900 0.90802100 -158.42749 0.88584500 0.33201500 -0.32410500 -141.61544 -0.42201400 0.86686200 -0.26543300 108.37804 2315 'point symmetry operation' ? ? 0.32644200 0.46925200 0.82051100 -182.98423 0.87620900 0.17536500 -0.44889300 -134.47752 -0.35453300 0.86547600 -0.35391700 274.97421 2316 'point symmetry operation' ? ? 0.27417800 0.42705200 0.86165700 -141.69119 0.88256900 0.24413800 -0.40183100 -109.95432 -0.38196600 0.87064500 -0.30996600 134.02348 2317 'point symmetry operation' ? ? 0.11632800 0.32525500 0.93844400 -169.89991 0.86542300 0.43043100 -0.25646000 -132.07822 -0.48734900 0.84198500 -0.23141300 234.21874 2318 'point symmetry operation' ? ? 0.13771800 0.31777300 0.93811200 -205.02321 0.86644600 0.42025300 -0.26955200 -160.00476 -0.47990000 0.84994600 -0.21745800 266.37826 2319 'point symmetry operation' ? ? 0.25584200 0.41087900 0.87505600 -201.53901 0.88198700 0.27138000 -0.38529400 -156.22043 -0.39578200 0.87036300 -0.29296000 232.15526 2320 'point symmetry operation' ? ? 0.23525000 0.45784000 0.85734500 -68.74787 0.91830500 0.18426200 -0.35037700 -111.61287 -0.31839200 0.86973000 -0.37709000 -96.52631 2321 'point symmetry operation' ? ? -0.22165700 0.88013500 0.41979700 208.19972 0.43744600 0.47450600 -0.76386100 162.72713 -0.87149800 0.01432200 -0.49019100 111.51957 2322 'point symmetry operation' ? ? 0.15155400 0.37843800 0.91313500 -130.51132 0.90007700 0.32897200 -0.28572500 -150.74544 -0.40852400 0.86519500 -0.29076700 18.79495 2323 'point symmetry operation' ? ? 0.30134600 0.45099600 0.84011500 -160.93762 0.87935700 0.20921900 -0.42773600 -120.20178 -0.36867500 0.86765800 -0.33354100 206.34330 2324 'point symmetry operation' ? ? -0.05465600 0.31537200 0.94739300 -136.33264 0.89243600 0.44099000 -0.09531300 -220.33449 -0.44784900 0.84027900 -0.30555300 153.01252 2325 'point symmetry operation' ? ? 0.11254400 0.35510300 0.92802800 -117.65832 0.90595100 0.34696400 -0.24263000 -180.58493 -0.40815100 0.86805400 -0.28265800 -184.41216 2326 'point symmetry operation' ? ? -0.08553200 0.31472200 0.94532200 -140.76821 0.90402900 0.42335800 -0.05915000 -269.47026 -0.41882500 0.84954000 -0.32073000 101.47732 2327 'point symmetry operation' ? ? -0.24346500 0.76074900 0.60165200 111.00746 0.34061700 0.64787000 -0.68135400 138.65455 -0.90813200 0.03904700 -0.41685900 11.64010 2328 'point symmetry operation' ? ? 0.03476700 0.31728900 0.94769100 -151.58207 0.89255400 0.41673800 -0.17226900 -201.80749 -0.44959800 0.85185500 -0.26871000 87.35033 2329 'point symmetry operation' ? ? -0.20050100 0.86553400 0.45896700 129.20877 0.39498300 0.50013500 -0.77061900 132.77876 -0.89654200 0.02677400 -0.44214900 174.33026 2330 'point symmetry operation' ? ? -0.13593100 0.35038700 0.92668800 -133.91559 0.91162800 0.41045400 -0.02147300 -333.78564 -0.38788700 0.84187700 -0.37521700 17.65431 2331 'point symmetry operation' ? ? -0.21668100 0.30639300 0.92691500 -92.74906 0.88960600 0.45300300 0.05821800 -252.61198 -0.40205700 0.83720500 -0.37072700 280.99486 2332 'point symmetry operation' ? ? -0.20673200 0.31660200 0.92575600 -117.66411 0.89261100 0.44847900 0.04595400 -331.46842 -0.40063200 0.83584100 -0.37531900 114.28087 2333 'point symmetry operation' ? ? 0.24885400 0.38046400 0.89068400 -95.93616 0.86943400 0.31748500 -0.37853300 -83.62016 -0.42679700 0.86859100 -0.25178300 -175.99602 2334 'point symmetry operation' ? ? 0.10709000 0.39943000 0.91048700 -102.07047 0.91525800 0.31810700 -0.24720500 -183.93148 -0.38837300 0.85980400 -0.33151600 -202.16119 2335 'point symmetry operation' ? ? 0.15697200 0.35028800 0.92339500 -226.76035 0.87160500 0.39051800 -0.29631000 -187.15347 -0.46439600 0.85134800 -0.24401400 270.69754 2336 'point symmetry operation' ? ? -0.20582600 0.84478800 0.49393100 139.69391 0.37523800 0.53429000 -0.75744900 150.35846 -0.90378700 0.02943900 -0.42696900 112.40164 2337 'point symmetry operation' ? ? 0.11731300 0.33219000 0.93588800 -163.71422 0.87449000 0.41206100 -0.25587600 -146.15529 -0.47064200 0.84844300 -0.24215800 175.80509 2338 'point symmetry operation' ? ? 0.12965100 0.34911500 0.92806700 -194.84777 0.86264700 0.42178200 -0.27917500 -167.06213 -0.48890600 0.83679000 -0.24648000 223.29113 2339 'point symmetry operation' ? ? 0.12473200 0.32037600 0.93904300 -163.47510 0.89007700 0.38206300 -0.24857700 -165.24159 -0.43841100 0.86682600 -0.23750500 103.11906 2340 'point symmetry operation' ? ? -0.01831600 0.32024300 0.94715800 -130.39596 0.89812100 0.42155800 -0.12516500 -172.56871 -0.43936500 0.84837100 -0.29533900 216.86792 2341 'point symmetry operation' ? ? -0.11278500 0.33301600 0.93615200 -136.27734 0.90094600 0.43159200 -0.04498600 -299.37341 -0.41901600 0.83834900 -0.34870700 57.54652 2342 'point symmetry operation' ? ? 0.05469500 0.32541500 0.94398800 -145.71399 0.88258300 0.42637500 -0.19811900 -161.00034 -0.46696300 0.84398400 -0.26388600 152.66591 2343 'point symmetry operation' ? ? 0.06745400 0.30860600 0.94879500 -150.69369 0.87923100 0.43110600 -0.20273000 -142.01749 -0.47159400 0.84788600 -0.24225700 201.78415 2344 'point symmetry operation' ? ? -0.42743600 0.50031300 0.75298500 -14.98725 0.24190000 0.86583000 -0.43797500 -47.05191 -0.87108100 -0.00505900 -0.49111300 2.79948 2345 'point symmetry operation' ? ? 0.18576800 0.35466700 0.91635200 -211.92494 0.88082300 0.35320700 -0.31527100 -180.11465 -0.43547800 0.86571100 -0.24678500 204.90664 2346 'point symmetry operation' ? ? 0.01353300 0.31078900 0.95038200 -128.34871 0.89124000 0.42716600 -0.15238100 -131.22173 -0.45332900 0.84908100 -0.27120800 261.83363 2347 'point symmetry operation' ? ? 0.44721400 0.52573200 0.72360600 0.00000 0.85065100 0.00000000 -0.52573200 0.00000 -0.27639400 0.85065100 -0.44721400 0.00000 2348 'point symmetry operation' ? ? 0.55031500 -0.31096400 0.77489000 -174.62932 0.59722400 -0.50197000 -0.62558000 -13.32414 0.58350500 0.80704900 -0.09052600 -152.29254 2349 'point symmetry operation' ? ? 0.36093600 -0.32650700 0.87356700 -274.75297 0.76354200 -0.43437600 -0.47783000 -153.57556 0.53547100 0.83947100 0.09252000 -135.34392 2350 'point symmetry operation' ? ? 0.44434800 -0.30909500 0.84084200 -147.77854 0.67084600 -0.50725500 -0.54098000 -34.67501 0.59373600 0.80445900 -0.01804100 -242.00325 2351 'point symmetry operation' ? ? 0.48070400 -0.32888900 0.81286900 -160.45786 0.65704100 -0.47880300 -0.58227700 -26.23729 0.58070800 0.81399100 -0.01406900 -204.84315 2352 'point symmetry operation' ? ? 0.58977600 -0.32180300 0.74068000 -146.51727 0.48543400 -0.59170900 -0.64361200 2.54281 0.64538300 0.73913800 -0.19276200 -101.70111 2353 'point symmetry operation' ? ? 0.55956400 0.61660000 0.55379800 64.37595 0.81234400 -0.27560100 -0.51394800 -48.41899 -0.16427300 0.73746200 -0.65510700 190.23270 2354 'point symmetry operation' ? ? 0.56250600 -0.33958100 0.75383800 -267.79050 0.57153900 -0.49912700 -0.65131900 -39.44752 0.59743700 0.79721800 -0.08667800 -135.89110 2355 'point symmetry operation' ? ? 0.54050700 0.64775800 0.53690000 127.15287 0.83440700 -0.33095900 -0.44071800 -82.21565 -0.10778700 0.68620500 -0.71937900 228.25902 2356 'point symmetry operation' ? ? 0.38901200 -0.33186300 0.85938200 -304.87032 0.74343600 -0.43781200 -0.50559400 -160.18253 0.54403500 0.83557700 0.07640500 -72.35951 2357 'point symmetry operation' ? ? 0.59133100 -0.31953200 0.74042400 -265.51384 0.50039900 -0.57462400 -0.64761800 -37.42671 0.63240000 0.75346400 -0.17989900 -100.80399 2358 'point symmetry operation' ? ? 0.33293400 -0.32379000 0.88561600 -242.74971 0.78088500 -0.43178100 -0.45142600 -145.39997 0.52855900 0.84185900 0.10908900 -198.65044 2359 'point symmetry operation' ? ? 0.57747000 0.64952000 0.49462300 -80.22714 0.81107900 -0.38727700 -0.43837100 -152.38514 -0.09317400 0.65432500 -0.75045300 234.15010 2360 'point symmetry operation' ? ? 0.57864000 -0.32384300 0.74853300 -207.70643 0.53208700 -0.54567300 -0.64739900 -18.75700 0.61811000 0.77289500 -0.14343500 -115.78542 2361 'point symmetry operation' ? ? 0.61787600 -0.28299100 0.73358400 -343.57003 0.39983900 -0.69026100 -0.60305100 -85.87312 0.67702200 0.66592600 -0.31334400 -41.99668 2362 'point symmetry operation' ? ? 0.60370100 -0.30386600 0.73702800 -209.89289 0.45340900 -0.62955000 -0.63094200 -27.92682 0.65571800 0.71507600 -0.24228300 -72.75805 2363 'point symmetry operation' ? ? 0.57128300 -0.32115000 0.75531400 -304.91209 0.60887100 -0.45128000 -0.65239800 -72.25156 0.55037600 0.83259200 -0.06226900 -54.56572 2364 'point symmetry operation' ? ? 0.58040700 -0.33358300 0.74286600 -356.28134 0.59074600 -0.45540500 -0.66605300 -78.95054 0.56048900 0.82542700 -0.06725700 -73.64710 2365 'point symmetry operation' ? ? 0.60130300 -0.31008600 0.73639800 -328.56526 0.47300000 -0.60465000 -0.64083600 -61.46406 0.64397700 0.73365300 -0.21690700 -84.76997 2366 'point symmetry operation' ? ? 0.53739000 -0.29227800 0.79106600 5.59683 0.46464400 -0.68019500 -0.56695800 42.25215 0.70378900 0.67224200 -0.22972400 -157.11300 2367 'point symmetry operation' ? ? 0.55299700 0.65713800 0.51221500 85.40513 0.82944000 -0.37597900 -0.41312300 -120.54708 -0.07889700 0.65330800 -0.75297100 245.84214 2368 'point symmetry operation' ? ? 0.54350400 -0.31875200 0.77653100 -125.64007 0.56051500 -0.55081200 -0.61840900 4.56295 0.62484200 0.77136500 -0.12070300 -155.89886 2369 'point symmetry operation' ? ? 0.61178600 -0.29131600 0.73542700 -276.79970 0.42611900 -0.66191700 -0.61667600 -57.82612 0.66644000 0.69065300 -0.28081600 -54.45219 2370 'point symmetry operation' ? ? 0.43238900 -0.32482900 0.84114600 -237.97138 0.71928100 -0.43830200 -0.53900600 -96.78782 0.54376100 0.83808000 0.04412700 -156.67982 2371 'point symmetry operation' ? ? 0.51801900 -0.33355100 0.78765500 25.17621 0.59010200 -0.52726000 -0.61137400 87.63021 0.61922300 0.78150000 -0.07630100 -268.60648 2372 'point symmetry operation' ? ? 0.39255700 -0.33483200 0.85661300 -211.63831 0.73106700 -0.45154000 -0.51152100 -91.20954 0.55806900 0.82704300 0.06753000 -222.75045 2373 'point symmetry operation' ? ? 0.54914600 0.58732500 0.59454900 88.56919 0.81529300 -0.22013400 -0.53557300 -13.18667 -0.18367500 0.77884000 -0.59972800 153.83398 2374 'point symmetry operation' ? ? 0.49366000 -0.33586000 0.80218300 -197.67749 0.65871900 -0.45783400 -0.59705900 -42.50910 0.56779500 0.82315700 -0.00477600 -174.49971 2375 'point symmetry operation' ? ? 0.57841300 0.64249600 0.50263000 -17.89927 0.80681500 -0.35966200 -0.46871600 -114.18189 -0.12037100 0.67664100 -0.72640800 226.62380 2376 'point symmetry operation' ? ? 0.33759600 -0.30745800 0.88966200 -156.83533 0.75328600 -0.47850700 -0.45121300 -84.01480 0.56443800 0.82249700 0.07006200 -313.05322 2377 'point symmetry operation' ? ? 0.29010400 -0.32667600 0.89951200 -306.58736 0.80529600 -0.42450100 -0.41388400 -210.20479 0.51704900 0.84444200 0.13992200 -114.85497 2378 'point symmetry operation' ? ? 0.29623500 -0.31957700 0.90006500 -215.47667 0.79920300 -0.43307100 -0.41680400 -144.83994 0.52299300 0.84280500 0.12711600 -263.37750 2379 'point symmetry operation' ? ? 0.61701900 -0.32171600 0.71818300 49.41093 0.48783900 -0.55973500 -0.66985900 116.73902 0.61749700 0.76367300 -0.18842100 -176.35561 2380 'point symmetry operation' ? ? 0.50156200 -0.30253400 0.81049900 47.93248 0.58811100 -0.56785700 -0.57590400 84.56073 0.63447800 0.76551500 -0.10689100 -275.08247 2381 'point symmetry operation' ? ? 0.58294200 -0.31761600 0.74786300 -378.39912 0.57192400 -0.49338700 -0.65534200 -79.83637 0.57713300 0.80974700 -0.10596300 -100.81754 2382 'point symmetry operation' ? ? 0.57687500 0.63220000 0.51724000 36.80235 0.80441700 -0.32970800 -0.49417400 -80.05000 -0.14187800 0.70115400 -0.69875300 216.78066 2383 'point symmetry operation' ? ? 0.56132700 -0.32415500 0.76147000 -260.78109 0.60394300 -0.46863300 -0.64469900 -52.83716 0.56583200 0.82177100 -0.06728500 -90.95412 2384 'point symmetry operation' ? ? 0.58089500 -0.30279000 0.75556500 -319.42386 0.59913300 -0.46929400 -0.64869400 -66.82963 0.55100100 0.82950700 -0.09119800 -96.10722 2385 'point symmetry operation' ? ? 0.54551300 -0.35025600 0.76140400 -211.12538 0.58968600 -0.48516600 -0.64566700 -24.33155 0.59555600 0.80120900 -0.05812200 -139.63004 2386 'point symmetry operation' ? ? 0.45155100 -0.33057400 0.82874800 -272.43503 0.69265400 -0.45562400 -0.55914000 -110.56127 0.56243500 0.82651600 0.02323700 -85.84990 2387 'point symmetry operation' ? ? 0.37391400 -0.31312400 0.87300800 -181.69524 0.74838100 -0.45412900 -0.48341900 -86.15591 0.54782800 0.83409900 0.06453200 -266.59283 2388 'point symmetry operation' ? ? 0.51797400 -0.32314800 0.79200900 -234.37426 0.64914900 -0.45446900 -0.60997100 -60.48232 0.55705500 0.83008100 -0.02563200 -108.95512 2389 'point symmetry operation' ? ? 0.52933900 -0.33647900 0.77883400 -270.17304 0.64112700 -0.44258700 -0.62695600 -73.38690 0.55565900 0.83120400 -0.01855300 -72.21731 2390 'point symmetry operation' ? ? 0.38288700 0.47994400 0.78933600 -19.72359 0.87306300 0.09126400 -0.47899200 -14.68365 -0.30192700 0.87254000 -0.38407700 -42.91516 2391 'point symmetry operation' ? ? 0.58283100 -0.33113400 0.74206300 -319.69696 0.54151200 -0.52260700 -0.65851900 -51.93822 0.60586600 0.78564200 -0.12527800 -120.15219 2392 'point symmetry operation' ? ? 0.48190200 -0.33651900 0.80902700 -296.88189 0.67463600 -0.44668800 -0.58765400 -114.93654 0.55914000 0.82899100 0.01176800 -30.00290 2393 'point symmetry operation' ? ? 0.63819700 -0.26286500 0.72360600 0.00000 0.26286500 -0.80901700 -0.52573100 0.00000 0.72360600 0.52573100 -0.44721400 0.00000 2394 'point symmetry operation' ? ? 0.04396000 -0.87413700 0.48368500 -9.10961 -0.38687600 -0.46127200 -0.79847000 193.58107 0.92108300 -0.15202600 -0.35846000 -127.70775 2395 'point symmetry operation' ? ? -0.02130300 -0.89704200 0.44143000 -111.32388 -0.14813600 -0.43382400 -0.88873600 183.44924 0.98873700 -0.08432400 -0.12364200 -267.10645 2396 'point symmetry operation' ? ? -0.02256800 -0.87186700 0.48922100 70.34902 -0.28251800 -0.46383900 -0.83966500 211.59081 0.95899600 -0.15716400 -0.23585000 -178.56829 2397 'point symmetry operation' ? ? 0.00900400 -0.88742000 0.46087200 36.32499 -0.30759200 -0.44100200 -0.84315100 204.99927 0.95147500 -0.13416900 -0.27693400 -158.27674 2398 'point symmetry operation' ? ? 0.00749300 -0.84684500 0.53178600 -24.28202 -0.50246000 -0.46297900 -0.73019400 155.57063 0.86456800 -0.26172900 -0.42897500 -83.81540 2399 'point symmetry operation' ? ? 0.62620900 -0.16477900 0.76204300 -102.33506 0.10744700 -0.94984500 -0.29368300 -168.52349 0.77221500 0.26578700 -0.57709600 61.68002 2400 'point symmetry operation' ? ? 0.03788300 -0.88575800 0.46259700 -87.71617 -0.41543300 -0.43498800 -0.79887400 236.00936 0.90883400 -0.16191400 -0.38445200 -168.34377 2401 'point symmetry operation' ? ? 0.57613500 -0.11578000 0.80911200 -93.22973 0.10189800 -0.97201900 -0.21164900 -248.61590 0.81097700 0.20438600 -0.54821700 67.28788 2402 'point symmetry operation' ? ? -0.01193200 -0.89837600 0.43906400 -178.17648 -0.18201300 -0.42980900 -0.88438400 167.75944 0.98322300 -0.09046800 -0.15838700 -252.88344 2403 'point symmetry operation' ? ? 0.02036300 -0.85291300 0.52165500 -111.24989 -0.48922100 -0.46353100 -0.73878400 217.00663 0.87192200 -0.24016100 -0.42670200 -150.30410 2404 'point symmetry operation' ? ? -0.03226700 -0.89652600 0.44181300 -42.71824 -0.11655900 -0.43565100 -0.89253700 198.79482 0.99265900 -0.08029700 -0.09044100 -279.61790 2405 'point symmetry operation' ? ? 0.58656700 -0.10067900 0.80361800 -248.00692 0.05711400 -0.98463100 -0.16504500 -144.08066 0.80788400 0.14270800 -0.57180200 -47.08564 2406 'point symmetry operation' ? ? 0.02733700 -0.86516200 0.50074500 -58.59780 -0.45713100 -0.45630500 -0.76342500 194.43512 0.88897900 -0.20803600 -0.40796600 -125.14504 2407 'point symmetry operation' ? ? -0.01045600 -0.78384400 0.62086900 -214.03548 -0.58122900 -0.50047500 -0.64163600 215.58425 0.81367300 -0.36757600 -0.45035900 -186.78984 2408 'point symmetry operation' ? ? 0.00415300 -0.82354900 0.56722800 -92.68913 -0.53348800 -0.48159300 -0.69531100 168.73412 0.84579700 -0.29972200 -0.44135400 -114.30726 2409 'point symmetry operation' ? ? 0.08388900 -0.89121800 0.44575000 -176.79497 -0.37806600 -0.44234600 -0.81326200 202.39889 0.92197000 -0.10029900 -0.37404700 -170.13890 2410 'point symmetry operation' ? ? 0.07974700 -0.89504300 0.43879100 -198.53538 -0.39872500 -0.43208500 -0.80890100 244.43292 0.91359700 -0.11044900 -0.39133300 -198.56895 2411 'point symmetry operation' ? ? 0.01422400 -0.83711900 0.54683600 -169.05347 -0.51587000 -0.47463000 -0.71316500 239.94982 0.85654900 -0.27195200 -0.43859500 -181.00784 2412 'point symmetry operation' ? ? -0.07328900 -0.79300900 0.60478500 124.30671 -0.50750800 -0.49237200 -0.70711100 99.87341 0.85852400 -0.35875600 -0.36637300 -32.77428 2413 'point symmetry operation' ? ? 0.56280200 -0.09299800 0.82134300 -140.18552 0.07563000 -0.98368900 -0.16320400 -248.29516 0.82312400 0.15397000 -0.54658900 31.00587 2414 'point symmetry operation' ? ? 0.00351500 -0.86147500 0.50778700 29.26884 -0.42227600 -0.46157400 -0.78014900 170.70659 0.90646000 -0.21168400 -0.36540200 -100.56460 2415 'point symmetry operation' ? ? -0.00261500 -0.80271600 0.59635500 -155.67521 -0.55833400 -0.49357500 -0.66681900 190.20522 0.82961200 -0.33470800 -0.44689300 -150.04706 2416 'point symmetry operation' ? ? 0.01344100 -0.89554800 0.44476000 -61.98554 -0.22379800 -0.43621000 -0.87157000 197.74724 0.97454300 -0.08782200 -0.20628400 -218.17548 2417 'point symmetry operation' ? ? -0.00470900 -0.87490900 0.48426300 225.49044 -0.38699000 -0.44494100 -0.80763000 167.70355 0.92207200 -0.19120800 -0.33648600 -38.62318 2418 'point symmetry operation' ? ? -0.02171800 -0.89642200 0.44266700 4.39458 -0.19801500 -0.43014300 -0.88077600 217.14952 0.97995800 -0.10678300 -0.16816300 -235.69968 2419 'point symmetry operation' ? ? 0.63373900 -0.20534700 0.74579300 -54.04358 0.12629200 -0.92371900 -0.36165400 -148.42102 0.76316700 0.32338300 -0.55946200 82.05925 2420 'point symmetry operation' ? ? 0.02731200 -0.89532300 0.44457900 -13.24291 -0.30888000 -0.43053900 -0.84807300 206.52513 0.95070800 -0.11415900 -0.28830600 -168.83563 2421 'point symmetry operation' ? ? 0.60618700 -0.11705300 0.78666100 -194.54356 0.06863100 -0.97772100 -0.19836900 -163.91574 0.79235500 0.17423800 -0.58464900 -0.72691 2422 'point symmetry operation' ? ? -0.05958600 -0.87915100 0.47280200 107.67004 -0.15243100 -0.46007500 -0.87469700 230.50686 0.98651600 -0.12419000 -0.10659500 -254.81688 2423 'point symmetry operation' ? ? -0.04870500 -0.89914900 0.43492300 -156.70492 -0.06882800 -0.43138300 -0.89953900 166.27114 0.99643800 -0.07374700 -0.04087600 -314.91397 2424 'point symmetry operation' ? ? -0.04988300 -0.89459400 0.44408500 22.50496 -0.07921800 -0.43969400 -0.89464700 214.33474 0.99560800 -0.07980700 -0.04893500 -300.55022 2425 'point symmetry operation' ? ? 0.04633800 -0.85934600 0.50928900 179.72326 -0.50534400 -0.45995100 -0.73011700 117.08075 0.86167200 -0.22353400 -0.45557900 34.09233 2426 'point symmetry operation' ? ? -0.02711100 -0.84913100 0.52748500 244.94320 -0.38468000 -0.47818100 -0.78953400 153.91277 0.92265200 -0.22431800 -0.31367900 -37.84070 2427 'point symmetry operation' ? ? 0.06634700 -0.87915700 0.47189000 -193.85564 -0.41863000 -0.45382100 -0.78663500 273.49559 0.90573000 -0.14535700 -0.39815100 -217.58665 2428 'point symmetry operation' ? ? 0.62032900 -0.13683100 0.77231400 -145.18101 0.07979700 -0.96854600 -0.23569200 -179.32014 0.78027100 0.20783500 -0.58989800 39.02455 2429 'point symmetry operation' ? ? 0.06522600 -0.88822200 0.45475900 -117.70608 -0.38180400 -0.44326500 -0.81101200 200.86600 0.92193900 -0.12073000 -0.36803900 -157.69991 2430 'point symmetry operation' ? ? 0.08830300 -0.87959600 0.46745300 -155.58921 -0.38987800 -0.46236600 -0.79637400 236.93635 0.91662300 -0.11192700 -0.38376400 -188.11560 2431 'point symmetry operation' ? ? 0.03079300 -0.89353900 0.44792800 -44.54282 -0.39367600 -0.42275900 -0.81626800 206.53658 0.91873300 -0.15120400 -0.36478200 -141.49562 2432 'point symmetry operation' ? ? 0.00845600 -0.89384800 0.44828900 -138.59505 -0.26011600 -0.43483800 -0.86212300 177.34067 0.96554000 -0.10931700 -0.23618100 -207.74131 2433 'point symmetry operation' ? ? -0.02400100 -0.88738700 0.46039900 57.02663 -0.17114300 -0.45008600 -0.87643100 222.11905 0.98495300 -0.09983000 -0.14106700 -242.73164 2434 'point symmetry operation' ? ? 0.04983900 -0.89125900 0.45074700 -88.20825 -0.32475200 -0.44124500 -0.83656300 188.33415 0.94448500 -0.10468700 -0.31142900 -164.95488 2435 'point symmetry operation' ? ? 0.05717000 -0.89908400 0.43402700 -140.90296 -0.33585100 -0.42672000 -0.83971100 187.20409 0.94017800 -0.09776200 -0.32635300 -169.39707 2436 'point symmetry operation' ? ? 0.61716200 -0.29459300 0.72960600 15.43721 0.33176400 -0.74338200 -0.58078900 28.79358 0.71347200 0.60049800 -0.36105200 -37.13433 2437 'point symmetry operation' ? ? 0.04054000 -0.87552900 0.48146000 -135.95407 -0.44886600 -0.44645500 -0.77407800 257.21115 0.89267900 -0.18473000 -0.41109400 -186.27693 2438 'point symmetry operation' ? ? 0.02827400 -0.89817500 0.43872600 -196.11655 -0.28828000 -0.42758000 -0.85677900 162.61669 0.95712800 -0.10225200 -0.27101500 -193.24456 2439 'point symmetry operation' ? ? -0.05278600 -0.68819100 0.72360700 0.00000 -0.68819100 -0.50000000 -0.52573100 0.00000 0.72360700 -0.52573100 -0.44721400 0.00000 2440 'point symmetry operation' ? ? -0.69986500 -0.55132000 0.45413100 117.74854 -0.70793200 0.45086200 -0.54365000 170.19958 0.09497500 -0.70197600 -0.70584000 105.03938 2441 'point symmetry operation' ? ? -0.75381400 -0.61121600 0.24120400 148.40503 -0.57921700 0.44475700 -0.68315400 308.76281 0.31027800 -0.65468100 -0.68929100 5.82825 2442 'point symmetry operation' ? ? -0.75497400 -0.54649700 0.36243100 210.77996 -0.62990100 0.45071800 -0.63251700 151.26064 0.18231500 -0.70582900 -0.68452000 119.57568 2443 'point symmetry operation' ? ? -0.73242600 -0.56985900 0.37257600 172.20195 -0.66021200 0.46075100 -0.59315100 160.71203 0.16634800 -0.68041900 -0.71369400 113.63923 2444 'point symmetry operation' ? ? -0.70221100 -0.45390800 0.54851500 69.63457 -0.71091700 0.48890100 -0.50554300 138.56033 -0.03870000 -0.74494600 -0.66600200 88.14148 2445 'point symmetry operation' ? ? -0.12125100 -0.45717400 0.88107300 -140.65891 -0.78320500 -0.50125500 -0.36787600 -46.26272 0.60982600 -0.73466700 -0.29728300 -144.05527 2446 'point symmetry operation' ? ? -0.69971800 -0.54769100 0.45872700 101.31507 -0.71158900 0.47720000 -0.51567500 266.87370 0.06352600 -0.68725200 -0.72363700 101.23167 2447 'point symmetry operation' ? ? -0.18379100 -0.38347700 0.90507800 -151.62056 -0.77189800 -0.51378200 -0.37443400 -95.52337 0.60860000 -0.76744600 -0.20157700 -207.16140 2448 'point symmetry operation' ? ? -0.74904200 -0.60701200 0.26546700 90.71808 -0.59970500 0.45091200 -0.66108400 339.44783 0.28158400 -0.65438100 -0.70178100 -19.63520 2449 'point symmetry operation' ? ? -0.69674800 -0.47367500 0.53867900 69.38734 -0.71702000 0.48146200 -0.50406000 264.08404 -0.02059200 -0.73744700 -0.67509200 86.63001 2450 'point symmetry operation' ? ? -0.75887700 -0.61408000 0.21681900 205.97352 -0.55794500 0.44137100 -0.70277300 275.79944 0.33586100 -0.65429100 -0.67756900 32.24885 2451 'point symmetry operation' ? ? -0.18183100 -0.33076500 0.92603000 -155.70396 -0.79984300 -0.49805500 -0.33495200 123.39026 0.57200500 -0.80158300 -0.17399900 -212.16730 2452 'point symmetry operation' ? ? -0.69919900 -0.50396300 0.50709200 82.83519 -0.71474200 0.47661600 -0.51184100 203.33667 0.01626100 -0.72031800 -0.69345300 93.23373 2453 'point symmetry operation' ? ? -0.69022000 -0.34114500 0.63813500 26.60692 -0.71119100 0.48244300 -0.51132800 353.29067 -0.13342700 -0.80676500 -0.57561100 40.69383 2454 'point symmetry operation' ? ? -0.69591000 -0.41381300 0.58691500 47.94835 -0.71426400 0.48353600 -0.50598500 208.24978 -0.07441200 -0.77133200 -0.63206900 66.79533 2455 'point symmetry operation' ? ? -0.67229000 -0.59713400 0.43755900 37.39779 -0.73147200 0.44488500 -0.51674500 312.31549 0.11390200 -0.66746400 -0.73587900 47.21727 2456 'point symmetry operation' ? ? -0.67236600 -0.59068800 0.44610700 50.21491 -0.73454900 0.45798500 -0.50068700 363.24062 0.09144000 -0.66433300 -0.74182300 64.25033 2457 'point symmetry operation' ? ? -0.69407200 -0.44187800 0.56833800 56.55631 -0.71803800 0.48175600 -0.50232700 331.47745 -0.05183300 -0.75674000 -0.65165900 76.43897 2458 'point symmetry operation' ? ? -0.75284800 -0.35235800 0.55593500 123.32864 -0.65467000 0.48816500 -0.57715000 -18.37966 -0.06802500 -0.79846000 -0.59819300 104.65789 2459 'point symmetry operation' ? ? -0.20579200 -0.33360900 0.91997500 -156.81343 -0.78224200 -0.50879100 -0.35948500 -43.97386 0.58800300 -0.79362300 -0.15625800 -236.09267 2460 'point symmetry operation' ? ? -0.72216700 -0.49970600 0.47829900 120.13642 -0.69011100 0.47336100 -0.54742700 118.08063 0.04714400 -0.72541200 -0.68669800 108.32754 2461 'point symmetry operation' ? ? -0.69277400 -0.37646700 0.61509100 35.04577 -0.71352000 0.48160100 -0.50887000 281.12132 -0.10465500 -0.79141200 -0.60225800 51.66744 2462 'point symmetry operation' ? ? -0.73252800 -0.60807100 0.30602800 148.41823 -0.63349500 0.44437400 -0.63341500 256.23309 0.24917100 -0.65786200 -0.71072700 53.51030 2463 'point symmetry operation' ? ? -0.73324700 -0.52083300 0.43713000 206.45676 -0.67501600 0.48015800 -0.56018000 -51.02342 0.08186900 -0.70582000 -0.70364500 187.70851 2464 'point symmetry operation' ? ? -0.75584300 -0.59395100 0.27554300 208.78013 -0.59925500 0.45797800 -0.65662000 229.46500 0.26380700 -0.66142200 -0.70208800 80.52484 2465 'point symmetry operation' ? ? -0.10659100 -0.52182000 0.84637000 -119.74470 -0.77420800 -0.49055400 -0.39994900 -80.15926 0.62389200 -0.69789700 -0.35170900 -104.49374 2466 'point symmetry operation' ? ? -0.71979900 -0.58794000 0.36907500 146.83917 -0.67305300 0.46090100 -0.57842100 201.13830 0.16997000 -0.66475400 -0.72747000 96.51487 2467 'point symmetry operation' ? ? -0.15556100 -0.36344200 0.91853700 -156.60757 -0.79942200 -0.49990800 -0.33319000 52.30749 0.58028000 -0.78613100 -0.21277800 -193.53080 2468 'point symmetry operation' ? ? -0.77858600 -0.57463200 0.25219500 294.06281 -0.55385000 0.44027700 -0.70668700 175.12088 0.29504900 -0.68989500 -0.66105400 111.88247 2469 'point symmetry operation' ? ? -0.76488400 -0.61988600 0.17519400 149.76562 -0.52475400 0.44186600 -0.72759000 356.53848 0.37361100 -0.64845600 -0.66326500 -42.70756 2470 'point symmetry operation' ? ? -0.76676200 -0.61379600 0.18796700 267.39799 -0.52870200 0.43776200 -0.72721300 249.68811 0.36407600 -0.65697700 -0.66017400 54.13395 2471 'point symmetry operation' ? ? -0.67452600 -0.48944000 0.55268700 114.91353 -0.73756900 0.47893800 -0.47603600 -83.06701 -0.03171200 -0.72874400 -0.68405200 164.51583 2472 'point symmetry operation' ? ? -0.74831900 -0.48498200 0.45256100 216.69942 -0.65874900 0.46320500 -0.59286700 -71.71741 0.07790200 -0.74177800 -0.66610600 181.70392 2473 'point symmetry operation' ? ? -0.67889700 -0.55830300 0.47686200 71.83705 -0.73114400 0.45453600 -0.50874800 384.54959 0.06728500 -0.69404200 -0.71678300 81.76097 2474 'point symmetry operation' ? ? -0.13551700 -0.39953000 0.90664800 -154.76121 -0.79721900 -0.49937300 -0.33921800 -10.26415 0.58828300 -0.76876700 -0.25084000 -175.21366 2475 'point symmetry operation' ? ? -0.68539500 -0.58048900 0.43962000 67.78585 -0.72048100 0.45310600 -0.52497800 264.34501 0.10555000 -0.67655600 -0.72878800 67.80801 2476 'point symmetry operation' ? ? -0.66737900 -0.58417600 0.46189300 70.24207 -0.73760500 0.43299100 -0.51812800 324.44150 0.10268300 -0.68648200 -0.71986000 74.41829 2477 'point symmetry operation' ? ? -0.70810200 -0.55867300 0.43182800 106.06097 -0.70103500 0.48303800 -0.52461700 208.31088 0.08450000 -0.67420900 -0.73369100 100.10034 2478 'point symmetry operation' ? ? -0.73525800 -0.59115300 0.33156300 86.16151 -0.64349100 0.45519100 -0.61540200 293.26625 0.21287300 -0.66583700 -0.71508500 19.64335 2479 'point symmetry operation' ? ? -0.75662400 -0.59616100 0.26853800 249.98252 -0.58687400 0.43813300 -0.68089500 199.42575 0.28826800 -0.67278000 -0.68137300 96.15455 2480 'point symmetry operation' ? ? -0.70276200 -0.59380700 0.39181500 90.78743 -0.69322000 0.44777100 -0.56475400 241.59308 0.15991200 -0.66850200 -0.72631500 62.05626 2481 'point symmetry operation' ? ? -0.69653200 -0.60170700 0.39088600 58.46954 -0.70155000 0.45677800 -0.54697500 279.62751 0.15057100 -0.65521200 -0.74028800 44.54388 2482 'point symmetry operation' ? ? -0.04837000 -0.75291400 0.65634000 41.90408 -0.63393800 -0.48465500 -0.60268700 23.29569 0.77187000 -0.44523100 -0.45385800 12.15304 2483 'point symmetry operation' ? ? -0.69167700 -0.52618300 0.49468800 85.37710 -0.72164100 0.47642200 -0.50225100 320.09952 0.02859600 -0.70438200 -0.70924500 97.91439 2484 'point symmetry operation' ? ? -0.72045300 -0.59798900 0.35122300 34.69289 -0.66678900 0.45808400 -0.58783600 317.86868 0.19063100 -0.65770000 -0.72876000 -2.29705 2485 'point symmetry operation' ? ? -0.67082000 -0.16246000 0.72360700 0.00000 -0.68819100 0.50000000 -0.52573100 0.00000 -0.27639300 -0.85065100 -0.44721400 0.00000 2486 'point symmetry operation' ? ? -0.65321900 0.21136400 0.72706900 30.63152 0.07774400 0.97389500 -0.21327200 -51.15618 -0.75316700 -0.08278800 -0.65259900 224.30041 2487 'point symmetry operation' ? ? -0.82429200 0.13597000 0.54959500 145.49728 0.06603700 0.98719700 -0.14519000 49.18623 -0.56230000 -0.08338600 -0.82271900 306.27402 2488 'point symmetry operation' ? ? -0.74070900 0.21736500 0.63569000 79.44350 0.10876700 0.97252900 -0.20580700 -132.29122 -0.66296200 -0.08330100 -0.74400400 240.40406 2489 'point symmetry operation' ? ? -0.71895500 0.18493600 0.67000200 59.39572 0.08648800 0.98026400 -0.17776800 -97.89551 -0.68965500 -0.06986000 -0.72076100 235.12634 2490 'point symmetry operation' ? ? -0.55854900 0.31398400 0.76774800 5.44302 0.14814200 0.94846600 -0.28011600 -24.98045 -0.81613500 -0.04272300 -0.57628000 176.53111 2491 'point symmetry operation' ? ? -0.64985100 0.14349400 0.74639300 2.36665 -0.62876300 0.45023200 -0.63399400 149.40315 -0.42702400 -0.88130600 -0.20236100 -142.65411 2492 'point symmetry operation' ? ? -0.63095700 0.20742300 0.74757500 38.06855 0.09234700 0.97682500 -0.19309000 10.49205 -0.77030200 -0.05279500 -0.63549100 300.29140 2493 'point symmetry operation' ? ? -0.68908100 0.21461600 0.69217600 32.67448 -0.57942500 0.41048400 -0.70410900 165.49339 -0.43524000 -0.88625200 -0.15850300 -215.80940 2494 'point symmetry operation' ? ? -0.80365700 0.13957400 0.57849400 130.21031 0.06759400 0.98722500 -0.14428600 117.61529 -0.59124200 -0.07685400 -0.80282500 305.04439 2495 'point symmetry operation' ? ? -0.56897900 0.29408900 0.76796800 26.76344 0.13181200 0.95440800 -0.26782700 38.74614 -0.81172000 -0.05116100 -0.58180300 282.56370 2496 'point symmetry operation' ? ? -0.84274500 0.13321700 0.52156800 159.64206 0.06670800 0.98727100 -0.14438000 -20.80369 -0.53416300 -0.08688300 -0.84090500 305.96089 2497 'point symmetry operation' ? ? -0.66582400 0.27723300 0.69269000 69.12222 -0.57550700 0.40001900 -0.71328500 280.39206 -0.47483500 -0.87357100 -0.10679300 -32.95760 2498 'point symmetry operation' ? ? -0.59692000 0.26058900 0.75880100 21.13703 0.11526300 0.96382500 -0.24032600 -4.35400 -0.79397800 -0.05599400 -0.60536300 237.55905 2499 'point symmetry operation' ? ? -0.48200500 0.43331100 0.76152000 45.79768 0.18955500 0.90013500 -0.39220600 136.94060 -0.85541800 -0.04469600 -0.51600700 326.07991 2500 'point symmetry operation' ? ? -0.52902500 0.35910200 0.76888100 17.66341 0.16090800 0.93206300 -0.32460400 36.01085 -0.83321200 -0.04800500 -0.55086700 220.27229 2501 'point symmetry operation' ? ? -0.65224100 0.15468800 0.74206000 41.65919 0.03704600 0.98429100 -0.17262200 105.59727 -0.75710500 -0.08510100 -0.64772700 297.12422 2502 'point symmetry operation' ? ? -0.63653800 0.15887400 0.75470400 46.20523 0.04736900 0.98475900 -0.16735100 113.28439 -0.76978900 -0.07077600 -0.63436200 351.60372 2503 'point symmetry operation' ? ? -0.54474300 0.32942700 0.77118900 36.47915 0.14588500 0.94281600 -0.29969200 86.63077 -0.82581600 -0.05075000 -0.56165100 331.78800 2504 'point symmetry operation' ? ? -0.56216000 0.42070900 0.71202500 4.01427 0.22653100 0.90634800 -0.35667600 -149.08537 -0.79539900 -0.03921400 -0.60481600 65.25697 2505 'point symmetry operation' ? ? -0.69061500 0.26782100 0.67180600 58.50058 -0.55862700 0.39242300 -0.73071100 210.05188 -0.45933200 -0.87993000 -0.12140200 -186.33249 2506 'point symmetry operation' ? ? -0.63067300 0.26660300 0.72881700 21.38679 0.12714800 0.96194500 -0.24185600 -80.58765 -0.76556200 -0.05986400 -0.64057200 182.09588 2507 'point symmetry operation' ? ? -0.50491600 0.39837000 0.76574200 31.79344 0.17502200 0.91595200 -0.36110900 89.27924 -0.84523800 -0.04830900 -0.53220300 271.92896 2508 'point symmetry operation' ? ? -0.77461400 0.14032000 0.61667100 102.46914 0.05637500 0.98651400 -0.15366200 -2.15563 -0.62991700 -0.08426400 -0.77207800 282.91728 2509 'point symmetry operation' ? ? -0.66078100 0.23935700 0.71139100 -5.62098 0.12406500 0.96958300 -0.21099100 -266.27754 -0.74025400 -0.05116000 -0.67037800 97.60595 2510 'point symmetry operation' ? ? -0.79528200 0.15457800 0.58620100 119.06448 0.08184500 0.98547000 -0.14882700 -71.28256 -0.60068900 -0.07038200 -0.79637900 288.91187 2511 'point symmetry operation' ? ? -0.64873300 0.07526000 0.75728500 -17.73749 -0.64174800 0.48074200 -0.59753400 97.26320 -0.40902900 -0.87362700 -0.26357500 -148.01522 2512 'point symmetry operation' ? ? -0.71519100 0.16149600 0.68001500 61.34079 0.06947500 0.98454700 -0.16075100 -51.22514 -0.69546700 -0.06772400 -0.71535900 254.84663 2513 'point symmetry operation' ? ? -0.65412200 0.24383000 0.71601100 43.48248 -0.59772600 0.41345700 -0.68686000 235.67477 -0.46351600 -0.87726900 -0.12470800 -85.33949 2514 'point symmetry operation' ? ? -0.82576900 0.18526500 0.53271200 144.75451 0.10377400 0.97829400 -0.17936500 -173.63106 -0.55437900 -0.09283300 -0.82707100 280.27910 2515 'point symmetry operation' ? ? -0.86869900 0.12518000 0.47926200 189.29245 0.06759100 0.98844700 -0.13566300 97.65448 -0.49070700 -0.08545700 -0.86712400 325.58461 2516 'point symmetry operation' ? ? -0.86370000 0.13476500 0.48565500 180.76859 0.07192200 0.98668300 -0.14588900 -87.63679 -0.49884900 -0.09107500 -0.86189100 310.51388 2517 'point symmetry operation' ? ? -0.54936400 0.27680600 0.78840200 -55.45344 0.11209100 0.95942000 -0.25874500 -207.10699 -0.82803000 -0.05377300 -0.55809900 34.67403 2518 'point symmetry operation' ? ? -0.66537800 0.28667100 0.68926900 2.23303 0.14465700 0.95533800 -0.25768900 -280.51664 -0.73235700 -0.07175300 -0.67713000 80.14825 2519 'point symmetry operation' ? ? -0.62288700 0.20153600 0.75590600 51.50083 0.06626500 0.97636700 -0.20571100 99.85282 -0.77950000 -0.07804500 -0.62152200 383.53744 2520 'point symmetry operation' ? ? -0.64610900 0.20714400 0.73459800 21.30127 -0.61462600 0.42943100 -0.66168200 193.48843 -0.45252300 -0.87902300 -0.15014400 -129.86413 2521 'point symmetry operation' ? ? -0.65320300 0.17376700 0.73697400 39.35125 0.05595100 0.98172700 -0.18188500 49.87406 -0.75511300 -0.07757300 -0.65098900 273.92560 2522 'point symmetry operation' ? ? -0.64182400 0.17521000 0.74656700 45.97895 0.03649800 0.97942500 -0.19848200 74.75671 -0.76598200 -0.10014200 -0.63501400 328.68184 2523 'point symmetry operation' ? ? -0.65004400 0.19156700 0.73535300 32.55674 0.09236800 0.98044600 -0.17376500 -21.46066 -0.75426100 -0.04503200 -0.65502900 251.28066 2524 'point symmetry operation' ? ? -0.75180400 0.15919700 0.63988100 91.22881 0.07233900 0.98447300 -0.15993800 77.01036 -0.65540700 -0.07395400 -0.75164700 282.06648 2525 'point symmetry operation' ? ? -0.81149500 0.15809000 0.56256900 130.51395 0.07571400 0.98304000 -0.16703400 -122.87431 -0.57943300 -0.09295300 -0.80970200 281.73682 2526 'point symmetry operation' ? ? -0.69976100 0.15813900 0.69665400 55.24690 0.05295400 0.98399000 -0.17017400 25.69249 -0.71241200 -0.08219000 -0.69693200 258.35686 2527 'point symmetry operation' ? ? -0.69017500 0.14468600 0.70903000 52.41854 0.04941200 0.98694400 -0.15330000 76.15738 -0.72195300 -0.07076900 -0.68831400 273.94667 2528 'point symmetry operation' ? ? -0.69396700 -0.26163500 0.67078800 23.10070 -0.68947700 0.50989300 -0.51442400 -23.57940 -0.20743800 -0.81948600 -0.53424000 36.83351 2529 'point symmetry operation' ? ? -0.60192000 0.23412100 0.76346500 38.42451 0.10015200 0.97064000 -0.21869300 49.81731 -0.79225100 -0.05517400 -0.60769700 339.67932 2530 'point symmetry operation' ? ? -0.72956200 0.14919300 0.66744300 76.57574 0.06219400 0.98634500 -0.15249400 136.26655 -0.68108000 -0.06974300 -0.72888000 278.95695 2531 'point symmetry operation' ? ? 0.44721400 -0.85065100 -0.27639400 0.00000 -0.52573200 0.00000000 -0.85065100 0.00000 0.72360600 0.52573200 -0.44721400 0.00000 2532 'point symmetry operation' ? ? -0.35435700 -0.70882000 -0.60992400 181.29159 -0.16135900 0.68881300 -0.70675400 68.48354 0.92108400 -0.15202500 -0.35845900 -127.70797 2533 'point symmetry operation' ? ? -0.14746800 -0.68979300 -0.70883000 140.06958 -0.02551600 0.71908000 -0.69446000 162.56423 0.98873800 -0.08432300 -0.12364100 -267.10670 2534 'point symmetry operation' ? ? -0.27566400 -0.71055900 -0.64739200 222.97393 -0.06583900 0.68586200 -0.72474800 -1.52090 0.95899700 -0.15716300 -0.23585000 -178.56858 2535 'point symmetry operation' ? ? -0.28975500 -0.69364700 -0.65946800 206.19100 -0.10361400 0.70771100 -0.69886400 28.80103 0.95147600 -0.13416800 -0.27693400 -158.27700 2536 'point symmetry operation' ? ? -0.47555200 -0.70201000 -0.53012600 140.45297 -0.16239500 0.66233000 -0.73140100 71.16753 0.86456900 -0.26172900 -0.42897400 -83.81557 2537 'point symmetry operation' ? ? 0.29569900 -0.95427600 -0.04382500 -191.89875 -0.56235700 -0.13680400 -0.81550000 45.24994 0.77221600 0.26578800 -0.57709600 61.68022 2538 'point symmetry operation' ? ? -0.38339300 -0.68741300 -0.61682500 197.35252 -0.16440500 0.70798800 -0.68682200 156.35395 0.90883500 -0.16191400 -0.38445100 -168.34403 2539 'point symmetry operation' ? ? 0.27494700 -0.96022400 0.04873800 -265.25753 -0.51644900 -0.19025700 -0.83491500 11.84034 0.81097700 0.20438700 -0.54821700 67.28814 2540 'point symmetry operation' ? ? -0.17679100 -0.68638600 -0.70542200 104.48909 -0.04489600 0.72158900 -0.69086500 221.29649 0.98322400 -0.09046800 -0.15838700 -252.88366 2541 'point symmetry operation' ? ? -0.45898400 -0.70441000 -0.54142600 172.00753 -0.17054300 0.66793000 -0.72442100 172.86372 0.87192300 -0.24016000 -0.42670100 -150.30433 2542 'point symmetry operation' ? ? -0.12082500 -0.69137100 -0.71232600 175.86441 -0.00533000 0.71802400 -0.69599800 102.05835 0.99266000 -0.08029700 -0.09044000 -279.61819 2543 'point symmetry operation' ? ? 0.23557900 -0.96755200 0.09136400 -213.66739 -0.54021000 -0.20851600 -0.81528900 191.34547 0.80788400 0.14270900 -0.57180200 -47.08548 2544 'point symmetry operation' ? ? -0.42630900 -0.70132200 -0.57132200 166.81114 -0.16726000 0.68181300 -0.71214900 115.81358 0.88898000 -0.20803600 -0.40796600 -125.14525 2545 'point symmetry operation' ? ? -0.55601200 -0.71820200 -0.41837400 138.89223 -0.16966500 0.59082500 -0.78875900 270.17917 0.81367400 -0.36757600 -0.45035900 -186.79005 2546 'point symmetry operation' ? ? -0.50609400 -0.71251400 -0.48599800 131.83322 -0.16880600 0.63442200 -0.75433000 140.29436 0.84579800 -0.29972100 -0.44135300 -114.30743 2547 'point symmetry operation' ? ? -0.33363800 -0.69609800 -0.63571500 137.86016 -0.19661200 0.71090700 -0.67524600 230.68681 0.92197100 -0.10029800 -0.37404600 -170.13911 2548 'point symmetry operation' ? ? -0.35456600 -0.68752200 -0.63371800 171.11876 -0.19905700 0.71771600 -0.66727900 264.35242 0.91359700 -0.11044800 -0.39133300 -198.56920 2549 'point symmetry operation' ? ? -0.48622600 -0.71008400 -0.50928000 175.96550 -0.17294000 0.64947900 -0.74045200 234.92807 0.85654900 -0.27195200 -0.43859500 -181.00808 2550 'point symmetry operation' ? ? -0.50531600 -0.71332700 -0.48561400 133.39822 -0.08712700 0.60204600 -0.79369500 -87.36027 0.85852500 -0.35875600 -0.36637300 -32.77441 2551 'point symmetry operation' ? ? 0.24584500 -0.96428300 0.09859300 -279.46264 -0.51188600 -0.21553000 -0.83157700 56.59710 0.82312400 0.15397100 -0.54658900 31.00612 2552 'point symmetry operation' ? ? -0.40052100 -0.70519400 -0.58505200 171.39626 -0.13383300 0.67667800 -0.72401500 24.91484 0.90646100 -0.21168400 -0.36540100 -100.56480 2553 'point symmetry operation' ? ? -0.53181500 -0.71747100 -0.44989900 132.78967 -0.17004800 0.61090600 -0.77322600 206.83267 0.82961300 -0.33470800 -0.44689300 -150.04726 2554 'point symmetry operation' ? ? -0.20869000 -0.69160100 -0.69147500 168.91423 -0.08194000 0.71692200 -0.69232300 120.05898 0.97454300 -0.08782100 -0.20628400 -218.17574 2555 'point symmetry operation' ? ? -0.36950400 -0.69352600 -0.61845700 229.17608 -0.11510800 0.69459500 -0.71013400 -162.63116 0.92207200 -0.19120700 -0.33648500 -38.62339 2556 'point symmetry operation' ? ? -0.19503400 -0.68610100 -0.70087700 207.87949 -0.04053500 0.71962800 -0.69317700 62.92328 0.97995900 -0.10678300 -0.16816200 -235.69998 2557 'point symmetry operation' ? ? 0.31594800 -0.94196500 -0.11349200 -157.85724 -0.56369500 -0.09014800 -0.82104900 5.53397 0.76316800 0.32338400 -0.55946300 82.05943 2558 'point symmetry operation' ? ? -0.28532200 -0.68613800 -0.66918400 192.32485 -0.12142400 0.71845900 -0.68488900 76.41446 0.95070900 -0.11415900 -0.28830600 -168.83588 2559 'point symmetry operation' ? ? 0.25259500 -0.96604000 0.05443100 -216.01056 -0.55531000 -0.19080800 -0.80945900 134.36938 0.79235500 0.17423900 -0.58464900 -0.72673 2560 'point symmetry operation' ? ? -0.16338300 -0.70923100 -0.68578300 252.49695 0.00956700 0.69395200 -0.71995800 -31.16999 0.98651700 -0.12418900 -0.10659500 -254.81723 2561 'point symmetry operation' ? ? -0.08050900 -0.68812200 -0.72111500 109.70867 0.02505300 0.72183800 -0.69160900 200.41586 0.99643900 -0.07374600 -0.04087500 -314.91423 2562 'point symmetry operation' ? ? -0.09075500 -0.69461900 -0.71363100 210.79884 0.02296200 0.71493800 -0.69881200 44.82942 0.99560900 -0.07980700 -0.04893400 -300.55055 2563 'point symmetry operation' ? ? -0.46629200 -0.70299300 -0.53700500 166.88810 -0.20023000 0.67515500 -0.70998200 -134.74722 0.86167300 -0.22353400 -0.45557900 34.09221 2564 'point symmetry operation' ? ? -0.37422900 -0.71717400 -0.58789100 222.07149 -0.09308800 0.65980600 -0.74564800 -185.39345 0.92265200 -0.22431700 -0.31367900 -37.84091 2565 'point symmetry operation' ? ? -0.37763800 -0.70328400 -0.60231400 200.20513 -0.19246300 0.69589100 -0.69187800 268.88256 0.90573100 -0.14535600 -0.39815000 -217.58694 2566 'point symmetry operation' ? ? 0.26758500 -0.96342600 0.01450200 -215.40714 -0.56531000 -0.16916300 -0.80734800 82.66255 0.78027200 0.20783600 -0.58989900 39.02475 2567 'point symmetry operation' ? ? -0.34296100 -0.69604700 -0.63079100 154.66179 -0.18001700 0.70777400 -0.68311900 174.01619 0.92193900 -0.12073000 -0.36803900 -157.70012 2568 'point symmetry operation' ? ? -0.34350900 -0.71154700 -0.61294700 177.26020 -0.20446000 0.69366700 -0.69066800 221.19157 0.91662300 -0.11192700 -0.38376300 -188.11585 2569 'point symmetry operation' ? ? -0.36489300 -0.67818700 -0.63790000 182.66354 -0.15093800 0.71916700 -0.67824600 106.18603 0.91873400 -0.15120300 -0.36478200 -141.49585 2570 'point symmetry operation' ? ? -0.24477100 -0.68977000 -0.68139900 125.83276 -0.08842200 0.71572900 -0.69275900 186.61306 0.96554100 -0.10931600 -0.23618000 -207.74153 2571 'point symmetry operation' ? ? -0.17018300 -0.70227600 -0.69126500 228.86999 -0.03005900 0.70487200 -0.70869900 14.40284 0.98495400 -0.09982900 -0.14106700 -242.73196 2572 'point symmetry operation' ? ? -0.29345600 -0.69506400 -0.65633100 151.85861 -0.14775300 0.71128600 -0.68719900 142.08950 0.94448600 -0.10468700 -0.31142900 -164.95509 2573 'point symmetry operation' ? ? -0.30174600 -0.68366800 -0.66449100 134.50029 -0.15815500 0.72321600 -0.67227000 191.85600 0.94017900 -0.09776100 -0.32635300 -169.39727 2574 'point symmetry operation' ? ? 0.50624100 -0.79803300 -0.32690300 32.15469 -0.48443600 0.05045700 -0.87337100 -5.78399 0.71347200 0.60049900 -0.36105200 -37.13438 2575 'point symmetry operation' ? ? -0.41436900 -0.69515800 -0.58741300 202.61030 -0.17726300 0.69471600 -0.69710000 208.78268 0.89268000 -0.18472900 -0.41109400 -186.27720 2576 'point symmetry operation' ? ? -0.26543300 -0.68420500 -0.67927200 94.05430 -0.11597300 0.72208700 -0.68201300 236.76936 0.95712900 -0.10225100 -0.27101400 -193.24475 2577 'point symmetry operation' ? ? -0.67082000 -0.68819100 -0.27639300 0.00000 -0.16246000 0.50000000 -0.85065100 0.00000 0.72360700 -0.52573100 -0.44721400 0.00000 2578 'point symmetry operation' ? ? -0.88955400 0.25842800 -0.37670800 198.25571 0.44684900 0.66366000 -0.59990100 -59.39095 0.09497500 -0.70197600 -0.70584000 105.03938 2579 'point symmetry operation' ? ? -0.78380900 0.23411200 -0.57518200 339.51050 0.53793200 0.71873800 -0.44050500 -45.72865 0.31027800 -0.65468100 -0.68929100 5.82825 2580 'point symmetry operation' ? ? -0.83237100 0.25978100 -0.48956200 208.99201 0.52337300 0.65902900 -0.54015000 -153.72154 0.18231500 -0.70582900 -0.68452000 119.57568 2581 'point symmetry operation' ? ? -0.85423100 0.26210300 -0.44898800 206.05955 0.49256200 0.68434800 -0.53763500 -114.11104 0.16634800 -0.68041900 -0.71369400 113.63923 2582 'point symmetry operation' ? ? -0.89311700 0.32470700 -0.31129900 153.29697 0.44815700 0.58277000 -0.67789000 -23.40891 -0.03870000 -0.74494600 -0.66600200 88.14148 2583 'point symmetry operation' ? ? -0.78234100 -0.61799700 -0.07760400 -87.46448 -0.12670700 0.27990200 -0.95163100 119.47858 0.60982600 -0.73466700 -0.29728300 -144.05527 2584 'point symmetry operation' ? ? -0.89298600 0.28459800 -0.34868100 285.12001 0.44557800 0.66834800 -0.59562700 -13.88786 0.06352600 -0.68725200 -0.72363700 101.23167 2585 'point symmetry operation' ? ? -0.79091300 -0.60713700 -0.07642400 -137.70148 -0.06373300 0.20594100 -0.97648700 114.68135 0.60860000 -0.76744600 -0.20157700 -207.16140 2586 'point symmetry operation' ? ? -0.80182000 0.24126600 -0.54669400 350.86743 0.52706200 0.71664200 -0.45676000 18.61708 0.28158400 -0.65438100 -0.70178100 -19.63520 2587 'point symmetry operation' ? ? -0.89723400 0.31152400 -0.31292900 272.60068 0.44107600 0.59927100 -0.66807700 15.61516 -0.02059200 -0.73744700 -0.67509200 86.63001 2588 'point symmetry operation' ? ? -0.76514300 0.23000700 -0.60137600 325.95013 0.54932100 0.72041600 -0.42337600 -110.66578 0.33586100 -0.65429100 -0.67756900 32.24885 2589 'point symmetry operation' ? ? -0.81688400 -0.57589100 -0.03239900 69.23587 -0.07423400 0.16066900 -0.98421300 186.21290 0.57200500 -0.80158300 -0.17399900 -212.16730 2590 'point symmetry operation' ? ? -0.89582400 0.29755500 -0.33008900 218.98212 0.44411000 0.62658000 -0.64044000 -15.94647 0.01626100 -0.72031800 -0.69345300 93.23373 2591 'point symmetry operation' ? ? -0.88967300 0.35341100 -0.28910700 344.22132 0.43666800 0.47353100 -0.76491100 83.86810 -0.13342700 -0.80676500 -0.57561100 40.69383 2592 'point symmetry operation' ? ? -0.89435300 0.33199500 -0.29985300 212.87413 0.44113000 0.54298000 -0.71454700 18.75112 -0.07441200 -0.77133200 -0.63206900 66.79533 2593 'point symmetry operation' ? ? -0.90342100 0.23858600 -0.35624000 308.58618 0.41334900 0.70538500 -0.57582600 60.94335 0.11390200 -0.66746400 -0.73587900 47.21727 2594 'point symmetry operation' ? ? -0.90637000 0.25303600 -0.33832700 360.97956 0.41247000 0.70330300 -0.57899400 64.49027 0.09144000 -0.66433300 -0.74182300 64.25033 2595 'point symmetry operation' ? ? -0.89737400 0.32162900 -0.30211500 332.73060 0.43821600 0.56912200 -0.69575000 48.64389 -0.05183300 -0.75674000 -0.65165900 76.43897 2596 'point symmetry operation' ? ? -0.85527100 0.35538800 -0.37710800 20.63058 0.51369700 0.48596400 -0.70707500 -122.97211 -0.06802500 -0.79846000 -0.59819300 104.65789 2597 'point symmetry operation' ? ? -0.80754900 -0.58698000 -0.05760200 -90.27969 -0.04600600 0.16005600 -0.98603500 135.54972 0.58800300 -0.79362300 -0.15625800 -236.09267 2598 'point symmetry operation' ? ? -0.87949600 0.29577600 -0.37283100 149.42555 0.47356500 0.62152500 -0.62405300 -77.76759 0.04714400 -0.72541200 -0.68669800 108.32754 2599 'point symmetry operation' ? ? -0.89267700 0.34169500 -0.29389100 278.19195 0.43837800 0.50686400 -0.74223600 53.54073 -0.10465500 -0.79141200 -0.60225800 51.66744 2600 'point symmetry operation' ? ? -0.82885300 0.23472100 -0.50784600 289.55587 0.50091500 0.71562800 -0.48678600 -61.97377 0.24917100 -0.65786200 -0.71072700 53.51030 2601 'point symmetry operation' ? ? -0.86856400 0.29571100 -0.39768200 15.27255 0.48876800 0.64371800 -0.58884000 -212.11911 0.08186900 -0.70582000 -0.70364500 187.70851 2602 'point symmetry operation' ? ? -0.80349400 0.25202200 -0.53933500 282.75077 0.53367000 0.70640300 -0.46496400 -127.65313 0.26380700 -0.66142200 -0.70208800 80.52484 2603 'point symmetry operation' ? ? -0.76925400 -0.62779600 -0.11883100 -113.23914 -0.13786900 0.34469100 -0.92853700 89.11340 0.62389200 -0.69789700 -0.35170900 -104.49374 2604 'point symmetry operation' ? ? -0.86254100 0.25665900 -0.43606100 236.66967 0.47658500 0.70159000 -0.52975300 -77.49721 0.16997000 -0.66475400 -0.72747000 96.51487 2605 'point symmetry operation' ? ? -0.80836700 -0.58775100 -0.03303900 1.35292 -0.09908700 0.19117400 -0.97654200 165.10651 0.58028000 -0.78613100 -0.21277800 -193.53080 2606 'point symmetry operation' ? ? -0.76733900 0.24115700 -0.59416600 257.42025 0.56933000 0.68256000 -0.45823000 -225.55503 0.29504900 -0.68989500 -0.66105400 111.88247 2607 'point symmetry operation' ? ? -0.73543300 0.22868400 -0.63784100 385.36828 0.56529100 0.72609100 -0.39145700 -32.25918 0.37361100 -0.64845600 -0.66326500 -42.70756 2608 'point symmetry operation' ? ? -0.73976700 0.22666300 -0.63353600 320.09799 0.56585600 0.71903000 -0.40348800 -177.15275 0.36407600 -0.65697700 -0.66017400 54.13395 2609 'point symmetry operation' ? ? -0.90991000 0.30425200 -0.28194700 -43.49113 0.41359100 0.61348500 -0.67274000 -134.95834 -0.03171200 -0.72874400 -0.68405200 164.51583 2610 'point symmetry operation' ? ? -0.85775000 0.29066600 -0.42400100 -1.24345 0.50812900 0.60438300 -0.61361700 -228.25525 0.07790200 -0.74177800 -0.66610600 181.70392 2611 'point symmetry operation' ? ? -0.90515000 0.25976400 -0.33649000 387.92720 0.41973300 0.67143700 -0.61073400 50.51123 0.06728500 -0.69404200 -0.71678300 81.76097 2612 'point symmetry operation' ? ? -0.80007700 -0.59839300 -0.04244600 -57.58567 -0.11747000 0.22566100 -0.96709800 144.01483 0.58828300 -0.76876700 -0.25084000 -175.21366 2613 'point symmetry operation' ? ? -0.89701700 0.25154800 -0.36343400 272.35399 0.42920900 0.69209500 -0.58033100 17.21890 0.10555000 -0.67655600 -0.72878800 67.80801 2614 'point symmetry operation' ? ? -0.90773600 0.23127800 -0.35003700 330.26814 0.40678200 0.68938500 -0.59939700 33.45373 0.10268300 -0.68648200 -0.71986000 74.41829 2615 'point symmetry operation' ? ? -0.88554000 0.28675700 -0.36549800 230.89004 0.45681400 0.68059700 -0.57280800 -36.49839 0.08450000 -0.67420900 -0.73369100 100.10034 2616 'point symmetry operation' ? ? -0.83920400 0.25023600 -0.48282400 305.53809 0.50042200 0.70288200 -0.50550500 8.67976 0.21287300 -0.66583700 -0.71508500 19.64335 2617 'point symmetry operation' ? ? -0.79196000 0.23246500 -0.56458700 266.91399 0.53823800 0.70237300 -0.46580300 -176.12156 0.28826800 -0.67278000 -0.68137300 96.15455 2618 'point symmetry operation' ? ? -0.87645600 0.24235900 -0.41603600 257.82350 0.45415000 0.70311300 -0.54715700 -11.68763 0.15991200 -0.66850200 -0.72631500 62.05626 2619 'point symmetry operation' ? ? -0.88245300 0.24848400 -0.39941400 284.00960 0.44565000 0.71341000 -0.54078000 30.80179 0.15057100 -0.65521200 -0.74028800 44.54388 2620 'point symmetry operation' ? ? -0.61785800 -0.69359800 -0.37036900 35.10459 -0.14989400 0.56629700 -0.81045700 -32.65439 0.77187000 -0.44523100 -0.45385800 12.15304 2621 'point symmetry operation' ? ? -0.90006100 0.29050500 -0.32480200 330.81566 0.43482400 0.64765200 -0.62568000 17.71772 0.02859600 -0.70438200 -0.70924500 97.91439 2622 'point symmetry operation' ? ? -0.85678600 0.25087400 -0.45053200 313.03171 0.47914200 0.71027700 -0.51568400 65.23188 0.19063100 -0.65770000 -0.72876000 -2.29705 2623 'point symmetry operation' ? ? -0.86180400 0.42532500 -0.27639300 0.00000 0.42532500 0.30901700 -0.85065100 0.00000 -0.27639300 -0.85065100 -0.44721300 0.00000 2624 'point symmetry operation' ? ? -0.12791800 0.99154500 0.02184300 -39.18665 0.64527200 0.09993000 -0.75738900 -44.94040 -0.75316700 -0.08278800 -0.65259800 224.30036 2625 'point symmetry operation' ? ? -0.19191600 0.98089800 0.03175000 91.74026 0.80435500 0.17574500 -0.56756200 -123.17672 -0.56230000 -0.08338600 -0.82271800 306.27396 2626 'point symmetry operation' ? ? -0.12544900 0.99210000 0.00070500 -101.26691 0.73806700 0.09380200 -0.66817500 -116.43545 -0.66296300 -0.08330100 -0.74400400 240.40408 2627 'point symmetry operation' ? ? -0.13991500 0.98943500 0.03797500 -74.74976 0.71049300 0.12703400 -0.69214300 -86.74002 -0.68965500 -0.06986000 -0.72076000 235.12633 2628 'point symmetry operation' ? ? -0.03171000 0.99907200 -0.02915900 -22.07575 0.57699000 -0.00552400 -0.81673200 -12.89597 -0.81613500 -0.04272300 -0.57627900 176.53105 2629 'point symmetry operation' ? ? -0.79880500 0.47253800 -0.37231600 142.82215 0.42374700 0.00265800 -0.90577700 43.91727 -0.42702400 -0.88130600 -0.20236000 -142.65412 2630 'point symmetry operation' ? ? -0.10715000 0.99311400 0.04737300 21.74253 0.62861300 0.10458400 -0.77065400 -32.96308 -0.77030200 -0.05279600 -0.63549000 300.29129 2631 'point symmetry operation' ? ? -0.76400400 0.45671300 -0.45575300 167.49050 0.47630200 -0.07726500 -0.87588000 20.06496 -0.43524000 -0.88625200 -0.15850200 -215.80936 2632 'point symmetry operation' ? ? -0.18405800 0.98203700 0.04154100 152.09624 0.78521000 0.17232700 -0.59476700 -87.49220 -0.59124200 -0.07685400 -0.80282400 305.04428 2633 'point symmetry operation' ? ? -0.05046400 0.99857500 -0.01740400 45.12028 0.58186300 0.01523300 -0.81314400 -13.48029 -0.81172000 -0.05116100 -0.58180200 282.56358 2634 'point symmetry operation' ? ? -0.19698100 0.98011700 0.02386000 29.54685 0.82211200 0.17838700 -0.54065700 -158.25727 -0.53416300 -0.08688400 -0.84090500 305.96088 2635 'point symmetry operation' ? ? -0.75309200 0.46611000 -0.46432100 288.02874 0.45539500 -0.14005100 -0.87920500 20.90676 -0.47483500 -0.87357100 -0.10679300 -32.95769 2636 'point symmetry operation' ? ? -0.07483800 0.99717800 0.00591900 2.39092 0.60332300 0.05000300 -0.79592800 -21.44794 -0.79397800 -0.05599500 -0.60536200 237.55897 2637 'point symmetry operation' ? ? 0.03132900 0.98998000 -0.13768700 144.39073 0.51699000 -0.13394600 -0.84544700 -1.23917 -0.85541800 -0.04469600 -0.51600600 326.07973 2638 'point symmetry operation' ? ? -0.01044600 0.99741300 -0.07111900 39.70677 0.55285500 -0.05350300 -0.83155800 -5.67091 -0.83321200 -0.04800500 -0.55086600 220.27219 2639 'point symmetry operation' ? ? -0.16632100 0.98391800 0.06513600 113.30256 0.63176600 0.15704500 -0.75908400 -6.98886 -0.75710600 -0.08510100 -0.64772600 297.12406 2640 'point symmetry operation' ? ? -0.15165100 0.98565600 0.07405600 122.01828 0.62002100 0.15320900 -0.76948100 -8.93694 -0.76979000 -0.07077600 -0.63436100 351.60354 2641 'point symmetry operation' ? ? -0.02959000 0.99847000 -0.04671300 93.66364 0.56316200 -0.02195700 -0.82605500 -7.92331 -0.82581700 -0.05075000 -0.56165000 331.78783 2642 'point symmetry operation' ? ? 0.04172600 0.99199400 -0.11919100 -140.54815 0.60464800 -0.12004100 -0.78739500 -49.88769 -0.79539900 -0.03921400 -0.60481500 65.25702 2643 'point symmetry operation' ? ? -0.74469900 0.45597800 -0.48734800 217.84888 0.48418900 -0.13344700 -0.86472700 9.27221 -0.45933200 -0.87992900 -0.12140100 -186.33247 2644 'point symmetry operation' ? ? -0.07396400 0.99725000 -0.00480200 -70.03445 0.63909700 0.04370300 -0.76788400 -45.24297 -0.76556200 -0.05986500 -0.64057100 182.09585 2645 'point symmetry operation' ? ? 0.01042700 0.99422500 -0.10680800 94.73449 0.53428800 -0.09582800 -0.83985300 -2.64852 -0.84523800 -0.04830900 -0.53220200 271.92882 2646 'point symmetry operation' ? ? -0.18575400 0.98159200 0.04442000 29.61477 0.75412200 0.17139700 -0.63397400 -98.12003 -0.62991700 -0.08426400 -0.77207800 282.91723 2647 'point symmetry operation' ? ? -0.08620000 0.99609400 0.01916800 -254.98200 0.66677800 0.07197500 -0.74177300 -76.93840 -0.74025500 -0.05116000 -0.67037700 97.60604 2648 'point symmetry operation' ? ? -0.16791700 0.98500600 0.03960300 -31.00061 0.78165000 0.15751400 -0.60350000 -135.26453 -0.60068900 -0.07038200 -0.79637800 288.91186 2649 'point symmetry operation' ? ? -0.81080900 0.48046900 -0.33427500 87.02156 0.41867100 0.07698100 -0.90486900 46.92531 -0.40902900 -0.87362700 -0.26357400 -148.01522 2650 'point symmetry operation' ? ? -0.15493300 0.98626500 0.05725300 -29.76252 0.70165600 0.15065000 -0.69640800 -74.16796 -0.69546800 -0.06772400 -0.71535900 254.84659 2651 'point symmetry operation' ? ? -0.77060700 0.46856800 -0.43198300 237.57690 0.43739900 -0.10413100 -0.89321800 31.47320 -0.46351600 -0.87726900 -0.12470700 -85.33954 2652 'point symmetry operation' ? ? -0.15648200 0.98766300 -0.00597000 -120.40119 0.81742100 0.12611200 -0.56206600 -191.32462 -0.55437900 -0.09283300 -0.82707000 280.27917 2653 'point symmetry operation' ? ? -0.20416100 0.97875200 0.01907600 151.36980 0.84706800 0.18639300 -0.49772800 -149.85088 -0.49070800 -0.08545700 -0.86712300 325.58455 2654 'point symmetry operation' ? ? -0.19849700 0.98003600 0.01132700 -27.48675 0.84365200 0.17673200 -0.50696800 -199.00235 -0.49884900 -0.09107600 -0.86189000 310.51391 2655 'point symmetry operation' ? ? -0.06315900 0.99800100 -0.00245100 -214.10658 0.55711400 0.03321900 -0.82977100 -11.26021 -0.82803100 -0.05377300 -0.55809800 34.67408 2656 'point symmetry operation' ? ? -0.06803700 0.99716700 -0.03208100 -266.09717 0.67751300 0.02257500 -0.73516400 -88.80812 -0.73235700 -0.07175400 -0.67712900 80.14836 2657 'point symmetry operation' ? ? -0.12946200 0.99085800 0.03794500 110.88054 0.61287800 0.11004100 -0.78247800 -18.12393 -0.77950000 -0.07804500 -0.62152100 383.53725 2658 'point symmetry operation' ? ? -0.78420400 0.47242400 -0.40229400 190.60089 0.42455600 -0.06430400 -0.90311500 39.53247 -0.45252300 -0.87902200 -0.15014300 -129.86416 2659 'point symmetry operation' ? ? -0.14863800 0.98737500 0.05475400 59.59342 0.63852200 0.13810800 -0.75711000 -22.01329 -0.75511300 -0.07757400 -0.65098900 273.92548 2660 'point symmetry operation' ? ? -0.16362400 0.98563100 0.04193500 85.30633 0.62169000 0.13602400 -0.77136200 -20.62744 -0.76598300 -0.10014300 -0.63501300 328.68168 2661 'point symmetry operation' ? ? -0.11302900 0.99165700 0.06197600 -10.34959 0.64677200 0.12078300 -0.75305900 -37.59497 -0.75426200 -0.04503200 -0.65502800 251.28058 2662 'point symmetry operation' ? ? -0.16352300 0.98548400 0.04562400 101.43266 0.73736100 0.15281400 -0.65798600 -62.96620 -0.65540700 -0.07395400 -0.75164600 282.06638 2663 'point symmetry operation' ? ? -0.17875900 0.98377900 0.01498500 -76.52921 0.79517400 0.15342300 -0.58665100 -162.09634 -0.57943400 -0.09295400 -0.80970100 281.73686 2664 'point symmetry operation' ? ? -0.16587600 0.98469800 0.05343300 41.50740 0.68187600 0.15367000 -0.71514400 -44.60347 -0.71241200 -0.08219100 -0.69693100 258.35678 2665 'point symmetry operation' ? ? -0.16628300 0.98335000 0.07330600 88.62837 0.67166500 0.16737800 -0.72170000 -26.31904 -0.72195300 -0.07076900 -0.68831300 273.94654 2666 'point symmetry operation' ? ? -0.87018000 0.40408700 -0.28196100 -15.28681 0.44694200 0.40639500 -0.79692300 -29.25650 -0.20743800 -0.81948600 -0.53423900 36.83352 2667 'point symmetry operation' ? ? -0.09075500 0.99548200 0.02793400 59.25310 0.60340900 0.07728200 -0.79367800 -21.14944 -0.79225100 -0.05517400 -0.60769600 339.67917 2668 'point symmetry operation' ? ? -0.16629800 0.98417400 0.06122100 153.26061 0.71307400 0.16290700 -0.68190000 -30.71914 -0.68108100 -0.06974400 -0.72887900 278.95681 2669 'point symmetry operation' ? ? 0.13819600 0.95105700 -0.27639300 0.00000 0.42532500 -0.30901700 -0.85065100 0.00000 -0.89442700 0.00000000 -0.44721300 0.00000 2670 'point symmetry operation' ? ? 0.87799800 0.47738800 0.03494700 -202.89858 0.15969800 -0.22332200 -0.96157400 91.86498 -0.45123900 0.84984000 -0.27231300 65.26043 2671 'point symmetry operation' ? ? 0.81023700 0.51853100 0.27320800 -260.83161 0.40556600 -0.15950100 -0.90004200 37.25044 -0.42312200 0.84005000 -0.33953200 219.02460 2672 'point symmetry operation' ? ? 0.86816200 0.47435800 0.14587900 -279.03591 0.28154500 -0.22869500 -0.93189600 58.80924 -0.40869000 0.85010800 -0.33209700 16.93595 2673 'point symmetry operation' ? ? 0.86603500 0.48320100 0.12845600 -248.16837 0.24900600 -0.19404300 -0.94886400 73.08823 -0.43356600 0.85373500 -0.28836800 38.29333 2674 'point symmetry operation' ? ? 0.91823500 0.38913500 -0.07361300 -143.30633 0.04606300 -0.28955100 -0.95605400 88.17779 -0.39334800 0.87449000 -0.28380000 59.20183 2675 'point symmetry operation' ? ? 0.26906000 0.81024800 -0.52067800 180.71304 0.32829600 -0.58539400 -0.74130700 -77.01089 -0.90544300 0.02851900 -0.42350700 63.94719 2676 'point symmetry operation' ? ? 0.88811800 0.45898800 0.02400600 -228.80171 0.13175300 -0.20420100 -0.97002200 125.48949 -0.44032600 0.86465700 -0.24182700 153.74125 2677 'point symmetry operation' ? ? 0.31848700 0.76112400 -0.56502800 228.55379 0.35734800 -0.64849300 -0.67213000 -141.25227 -0.87799100 0.01215300 -0.47852200 53.29525 2678 'point symmetry operation' ? ? 0.82276900 0.51220800 0.24636400 -217.12999 0.37279700 -0.15913300 -0.91416600 49.60785 -0.42903800 0.84399100 -0.32187800 272.45869 2679 'point symmetry operation' ? ? 0.91111900 0.40726200 -0.06325400 -196.06396 0.05725600 -0.27706400 -0.95914400 125.78620 -0.40814800 0.87027200 -0.27575600 166.72288 2680 'point symmetry operation' ? ? 0.79848100 0.52233200 0.29932800 -303.72666 0.43605600 -0.15899800 -0.88576200 25.05355 -0.41506900 0.83778800 -0.35472300 163.25712 2681 'point symmetry operation' ? ? 0.33879700 0.71844300 -0.60750000 140.34689 0.31674800 -0.69509200 -0.64538200 -76.12569 -0.88593800 0.02622900 -0.46306100 242.88152 2682 'point symmetry operation' ? ? 0.90207600 0.43069200 -0.02764800 -183.64118 0.09035200 -0.25110800 -0.96373300 106.91196 -0.42201400 0.86686200 -0.26543200 108.37795 2683 'point symmetry operation' ? ? 0.93420100 0.31178900 -0.17337100 -184.44104 -0.03970200 -0.39209400 -0.91906800 132.47253 -0.35453300 0.86547600 -0.35391600 274.97402 2684 'point symmetry operation' ? ? 0.92409900 0.36415600 -0.11589700 -148.35784 0.01197000 -0.33070800 -0.94365700 100.77861 -0.38196600 0.87064500 -0.30996500 134.02338 2685 'point symmetry operation' ? ? 0.85901400 0.50987400 0.04608800 -178.11589 0.15679600 -0.17632600 -0.97176400 120.77003 -0.48735000 0.84198400 -0.23141200 234.21858 2686 'point symmetry operation' ? ? 0.86659700 0.49788200 0.03353300 -215.52933 0.13676900 -0.17235500 -0.97549400 145.54451 -0.47990100 0.84994500 -0.21745700 266.37808 2687 'point symmetry operation' ? ? 0.91787900 0.38506700 -0.09602900 -210.85355 0.02922800 -0.30690800 -0.95129000 143.40026 -0.39578200 0.87036200 -0.29295900 232.15509 2688 'point symmetry operation' ? ? 0.94605600 0.31672400 -0.06829400 -127.39450 0.06003600 -0.37849200 -0.92365600 30.89288 -0.31839200 0.86973000 -0.37708900 -96.52625 2689 'point symmetry operation' ? ? 0.34754000 0.72326000 -0.59675100 219.10011 0.34598700 -0.69042800 -0.63529600 -147.72433 -0.87149800 0.01432300 -0.49019000 111.51958 2690 'point symmetry operation' ? ? 0.90285700 0.42981500 0.01043400 -183.69776 0.13400300 -0.25825800 -0.95673700 77.54078 -0.40852500 0.86519500 -0.29076600 18.79493 2691 'point symmetry operation' ? ? 0.92944000 0.33834500 -0.14719100 -164.05123 -0.01486100 -0.36427100 -0.93117400 115.91641 -0.36867500 0.86765700 -0.33354000 206.34316 2692 'point symmetry operation' ? ? 0.83186800 0.51686200 0.20211300 -251.67977 0.32775900 -0.16366400 -0.93047700 61.57299 -0.44785000 0.84027800 -0.30555200 153.01247 2693 'point symmetry operation' ? ? 0.89638800 0.43971600 0.05602200 -208.10505 0.17291900 -0.23050600 -0.95758400 56.09597 -0.40815100 0.86805400 -0.28265700 -184.41206 2694 'point symmetry operation' ? ? 0.83335200 0.49989200 0.23586600 -299.78136 0.36070700 -0.16849400 -0.91733300 50.60769 -0.41882500 0.84954000 -0.32072900 101.47732 2695 'point symmetry operation' ? ? 0.24871100 0.85124600 -0.46208600 166.17161 0.33680600 -0.52331300 -0.78275500 -62.72780 -0.90813200 0.03904700 -0.41685900 11.64011 2696 'point symmetry operation' ? ? 0.85961300 0.49439000 0.12901500 -238.77189 0.24274900 -0.17298100 -0.95454200 81.80122 -0.44959800 0.85185500 -0.26870900 87.35029 2697 'point symmetry operation' ? ? 0.31369200 0.74312100 -0.59107400 166.20794 0.31274400 -0.66862200 -0.67463800 -81.85402 -0.89654200 0.02677400 -0.44214800 174.33020 2698 'point symmetry operation' ? ? 0.82500500 0.49864100 0.26594000 -358.83138 0.41098700 -0.20640100 -0.88796900 24.21594 -0.38788700 0.84187600 -0.37521600 17.65438 2699 'point symmetry operation' ? ? 0.77910800 0.52551300 0.34180200 -268.90939 0.48097900 -0.15141200 -0.86355900 10.14823 -0.40205700 0.83720400 -0.37072600 280.99480 2700 'point symmetry operation' ? ? 0.78504000 0.52436400 0.32978000 -351.60557 0.47244600 -0.16251900 -0.86624600 9.47591 -0.40063200 0.83584100 -0.37531800 114.28091 2701 'point symmetry operation' ? ? 0.90378100 0.41951600 -0.08477000 -109.17350 0.03199600 -0.26373500 -0.96406400 65.40072 -0.42679700 0.86859000 -0.25178200 -175.99597 2702 'point symmetry operation' ? ? 0.90355500 0.42596900 0.04625100 -206.47089 0.18098100 -0.28158000 -0.94231500 40.23690 -0.38837300 0.85980400 -0.33151500 -202.16108 2703 'point symmetry operation' ? ? 0.87745300 0.47965100 0.00353700 -248.06645 0.12005200 -0.21246700 -0.96976500 157.82835 -0.46439600 0.85134800 -0.24401300 270.69736 2704 'point symmetry operation' ? ? 0.29326900 0.76919500 -0.56774400 186.16732 0.31170800 -0.63833700 -0.70382100 -86.39355 -0.90378700 0.02943900 -0.42696800 112.40162 2705 'point symmetry operation' ? ? 0.86794100 0.49454600 0.04585300 -189.59251 0.15866100 -0.18859800 -0.96915300 110.53705 -0.47064200 0.84844300 -0.24215700 175.80497 2706 'point symmetry operation' ? ? 0.86049100 0.50902200 0.02127800 -219.09691 0.14326700 -0.20169000 -0.96891500 133.68625 -0.48890700 0.83679000 -0.24647900 223.29098 2707 'point symmetry operation' ? ? 0.88505800 0.46236500 0.05377000 -207.67079 0.15642200 -0.18663100 -0.96989700 104.41165 -0.43841100 0.86682600 -0.23750400 103.11898 2708 'point symmetry operation' ? ? 0.84850400 0.49988700 0.17364900 -204.41725 0.29495400 -0.17430100 -0.93947900 70.68729 -0.43936600 0.84837000 -0.29533800 216.86782 2709 'point symmetry operation' ? ? 0.82199900 0.51337700 0.24650300 -326.83321 0.38567200 -0.18334800 -0.90423500 37.09605 -0.41901700 0.83834800 -0.34870600 57.54655 2710 'point symmetry operation' ? ? 0.85628800 0.50606600 0.10328600 -198.14863 0.22071500 -0.17773100 -0.95900800 88.83044 -0.46696400 0.84398400 -0.26388500 152.66582 2711 'point symmetry operation' ? ? 0.85704400 0.50537100 0.10038600 -181.63366 0.20754500 -0.16028300 -0.96500500 99.43242 -0.47159400 0.84788600 -0.24225600 201.78403 2712 'point symmetry operation' ? ? 0.09797600 0.97805900 -0.18385400 -49.38036 0.48126700 -0.20827000 -0.85147300 -0.28610 -0.87108100 -0.00505900 -0.49111200 2.79949 2713 'point symmetry operation' ? ? 0.89511800 0.44551800 -0.01667200 -236.78775 0.09551300 -0.22816200 -0.96892700 145.89416 -0.43547800 0.86571100 -0.24678400 204.90649 2714 'point symmetry operation' ? ? 0.85180200 0.50229900 0.14876200 -164.46127 0.26253700 -0.16357700 -0.95095600 81.51715 -0.45332900 0.84908100 -0.27120700 261.83349 2715 'point symmetry operation' ? ? 0.94721300 0.16246000 -0.27639400 0.00000 -0.16246000 -0.50000000 -0.85065100 0.00000 -0.27639400 0.85065100 -0.44721300 0.00000 2716 'point symmetry operation' ? ? 0.73805000 -0.57349400 -0.35550800 -66.63538 -0.33882800 0.14062800 -0.93028000 161.96481 0.58350400 0.80704900 -0.09052500 -152.29259 2717 'point symmetry operation' ? ? 0.83770600 -0.51401200 -0.18449600 -230.96217 -0.10732200 0.17629700 -0.97846900 213.84793 0.53547100 0.83947100 0.09252100 -135.34397 2718 'point symmetry operation' ? ? 0.77532300 -0.57794300 -0.25466800 -78.64391 -0.21529600 0.13721700 -0.96686100 129.83032 0.59373500 0.80445800 -0.01804100 -242.00323 2719 'point symmetry operation' ? ? 0.77342800 -0.55700000 -0.30258800 -74.53728 -0.25413900 0.16483400 -0.95301800 144.49650 0.58070800 0.81399000 -0.01406800 -204.84316 2720 'point symmetry operation' ? ? 0.64392500 -0.66219100 -0.38322800 -42.85794 -0.41090200 0.12320500 -0.90331600 140.13187 0.64538300 0.73913700 -0.19276100 -101.70117 2721 'point symmetry operation' ? ? 0.94549900 -0.07157200 -0.31766000 -26.15590 -0.28114900 -0.67158600 -0.68551300 -76.18729 -0.16427300 0.73746200 -0.65510600 190.23268 2722 'point symmetry operation' ? ? 0.71739000 -0.57963400 -0.38649200 -120.26853 -0.35835900 0.16872300 -0.91821100 242.49379 0.59743700 0.79721800 -0.08667700 -135.89121 2723 'point symmetry operation' ? ? 0.96059300 -0.11459200 -0.25323600 -38.89928 -0.25620600 -0.71832600 -0.64681300 -146.33541 -0.10778700 0.68620500 -0.71937800 228.25905 2724 'point symmetry operation' ? ? 0.82726000 -0.51893400 -0.21528500 -246.55252 -0.14023700 0.18033000 -0.97355800 240.44962 0.54403500 0.83557700 0.07640600 -72.35961 2725 'point symmetry operation' ? ? 0.65863900 -0.64524000 -0.38711800 -117.64310 -0.40775700 0.12632500 -0.90431000 240.95306 0.63240000 0.75346400 -0.17989800 -100.80412 2726 'point symmetry operation' ? ? 0.84554700 -0.51070400 -0.15566100 -213.29718 -0.07533100 0.17451600 -0.98176900 185.93735 0.52855800 0.84185800 0.10909000 -198.65045 2727 'point symmetry operation' ? ? 0.94982900 -0.16761000 -0.26406800 -169.71827 -0.29856900 -0.73740500 -0.60588000 29.21110 -0.09317400 0.65432500 -0.75045200 234.15002 2728 'point symmetry operation' ? ? 0.68485400 -0.61903900 -0.38440300 -82.02372 -0.38589400 0.13937100 -0.91195500 191.74420 0.61811000 0.77289500 -0.14343400 -115.78551 2729 'point symmetry operation' ? ? 0.57120300 -0.74392500 -0.34684500 -187.83900 -0.46407700 0.05583900 -0.88403300 300.21817 0.67702200 0.66592600 -0.31334300 -41.99687 2730 'point symmetry operation' ? ? 0.61777100 -0.69263700 -0.37230700 -91.42038 -0.43404100 0.09445300 -0.89592800 190.99005 0.65571800 0.71507600 -0.24228200 -72.75815 2731 'point symmetry operation' ? ? 0.75560600 -0.52843300 -0.38706300 -162.93819 -0.35517000 0.16597900 -0.91994900 267.66157 0.55037600 0.83259200 -0.06226800 -54.56588 2732 'point symmetry operation' ? ? 0.74118800 -0.53619800 -0.40389500 -185.18325 -0.36944900 0.17652900 -0.91233000 314.44650 0.56048900 0.82542600 -0.06725600 -73.64729 2733 'point symmetry operation' ? ? 0.63566200 -0.67087700 -0.38191100 -159.98791 -0.42570700 0.10806200 -0.89838500 293.49057 0.64397700 0.73365200 -0.21690600 -84.77014 2734 'point symmetry operation' ? ? 0.60796500 -0.73722200 -0.29475600 41.91366 -0.36750400 0.06778200 -0.92754900 7.73360 0.70378900 0.67224200 -0.22972300 -157.11295 2735 'point symmetry operation' ? ? 0.95972900 -0.15451000 -0.23462000 -88.25536 -0.26962000 -0.74115800 -0.61480900 -118.47602 -0.07889700 0.65330800 -0.75297000 245.84216 2736 'point symmetry operation' ? ? 0.70103300 -0.62235200 -0.34818100 -34.48527 -0.34369300 0.13294100 -0.92962500 120.90069 0.62484200 0.77136500 -0.12070200 -155.89888 2737 'point symmetry operation' ? ? 0.59431500 -0.71954200 -0.35923400 -140.53160 -0.45016400 0.07251400 -0.88999700 245.38281 0.66643900 0.69065300 -0.28081500 -54.45234 2738 'point symmetry operation' ? ? 0.81769200 -0.51722700 -0.25269600 -165.58774 -0.18895500 0.17348900 -0.96653900 196.41495 0.54376000 0.83808000 0.04412800 -156.67987 2739 'point symmetry operation' ? ? 0.72129600 -0.60452600 -0.33805200 91.12107 -0.31031300 0.15429400 -0.93803000 3.13501 0.61922300 0.78149900 -0.07630000 -268.60638 2740 'point symmetry operation' ? ? 0.81659200 -0.53290800 -0.22177700 -152.14513 -0.14743100 0.17891100 -0.97275700 173.09443 0.55806800 0.82704300 0.06753000 -222.75045 2741 'point symmetry operation' ? ? 0.94508500 -0.02786700 -0.32563500 14.82811 -0.27032900 -0.62660400 -0.73095100 -88.30906 -0.18367500 0.77884000 -0.59972700 153.83398 2742 'point symmetry operation' ? ? 0.77902700 -0.53921200 -0.31994800 -101.51417 -0.26594200 0.17794400 -0.94742300 174.86623 0.56779500 0.82315700 -0.00477600 -174.49976 2743 'point symmetry operation' ? ? 0.94606500 -0.14351600 -0.29045400 -114.12449 -0.30078400 -0.72219100 -0.62287200 -18.26077 -0.12037100 0.67664200 -0.72640700 226.62374 2744 'point symmetry operation' ? ? 0.82073900 -0.55009600 -0.15420800 -128.36749 -0.08829400 0.14454300 -0.98555100 123.19691 0.56443800 0.82249700 0.07006300 -313.05315 2745 'point symmetry operation' ? ? 0.85552800 -0.50467200 -0.11566200 -294.65707 -0.02705400 0.17951100 -0.98338400 226.62482 0.51704900 0.84444200 0.13992300 -114.85503 2746 'point symmetry operation' ? ? 0.85162700 -0.51062900 -0.11826900 -204.33674 -0.03476800 0.17010900 -0.98481200 160.17215 0.52299300 0.84280500 0.12711700 -263.37747 2747 'point symmetry operation' ? ? 0.65463100 -0.63175500 -0.41514200 126.29410 -0.43606800 0.13300300 -0.89003100 -10.91836 0.61749700 0.76367300 -0.18842000 -176.35556 2748 'point symmetry operation' ? ? 0.71431700 -0.63355200 -0.29725900 95.23389 -0.29527600 0.11225000 -0.94879500 -19.45602 0.63447800 0.76551400 -0.10689000 -275.08235 2749 'point symmetry operation' ? ? 0.72407100 -0.56738700 -0.39216500 -192.86049 -0.37767600 0.14960700 -0.91377200 335.20800 0.57713300 0.80974700 -0.10596200 -100.81773 2750 'point symmetry operation' ? ? 0.94330900 -0.11821000 -0.31015100 -64.75945 -0.30006200 -0.70314300 -0.64463400 -59.73775 -0.14187800 0.70115400 -0.69875200 216.78063 2751 'point symmetry operation' ? ? 0.74784300 -0.54586500 -0.37783800 -130.83680 -0.34722400 0.16347500 -0.92342400 231.68985 0.56583200 0.82177100 -0.06728400 -90.95424 2752 'point symmetry operation' ? ? 0.74931500 -0.53989200 -0.38346200 -162.26602 -0.36732100 0.14295200 -0.91904300 283.13852 0.55100000 0.82950700 -0.09119700 -96.10738 2753 'point symmetry operation' ? ? 0.72939700 -0.56965500 -0.37877800 -88.38193 -0.33658900 0.18319000 -0.92366100 193.27315 0.59555600 0.80120800 -0.05812200 -139.63012 2754 'point symmetry operation' ? ? 0.79828900 -0.53547700 -0.27567700 -189.33690 -0.21540800 0.17360000 -0.96097000 224.93565 0.56243500 0.82651500 0.02323700 -85.85000 2755 'point symmetry operation' ? ? 0.82729800 -0.52866200 -0.18998400 -138.08593 -0.12434900 0.15746600 -0.97966400 146.17850 0.54782700 0.83409900 0.06453300 -266.59280 2756 'point symmetry operation' ? ? 0.77743900 -0.53208400 -0.33537300 -129.94762 -0.29202400 0.16689400 -0.94173700 204.21296 0.55705500 0.83008000 -0.02563100 -108.95520 2757 'point symmetry operation' ? ? 0.77332200 -0.52490300 -0.35559800 -153.28301 -0.30531200 0.18324400 -0.93445500 234.27192 0.55565900 0.83120300 -0.01855200 -72.21743 2758 'point symmetry operation' ? ? 0.94865000 0.23510800 -0.21163000 -20.05988 -0.09435600 -0.42825100 -0.89872000 14.22070 -0.30192700 0.87254000 -0.38407600 -42.91515 2759 'point symmetry operation' ? ? 0.69511300 -0.59935400 -0.39697800 -148.18785 -0.38696800 0.15343300 -0.90923800 287.99993 0.60586600 0.78564100 -0.12527700 -120.15234 2760 'point symmetry operation' ? ? 0.79053300 -0.52881500 -0.30888800 -201.05251 -0.24984100 0.18201500 -0.95102600 246.83401 0.55914000 0.82899000 0.01176900 -30.00304 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 13 ? MET A 20 ? GLY A 12 MET A 19 1 ? 8 HELX_P HELX_P2 AA2 ALA A 21 ? GLN A 39 ? ALA A 20 GLN A 38 1 ? 19 HELX_P HELX_P3 AA3 THR A 47 ? ARG A 53 ? THR A 46 ARG A 52 1 ? 7 HELX_P HELX_P4 AA4 TYR A 180 ? LEU A 185 ? TYR A 179 LEU A 184 1 ? 6 HELX_P HELX_P5 AA5 ALA A 203 ? HIS A 213 ? ALA A 202 HIS A 212 1 ? 11 HELX_P HELX_P6 AA6 PRO A 215 ? ILE A 226 ? PRO A 214 ILE A 225 1 ? 12 HELX_P HELX_P7 AA7 GLY A 248 ? VAL A 252 ? GLY A 247 VAL A 251 5 ? 5 HELX_P HELX_P8 AA8 PHE A 301 ? ALA A 309 ? PHE A 300 ALA A 308 5 ? 9 HELX_P HELX_P9 AA9 GLN A 328 ? ASN A 331 ? GLN A 327 ASN A 330 5 ? 4 HELX_P HELX_P10 AB1 THR A 402 ? ILE A 413 ? THR A 401 ILE A 412 1 ? 12 HELX_P HELX_P11 AB2 ASN A 455 ? ALA A 458 ? ASN A 454 ALA A 457 5 ? 4 HELX_P HELX_P12 AB3 TYR A 463 ? TRP A 468 ? TYR A 462 TRP A 467 1 ? 6 HELX_P HELX_P13 AB4 ALA A 542 ? ASP A 547 ? ALA A 541 ASP A 546 1 ? 6 HELX_P HELX_P14 AB5 ASP A 547 ? TYR A 553 ? ASP A 546 TYR A 552 1 ? 7 HELX_P HELX_P15 AB6 GLY A 554 ? LEU A 558 ? GLY A 553 LEU A 557 5 ? 5 HELX_P HELX_P16 AB7 ASN A 585 ? ARG A 590 ? ASN A 584 ARG A 589 1 ? 6 HELX_P HELX_P17 AB8 ASP B 12 ? MET B 20 ? ASP B 11 MET B 19 1 ? 9 HELX_P HELX_P18 AB9 ALA B 21 ? GLN B 39 ? ALA B 20 GLN B 38 1 ? 19 HELX_P HELX_P19 AC1 THR B 47 ? ARG B 53 ? THR B 46 ARG B 52 1 ? 7 HELX_P HELX_P20 AC2 TYR B 180 ? LEU B 185 ? TYR B 179 LEU B 184 1 ? 6 HELX_P HELX_P21 AC3 ALA B 203 ? HIS B 213 ? ALA B 202 HIS B 212 1 ? 11 HELX_P HELX_P22 AC4 PRO B 215 ? ILE B 226 ? PRO B 214 ILE B 225 1 ? 12 HELX_P HELX_P23 AC5 GLY B 248 ? VAL B 252 ? GLY B 247 VAL B 251 5 ? 5 HELX_P HELX_P24 AC6 PHE B 301 ? ALA B 309 ? PHE B 300 ALA B 308 5 ? 9 HELX_P HELX_P25 AC7 GLN B 328 ? ASN B 331 ? GLN B 327 ASN B 330 5 ? 4 HELX_P HELX_P26 AC8 THR B 402 ? ILE B 413 ? THR B 401 ILE B 412 1 ? 12 HELX_P HELX_P27 AC9 ASN B 455 ? ALA B 458 ? ASN B 454 ALA B 457 5 ? 4 HELX_P HELX_P28 AD1 TYR B 463 ? TRP B 468 ? TYR B 462 TRP B 467 1 ? 6 HELX_P HELX_P29 AD2 ALA B 542 ? ASP B 547 ? ALA B 541 ASP B 546 1 ? 6 HELX_P HELX_P30 AD3 ASP B 547 ? TYR B 553 ? ASP B 546 TYR B 552 1 ? 7 HELX_P HELX_P31 AD4 GLY B 554 ? LEU B 558 ? GLY B 553 LEU B 557 5 ? 5 HELX_P HELX_P32 AD5 ASN B 585 ? ARG B 590 ? ASN B 584 ARG B 589 1 ? 6 HELX_P HELX_P33 AD6 ASP C 12 ? MET C 20 ? ASP C 11 MET C 19 1 ? 9 HELX_P HELX_P34 AD7 ALA C 21 ? GLN C 39 ? ALA C 20 GLN C 38 1 ? 19 HELX_P HELX_P35 AD8 THR C 47 ? ARG C 53 ? THR C 46 ARG C 52 1 ? 7 HELX_P HELX_P36 AD9 TYR C 180 ? LEU C 185 ? TYR C 179 LEU C 184 1 ? 6 HELX_P HELX_P37 AE1 ALA C 203 ? HIS C 213 ? ALA C 202 HIS C 212 1 ? 11 HELX_P HELX_P38 AE2 PRO C 215 ? ILE C 226 ? PRO C 214 ILE C 225 1 ? 12 HELX_P HELX_P39 AE3 GLY C 248 ? VAL C 252 ? GLY C 247 VAL C 251 5 ? 5 HELX_P HELX_P40 AE4 PHE C 301 ? ALA C 309 ? PHE C 300 ALA C 308 5 ? 9 HELX_P HELX_P41 AE5 VAL C 313 ? ILE C 315 ? VAL C 312 ILE C 314 5 ? 3 HELX_P HELX_P42 AE6 GLN C 328 ? ASN C 331 ? GLN C 327 ASN C 330 5 ? 4 HELX_P HELX_P43 AE7 THR C 402 ? GLY C 414 ? THR C 401 GLY C 413 1 ? 13 HELX_P HELX_P44 AE8 ASN C 455 ? ALA C 458 ? ASN C 454 ALA C 457 5 ? 4 HELX_P HELX_P45 AE9 TYR C 463 ? TRP C 468 ? TYR C 462 TRP C 467 1 ? 6 HELX_P HELX_P46 AF1 ALA C 542 ? ASP C 547 ? ALA C 541 ASP C 546 1 ? 6 HELX_P HELX_P47 AF2 ASP C 547 ? TYR C 553 ? ASP C 546 TYR C 552 1 ? 7 HELX_P HELX_P48 AF3 GLY C 554 ? LEU C 558 ? GLY C 553 LEU C 557 5 ? 5 HELX_P HELX_P49 AF4 SER C 587 ? ARG C 590 ? SER C 586 ARG C 589 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASP 12 A . ? ASP 11 A GLY 13 A ? GLY 12 A 1 7.46 2 ILE 586 C . ? ILE 585 C SER 587 C ? SER 586 C 1 0.06 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 4 ? AA3 ? 2 ? AA4 ? 29 ? AA5 ? 2 ? AA6 ? 4 ? AA7 ? 4 ? AA8 ? 5 ? AA9 ? 4 ? AB1 ? 2 ? AB2 ? 2 ? AB3 ? 4 ? AB4 ? 4 ? AB5 ? 5 ? AB6 ? 4 ? AB7 ? 2 ? AB8 ? 2 ? AB9 ? 4 ? AC1 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 5 ? anti-parallel AA1 2 3 ? anti-parallel AA1 2 4 ? anti-parallel AA1 2 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 3 7 ? anti-parallel AA4 5 6 ? anti-parallel AA4 5 19 ? anti-parallel AA4 6 15 ? anti-parallel AA4 6 25 ? anti-parallel AA4 7 8 ? anti-parallel AA4 8 10 ? parallel AA4 9 10 ? anti-parallel AA4 10 24 ? anti-parallel AA4 11 12 ? anti-parallel AA4 12 13 ? anti-parallel AA4 13 16 ? anti-parallel AA4 14 15 ? anti-parallel AA4 14 29 ? anti-parallel AA4 15 25 ? anti-parallel AA4 16 17 ? anti-parallel AA4 17 19 ? parallel AA4 18 19 ? anti-parallel AA4 20 21 ? anti-parallel AA4 21 22 ? anti-parallel AA4 22 23 ? anti-parallel AA4 22 26 ? anti-parallel AA4 24 25 ? anti-parallel AA4 26 27 ? anti-parallel AA4 27 29 ? parallel AA4 28 29 ? anti-parallel AA5 1 2 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel AA7 1 2 ? anti-parallel AA7 2 3 ? anti-parallel AA7 3 4 ? anti-parallel AA8 1 5 ? anti-parallel AA8 2 3 ? anti-parallel AA8 2 4 ? anti-parallel AA8 2 5 ? anti-parallel AA9 1 2 ? anti-parallel AA9 2 3 ? anti-parallel AA9 3 4 ? anti-parallel AB1 1 2 ? anti-parallel AB2 1 2 ? anti-parallel AB3 1 2 ? anti-parallel AB3 2 3 ? anti-parallel AB3 3 4 ? anti-parallel AB4 1 2 ? anti-parallel AB4 2 3 ? anti-parallel AB4 3 4 ? anti-parallel AB5 1 5 ? anti-parallel AB5 2 3 ? anti-parallel AB5 2 4 ? anti-parallel AB5 2 5 ? anti-parallel AB6 1 2 ? anti-parallel AB6 2 3 ? anti-parallel AB6 3 4 ? anti-parallel AB7 1 2 ? anti-parallel AB8 1 2 ? anti-parallel AB9 1 2 ? anti-parallel AB9 2 3 ? anti-parallel AB9 3 4 ? anti-parallel AC1 1 2 ? anti-parallel AC1 2 3 ? anti-parallel AC1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 69 ? THR A 76 ? MET A 68 THR A 75 AA1 2 PHE A 99 ? LEU A 109 ? PHE A 98 LEU A 108 AA1 3 LEU A 293 ? PRO A 298 ? LEU A 292 PRO A 297 AA1 4 ILE A 310 ? ALA A 311 ? ILE A 309 ALA A 310 AA1 5 VAL A 389 ? VAL A 401 ? VAL A 388 VAL A 400 AA2 1 THR A 88 ? SER A 92 ? THR A 87 SER A 91 AA2 2 ARG A 320 ? ILE A 326 ? ARG A 319 ILE A 325 AA2 3 PHE A 186 ? VAL A 193 ? PHE A 185 VAL A 192 AA2 4 ASN A 196 ? THR A 202 ? ASN A 195 THR A 201 AA3 1 ALA A 116 ? THR A 118 ? ALA A 115 THR A 117 AA3 2 ALA A 170 ? THR A 172 ? ALA A 169 THR A 171 AA4 1 ASP A 129 ? LEU A 133 ? ASP A 128 LEU A 132 AA4 2 VAL A 138 ? THR A 142 ? VAL A 137 THR A 141 AA4 3 VAL A 149 ? VAL A 158 ? VAL A 148 VAL A 157 AA4 4 THR A 164 ? GLN A 165 ? THR A 163 GLN A 164 AA4 5 VAL A 232 ? ASN A 240 ? VAL A 231 ASN A 239 AA4 6 ALA A 273 ? VAL A 280 ? ALA A 272 VAL A 279 AA4 7 PHE A 341 ? THR A 351 ? PHE A 340 THR A 350 AA4 8 LEU A 364 ? PRO A 375 ? LEU A 363 PRO A 374 AA4 9 SER A 473 ? SER A 490 ? SER A 472 SER A 489 AA4 10 PHE A 503 ? THR A 521 ? PHE A 502 THR A 520 AA4 11 ASP B 129 ? LEU B 133 ? ASP B 128 LEU B 132 AA4 12 VAL B 138 ? THR B 142 ? VAL B 137 THR B 141 AA4 13 VAL B 149 ? VAL B 158 ? VAL B 148 VAL B 157 AA4 14 VAL B 232 ? ASN B 240 ? VAL B 231 ASN B 239 AA4 15 ALA B 273 ? VAL B 280 ? ALA B 272 VAL B 279 AA4 16 PHE B 341 ? THR B 351 ? PHE B 340 THR B 350 AA4 17 LEU B 364 ? PRO B 375 ? LEU B 363 PRO B 374 AA4 18 SER B 473 ? SER B 490 ? SER B 472 SER B 489 AA4 19 PHE B 503 ? THR B 521 ? PHE B 502 THR B 520 AA4 20 ASP C 129 ? LEU C 133 ? ASP C 128 LEU C 132 AA4 21 VAL C 138 ? THR C 142 ? VAL C 137 THR C 141 AA4 22 VAL C 149 ? VAL C 158 ? VAL C 148 VAL C 157 AA4 23 THR C 164 ? GLN C 165 ? THR C 163 GLN C 164 AA4 24 VAL C 232 ? ASN C 240 ? VAL C 231 ASN C 239 AA4 25 ALA C 273 ? VAL C 280 ? ALA C 272 VAL C 279 AA4 26 PHE C 341 ? THR C 351 ? PHE C 340 THR C 350 AA4 27 LEU C 364 ? PRO C 375 ? LEU C 363 PRO C 374 AA4 28 SER C 473 ? SER C 490 ? SER C 472 SER C 489 AA4 29 PHE C 503 ? THR C 521 ? PHE C 502 THR C 520 AA5 1 PHE A 174 ? TYR A 177 ? PHE A 173 TYR A 176 AA5 2 LEU A 333 ? ALA A 336 ? LEU A 332 ALA A 335 AA6 1 PHE A 415 ? GLU A 428 ? PHE A 414 GLU A 427 AA6 2 CYS A 607 ? LEU A 620 ? CYS A 606 LEU A 619 AA6 3 VAL A 444 ? PRO A 453 ? VAL A 443 PRO A 452 AA6 4 LEU A 567 ? ASN A 570 ? LEU A 566 ASN A 569 AA7 1 ALA A 432 ? LEU A 436 ? ALA A 431 LEU A 435 AA7 2 PHE A 592 ? THR A 597 ? PHE A 591 THR A 596 AA7 3 THR A 526 ? ALA A 531 ? THR A 525 ALA A 530 AA7 4 GLU A 535 ? ARG A 541 ? GLU A 534 ARG A 540 AA8 1 MET B 69 ? THR B 76 ? MET B 68 THR B 75 AA8 2 PHE B 99 ? LEU B 109 ? PHE B 98 LEU B 108 AA8 3 LEU B 293 ? PRO B 298 ? LEU B 292 PRO B 297 AA8 4 ILE B 310 ? ALA B 311 ? ILE B 309 ALA B 310 AA8 5 VAL B 389 ? VAL B 401 ? VAL B 388 VAL B 400 AA9 1 THR B 88 ? SER B 92 ? THR B 87 SER B 91 AA9 2 ARG B 320 ? ILE B 326 ? ARG B 319 ILE B 325 AA9 3 PHE B 186 ? VAL B 193 ? PHE B 185 VAL B 192 AA9 4 ASN B 196 ? THR B 202 ? ASN B 195 THR B 201 AB1 1 ALA B 116 ? THR B 118 ? ALA B 115 THR B 117 AB1 2 ALA B 170 ? THR B 172 ? ALA B 169 THR B 171 AB2 1 PHE B 174 ? TYR B 177 ? PHE B 173 TYR B 176 AB2 2 LEU B 333 ? ALA B 336 ? LEU B 332 ALA B 335 AB3 1 PHE B 415 ? GLU B 428 ? PHE B 414 GLU B 427 AB3 2 CYS B 607 ? LEU B 620 ? CYS B 606 LEU B 619 AB3 3 VAL B 444 ? PRO B 453 ? VAL B 443 PRO B 452 AB3 4 LEU B 567 ? ASN B 570 ? LEU B 566 ASN B 569 AB4 1 ALA B 432 ? LEU B 436 ? ALA B 431 LEU B 435 AB4 2 PHE B 592 ? THR B 597 ? PHE B 591 THR B 596 AB4 3 THR B 526 ? ALA B 531 ? THR B 525 ALA B 530 AB4 4 ILE B 534 ? ARG B 541 ? ILE B 533 ARG B 540 AB5 1 MET C 69 ? THR C 76 ? MET C 68 THR C 75 AB5 2 PHE C 99 ? LEU C 109 ? PHE C 98 LEU C 108 AB5 3 LEU C 293 ? PRO C 298 ? LEU C 292 PRO C 297 AB5 4 ILE C 310 ? ALA C 311 ? ILE C 309 ALA C 310 AB5 5 VAL C 389 ? VAL C 401 ? VAL C 388 VAL C 400 AB6 1 THR C 88 ? SER C 92 ? THR C 87 SER C 91 AB6 2 ARG C 320 ? ILE C 326 ? ARG C 319 ILE C 325 AB6 3 PHE C 186 ? VAL C 193 ? PHE C 185 VAL C 192 AB6 4 ASN C 196 ? THR C 202 ? ASN C 195 THR C 201 AB7 1 ALA C 116 ? THR C 118 ? ALA C 115 THR C 117 AB7 2 ALA C 170 ? THR C 172 ? ALA C 169 THR C 171 AB8 1 PHE C 174 ? TYR C 177 ? PHE C 173 TYR C 176 AB8 2 LEU C 333 ? ALA C 336 ? LEU C 332 ALA C 335 AB9 1 PHE C 415 ? GLU C 428 ? PHE C 414 GLU C 427 AB9 2 CYS C 607 ? LEU C 620 ? CYS C 606 LEU C 619 AB9 3 VAL C 444 ? PRO C 453 ? VAL C 443 PRO C 452 AB9 4 LEU C 567 ? ASN C 570 ? LEU C 566 ASN C 569 AC1 1 ALA C 432 ? LEU C 436 ? ALA C 431 LEU C 435 AC1 2 PHE C 592 ? THR C 597 ? PHE C 591 THR C 596 AC1 3 THR C 526 ? ALA C 531 ? THR C 525 ALA C 530 AC1 4 GLU C 535 ? ARG C 541 ? GLU C 534 ARG C 540 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 5 N GLY A 70 ? N GLY A 69 O PHE A 400 ? O PHE A 399 AA1 2 3 N VAL A 107 ? N VAL A 106 O MET A 295 ? O MET A 294 AA1 2 4 N PHE A 100 ? N PHE A 99 O ILE A 310 ? O ILE A 309 AA1 2 5 N PHE A 99 ? N PHE A 98 O ILE A 399 ? O ILE A 398 AA2 1 2 N PHE A 91 ? N PHE A 90 O ILE A 322 ? O ILE A 321 AA2 2 3 O ASP A 325 ? O ASP A 324 N ARG A 188 ? N ARG A 187 AA2 3 4 N PHE A 191 ? N PHE A 190 O LEU A 198 ? O LEU A 197 AA3 1 2 N GLY A 117 ? N GLY A 116 O ALA A 171 ? O ALA A 170 AA4 1 2 N VAL A 132 ? N VAL A 131 O VAL A 139 ? O VAL A 138 AA4 2 3 N SER A 140 ? N SER A 139 O TYR A 153 ? O TYR A 152 AA4 3 4 N TYR A 157 ? N TYR A 156 O GLN A 165 ? O GLN A 164 AA4 3 7 N SER A 156 ? N SER A 155 O GLN A 343 ? O GLN A 342 AA4 5 6 N ALA A 234 ? N ALA A 233 O THR A 277 ? O THR A 276 AA4 5 19 N ALA A 235 ? N ALA A 234 O ILE B 516 ? O ILE B 515 AA4 6 15 N LEU A 276 ? N LEU A 275 O GLN B 278 ? O GLN B 277 AA4 6 25 N GLN A 278 ? N GLN A 277 O LEU C 276 ? O LEU C 275 AA4 7 8 N LEU A 342 ? N LEU A 341 O THR A 374 ? O THR A 373 AA4 8 10 N ARG A 369 ? N ARG A 368 O GLN A 509 ? O GLN A 508 AA4 9 10 N SER A 483 ? N SER A 482 O VAL A 510 ? O VAL A 509 AA4 10 24 N ILE A 516 ? N ILE A 515 O ALA C 235 ? O ALA C 234 AA4 11 12 N VAL B 132 ? N VAL B 131 O VAL B 139 ? O VAL B 138 AA4 12 13 N SER B 140 ? N SER B 139 O TYR B 153 ? O TYR B 152 AA4 13 16 N LEU B 152 ? N LEU B 151 O GLU B 347 ? O GLU B 346 AA4 14 15 N ALA B 234 ? N ALA B 233 O THR B 277 ? O THR B 276 AA4 14 29 N ALA B 235 ? N ALA B 234 O ILE C 516 ? O ILE C 515 AA4 15 25 N LEU B 276 ? N LEU B 275 O GLN C 278 ? O GLN C 277 AA4 16 17 N LEU B 350 ? N LEU B 349 O THR B 365 ? O THR B 364 AA4 17 19 N THR B 371 ? N THR B 370 O GLN B 509 ? O GLN B 508 AA4 18 19 N ASP B 481 ? N ASP B 480 O GLN B 512 ? O GLN B 511 AA4 20 21 N VAL C 132 ? N VAL C 131 O VAL C 139 ? O VAL C 138 AA4 21 22 N SER C 140 ? N SER C 139 O TYR C 153 ? O TYR C 152 AA4 22 23 N TYR C 157 ? N TYR C 156 O GLN C 165 ? O GLN C 164 AA4 22 26 N SER C 156 ? N SER C 155 O GLN C 343 ? O GLN C 342 AA4 24 25 N ALA C 234 ? N ALA C 233 O THR C 277 ? O THR C 276 AA4 26 27 N LEU C 342 ? N LEU C 341 O THR C 374 ? O THR C 373 AA4 27 29 N ARG C 369 ? N ARG C 368 O GLN C 509 ? O GLN C 508 AA4 28 29 N ASP C 481 ? N ASP C 480 O GLN C 512 ? O GLN C 511 AA5 1 2 N PHE A 174 ? N PHE A 173 O ALA A 336 ? O ALA A 335 AA6 1 2 N ILE A 418 ? N ILE A 417 O ASN A 617 ? O ASN A 616 AA6 2 3 O ILE A 610 ? O ILE A 609 N GLY A 450 ? N GLY A 449 AA6 3 4 N ILE A 447 ? N ILE A 446 O LEU A 569 ? O LEU A 568 AA7 1 2 N VAL A 435 ? N VAL A 434 O ILE A 594 ? O ILE A 593 AA7 2 3 O TYR A 593 ? O TYR A 592 N LYS A 530 ? N LYS A 529 AA7 3 4 N VAL A 529 ? N VAL A 528 O LEU A 536 ? O LEU A 535 AA8 1 5 N GLY B 70 ? N GLY B 69 O PHE B 400 ? O PHE B 399 AA8 2 3 N VAL B 107 ? N VAL B 106 O MET B 295 ? O MET B 294 AA8 2 4 N PHE B 100 ? N PHE B 99 O ILE B 310 ? O ILE B 309 AA8 2 5 N VAL B 104 ? N VAL B 103 O TYR B 395 ? O TYR B 394 AA9 1 2 N ILE B 89 ? N ILE B 88 O VAL B 324 ? O VAL B 323 AA9 2 3 O THR B 323 ? O THR B 322 N LYS B 190 ? N LYS B 189 AA9 3 4 N PHE B 191 ? N PHE B 190 O ASP B 199 ? O ASP B 198 AB1 1 2 N GLY B 117 ? N GLY B 116 O ALA B 171 ? O ALA B 170 AB2 1 2 N ARG B 176 ? N ARG B 175 O PHE B 334 ? O PHE B 333 AB3 1 2 N GLU B 428 ? N GLU B 427 O CYS B 607 ? O CYS B 606 AB3 2 3 O ILE B 612 ? O ILE B 611 N TYR B 448 ? N TYR B 447 AB3 3 4 N LEU B 449 ? N LEU B 448 O LEU B 567 ? O LEU B 566 AB4 1 2 N VAL B 435 ? N VAL B 434 O ILE B 594 ? O ILE B 593 AB4 2 3 O GLU B 595 ? O GLU B 594 N ARG B 528 ? N ARG B 527 AB4 3 4 N ALA B 531 ? N ALA B 530 O ILE B 534 ? O ILE B 533 AB5 1 5 N GLY C 70 ? N GLY C 69 O PHE C 400 ? O PHE C 399 AB5 2 3 N VAL C 105 ? N VAL C 104 O VAL C 297 ? O VAL C 296 AB5 2 4 N PHE C 100 ? N PHE C 99 O ILE C 310 ? O ILE C 309 AB5 2 5 N VAL C 104 ? N VAL C 103 O TYR C 395 ? O TYR C 394 AB6 1 2 N ILE C 89 ? N ILE C 88 O VAL C 324 ? O VAL C 323 AB6 2 3 O THR C 323 ? O THR C 322 N LYS C 190 ? N LYS C 189 AB6 3 4 N VAL C 189 ? N VAL C 188 O TYR C 201 ? O TYR C 200 AB7 1 2 N GLY C 117 ? N GLY C 116 O ALA C 171 ? O ALA C 170 AB8 1 2 N PHE C 174 ? N PHE C 173 O ALA C 336 ? O ALA C 335 AB9 1 2 N GLU C 428 ? N GLU C 427 O CYS C 607 ? O CYS C 606 AB9 2 3 O ILE C 612 ? O ILE C 611 N TYR C 448 ? N TYR C 447 AB9 3 4 N ILE C 447 ? N ILE C 446 O LEU C 569 ? O LEU C 568 AC1 1 2 N VAL C 435 ? N VAL C 434 O ILE C 594 ? O ILE C 593 AC1 2 3 O GLU C 595 ? O GLU C 594 N ARG C 528 ? N ARG C 527 AC1 3 4 N VAL C 529 ? N VAL C 528 O LEU C 536 ? O LEU C 535 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 CG1 _pdbx_validate_close_contact.auth_asym_id_1 C _pdbx_validate_close_contact.auth_comp_id_1 ILE _pdbx_validate_close_contact.auth_seq_id_1 585 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 CB _pdbx_validate_close_contact.auth_asym_id_2 C _pdbx_validate_close_contact.auth_comp_id_2 ALA _pdbx_validate_close_contact.auth_seq_id_2 588 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.12 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 59 ? ? -162.53 110.68 2 1 PHE A 95 ? ? -144.22 -75.02 3 1 SER A 100 ? ? -130.05 -118.37 4 1 ILE A 125 ? ? -100.56 -62.84 5 1 ASN A 143 ? ? -155.00 88.58 6 1 PHE A 280 ? ? -149.23 51.37 7 1 LEU A 299 ? ? -91.29 51.28 8 1 LEU A 362 ? ? 68.09 79.70 9 1 GLN A 538 ? ? -68.71 98.58 10 1 SER A 554 ? ? 53.90 -139.36 11 1 SER A 580 ? ? -145.82 34.78 12 1 ALA B 9 ? ? 75.45 -35.11 13 1 PHE B 95 ? ? -143.52 -73.75 14 1 SER B 100 ? ? -128.11 -121.00 15 1 ASN B 143 ? ? -158.86 87.56 16 1 PHE B 280 ? ? -155.03 51.31 17 1 VAL B 361 ? ? -109.04 -67.92 18 1 SER B 554 ? ? 59.53 -138.99 19 1 SER B 580 ? ? -145.96 23.69 20 1 ASN C 59 ? ? -164.72 118.51 21 1 PHE C 95 ? ? -142.45 -73.20 22 1 SER C 100 ? ? -127.57 -118.32 23 1 ILE C 125 ? ? -106.56 -61.51 24 1 ASN C 143 ? ? -159.61 81.84 25 1 PHE C 280 ? ? -154.01 50.22 26 1 LEU C 362 ? ? 63.15 83.56 27 1 LYS C 440 ? ? -155.18 25.15 28 1 SER C 554 ? ? 53.79 -136.82 29 1 SER C 580 ? ? -145.84 33.36 30 1 SER C 586 ? ? 79.61 177.49 31 1 ARG C 587 ? ? -63.17 12.51 # _pdbx_point_symmetry.entry_id 5J7V _pdbx_point_symmetry.Schoenflies_symbol I # _em_3d_fitting.entry_id 5J7V _em_3d_fitting.id 1 _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_protocol 'RIGID BODY FIT' _em_3d_fitting.ref_space REAL _em_3d_fitting.target_criteria 'Correlation coefficient' _em_3d_fitting.method ? # loop_ _em_3d_fitting_list.3d_fitting_id _em_3d_fitting_list.id _em_3d_fitting_list.details _em_3d_fitting_list.pdb_chain_id _em_3d_fitting_list.pdb_chain_residue_range _em_3d_fitting_list.pdb_entry_id _em_3d_fitting_list.initial_refinement_model_id _em_3d_fitting_list.chain_id _em_3d_fitting_list.chain_residue_range _em_3d_fitting_list.source_name _em_3d_fitting_list.type _em_3d_fitting_list.accession_code 1 1 ? A ? 5J7O 1 ? ? PDB 'experimental model' 5J7O 1 2 ? B ? 5J7O 1 ? ? PDB 'experimental model' 5J7O 1 3 ? C ? 5J7O 1 ? ? PDB 'experimental model' 5J7O # _em_3d_reconstruction.entry_id 5J7V _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm 'FOURIER SPACE' _em_3d_reconstruction.details ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.num_particles 9640 _em_3d_reconstruction.resolution 15.5 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type POINT _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? _em_3d_reconstruction.citation_id ? _em_3d_reconstruction.euler_angles_details ? # _em_buffer.id 1 _em_buffer.details ? _em_buffer.pH 7 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details ? _em_entity_assembly.name Faustovirus _em_entity_assembly.source NATURAL _em_entity_assembly.type VIRUS _em_entity_assembly.entity_id_list 1 _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_imaging.id 1 _em_imaging.entry_id 5J7V _em_imaging.accelerating_voltage 300 _em_imaging.alignment_procedure 'COMA FREE' _em_imaging.c2_aperture_diameter 100 _em_imaging.calibrated_defocus_max ? _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_magnification ? _em_imaging.cryogen NITROGEN _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'SPOT SCAN' _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs 2.7 _em_imaging.nominal_defocus_max ? _em_imaging.nominal_defocus_min ? _em_imaging.nominal_magnification ? _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model 'FEI TITAN KRIOS AUTOGRID HOLDER' _em_imaging.specimen_id 1 _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.specimen_holder_type ? _em_imaging.astigmatism ? _em_imaging.electron_beam_tilt_params ? _em_imaging.citation_id ? _em_imaging.detector_distance ? # _em_sample_support.id 1 _em_sample_support.specimen_id 1 _em_sample_support.method ? _em_sample_support.film_material ? _em_sample_support.grid_material ? _em_sample_support.grid_mesh_size ? _em_sample_support.grid_type ? _em_sample_support.details ? # _em_virus_entity.id 1 _em_virus_entity.entity_assembly_id 1 _em_virus_entity.empty NO _em_virus_entity.enveloped NO _em_virus_entity.virus_isolate SPECIES _em_virus_entity.virus_type VIRION _em_virus_entity.virus_host_category ? _em_virus_entity.details ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature ? _em_vitrification.cryogen_name ETHANE _em_vitrification.details 'Plunged into liquid ethane' _em_vitrification.humidity ? _em_vitrification.instrument 'GATAN CRYOPLUNGE 3' _em_vitrification.entry_id 5J7V _em_vitrification.temp ? _em_vitrification.method ? _em_vitrification.time_resolved_state ? _em_vitrification.citation_id ? # _em_experiment.entry_id 5J7V _em_experiment.id 1 _em_experiment.aggregation_state PARTICLE _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.entity_assembly_id 1 # _em_single_particle_entity.entry_id 5J7V _em_single_particle_entity.id 1 _em_single_particle_entity.image_processing_id 1 _em_single_particle_entity.point_symmetry I # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 0 ? A GLU 1 2 1 Y 1 A ALA 1 ? A ALA 2 3 1 Y 1 A GLY 2 ? A GLY 3 4 1 Y 1 A GLY 3 ? A GLY 4 5 1 Y 1 A VAL 4 ? A VAL 5 6 1 Y 1 A PHE 5 ? A PHE 6 7 1 Y 1 A LYS 6 ? A LYS 7 8 1 Y 1 A LEU 7 ? A LEU 8 9 1 Y 1 A ILE 8 ? A ILE 9 10 1 Y 1 A ALA 9 ? A ALA 10 11 1 Y 1 A ASN 10 ? A ASN 11 12 1 Y 1 A ASP 622 ? A ASP 623 13 1 Y 1 A GLY 623 ? A GLY 624 14 1 Y 1 A SER 624 ? A SER 625 15 1 Y 1 A ALA 625 ? A ALA 626 16 1 Y 1 A VAL 626 ? A VAL 627 17 1 Y 1 A LEU 627 ? A LEU 628 18 1 Y 1 A ARG 628 ? A ARG 629 19 1 Y 1 A TYR 629 ? A TYR 630 20 1 Y 1 A SER 630 ? A SER 631 21 1 Y 1 A THR 631 ? A THR 632 22 1 Y 1 A LYS 632 ? A LYS 633 23 1 Y 1 A GLU 633 ? A GLU 634 24 1 Y 1 A PHE 634 ? A PHE 635 25 1 Y 1 A TYR 635 ? A TYR 636 26 1 Y 1 A LEU 636 ? A LEU 637 27 1 Y 1 A GLN 637 ? A GLN 638 28 1 Y 1 A CYS 638 ? A CYS 639 29 1 Y 1 A LEU 639 ? A LEU 640 30 1 Y 1 A ILE 640 ? A ILE 641 31 1 Y 1 A LEU 641 ? A LEU 642 32 1 Y 1 A ARG 642 ? A ARG 643 33 1 Y 1 A CYS 643 ? A CYS 644 34 1 Y 1 A ILE 644 ? A ILE 645 35 1 Y 1 B GLU 0 ? B GLU 1 36 1 Y 1 B ALA 1 ? B ALA 2 37 1 Y 1 B GLY 2 ? B GLY 3 38 1 Y 1 B GLY 3 ? B GLY 4 39 1 Y 1 B VAL 4 ? B VAL 5 40 1 Y 1 B PHE 5 ? B PHE 6 41 1 Y 1 B ASP 622 ? B ASP 623 42 1 Y 1 B GLY 623 ? B GLY 624 43 1 Y 1 B SER 624 ? B SER 625 44 1 Y 1 B ALA 625 ? B ALA 626 45 1 Y 1 B VAL 626 ? B VAL 627 46 1 Y 1 B LEU 627 ? B LEU 628 47 1 Y 1 B ARG 628 ? B ARG 629 48 1 Y 1 B TYR 629 ? B TYR 630 49 1 Y 1 B SER 630 ? B SER 631 50 1 Y 1 B THR 631 ? B THR 632 51 1 Y 1 B LYS 632 ? B LYS 633 52 1 Y 1 B GLU 633 ? B GLU 634 53 1 Y 1 B PHE 634 ? B PHE 635 54 1 Y 1 B TYR 635 ? B TYR 636 55 1 Y 1 B LEU 636 ? B LEU 637 56 1 Y 1 B GLN 637 ? B GLN 638 57 1 Y 1 B CYS 638 ? B CYS 639 58 1 Y 1 B LEU 639 ? B LEU 640 59 1 Y 1 B ILE 640 ? B ILE 641 60 1 Y 1 B LEU 641 ? B LEU 642 61 1 Y 1 B ARG 642 ? B ARG 643 62 1 Y 1 B CYS 643 ? B CYS 644 63 1 Y 1 B ILE 644 ? B ILE 645 64 1 Y 1 C GLU 0 ? C GLU 1 65 1 Y 1 C ALA 1 ? C ALA 2 66 1 Y 1 C GLY 2 ? C GLY 3 67 1 Y 1 C GLY 3 ? C GLY 4 68 1 Y 1 C VAL 4 ? C VAL 5 69 1 Y 1 C SER 621 ? C SER 622 70 1 Y 1 C ASP 622 ? C ASP 623 71 1 Y 1 C GLY 623 ? C GLY 624 72 1 Y 1 C SER 624 ? C SER 625 73 1 Y 1 C ALA 625 ? C ALA 626 74 1 Y 1 C VAL 626 ? C VAL 627 75 1 Y 1 C LEU 627 ? C LEU 628 76 1 Y 1 C ARG 628 ? C ARG 629 77 1 Y 1 C TYR 629 ? C TYR 630 78 1 Y 1 C SER 630 ? C SER 631 79 1 Y 1 C THR 631 ? C THR 632 80 1 Y 1 C LYS 632 ? C LYS 633 81 1 Y 1 C GLU 633 ? C GLU 634 82 1 Y 1 C PHE 634 ? C PHE 635 83 1 Y 1 C TYR 635 ? C TYR 636 84 1 Y 1 C LEU 636 ? C LEU 637 85 1 Y 1 C GLN 637 ? C GLN 638 86 1 Y 1 C CYS 638 ? C CYS 639 87 1 Y 1 C LEU 639 ? C LEU 640 88 1 Y 1 C ILE 640 ? C ILE 641 89 1 Y 1 C LEU 641 ? C LEU 642 90 1 Y 1 C ARG 642 ? C ARG 643 91 1 Y 1 C CYS 643 ? C CYS 644 92 1 Y 1 C ILE 644 ? C ILE 645 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING ONLY' _em_ctf_correction.details ? # _em_entity_assembly_naturalsource.id 1 _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.ncbi_tax_id 1477405 _em_entity_assembly_naturalsource.organ . _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism Faustovirus _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 25 _em_image_recording.average_exposure_time ? _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'GATAN ULTRASCAN 4000 (4k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # _em_imaging_optics.id 1 _em_imaging_optics.imaging_id 1 _em_imaging_optics.chr_aberration_corrector ? _em_imaging_optics.energyfilter_lower ? _em_imaging_optics.energyfilter_name ? _em_imaging_optics.energyfilter_upper ? _em_imaging_optics.phase_plate ? _em_imaging_optics.sph_aberration_corrector ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'PARTICLE SELECTION' 'e2boxer.py was used to manually select particles.' EMAN2 2.1 1 ? ? 2 'IMAGE ACQUISITION' ? Leginon 3.1 ? ? 1 3 MASKING ? ? ? ? ? ? 4 'CTF CORRECTION' ? CTFFIND 4 1 ? ? 5 'LAYERLINE INDEXING' ? ? ? ? ? ? 6 'DIFFRACTION INDEXING' ? ? ? ? ? ? 7 'MODEL FITTING' ? 'UCSF Chimera' 1.10.2 ? 1 ? 8 OTHER ? ? ? ? ? ? 9 'INITIAL EULER ASSIGNMENT' ? jspr ? 1 ? ? 10 'FINAL EULER ASSIGNMENT' ? jspr ? 1 ? ? 11 CLASSIFICATION ? ? ? 1 ? ? 12 RECONSTRUCTION ? jspr ? 1 ? ? 13 'MODEL REFINEMENT' ? ? ? ? 1 ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _em_virus_natural_host.id 1 _em_virus_natural_host.entity_assembly_id 1 _em_virus_natural_host.ncbi_tax_id 5778 _em_virus_natural_host.organism 'Vermamoeba vermiformis' _em_virus_natural_host.strain 'CDC 19' # loop_ _em_virus_shell.id _em_virus_shell.entity_assembly_id _em_virus_shell.diameter _em_virus_shell.name _em_virus_shell.triangulation 1 1 2600 'outer capsid shell' 277 2 1 1900 'inner capsid shell' 16 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number AI011219 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5J7O # _atom_sites.entry_id 5J7V _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_