data_5JDX # _entry.id 5JDX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.319 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5JDX WWPDB D_1000220391 BMRB 30066 # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 30066 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5JDX _pdbx_database_status.recvd_initial_deposition_date 2016-04-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jaremko, M.J.' 1 'Lee, D.J.' 2 'Burkart, M.D.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'PigG holo' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jaremko, M.J.' 1 ? primary 'Lee, D.J.' 2 ? primary 'Burkart, M.D.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative peptidyl carrier protein' 9787.098 1 ? ? ? ? 2 non-polymer man "4'-PHOSPHOPANTETHEINE" 358.348 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PigG holo' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MLESKLINHIATQFLDGEKDGLDSQTPLFELNIVDSAAIFDLVDFLRQESKVSIGMQEIHPANFATVQSMVALVQRLKAH PEQGGAALE ; _entity_poly.pdbx_seq_one_letter_code_can ;MLESKLINHIATQFLDGEKDGLDSQTPLFELNIVDSAAIFDLVDFLRQESKVSIGMQEIHPANFATVQSMVALVQRLKAH PEQGGAALE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 GLU n 1 4 SER n 1 5 LYS n 1 6 LEU n 1 7 ILE n 1 8 ASN n 1 9 HIS n 1 10 ILE n 1 11 ALA n 1 12 THR n 1 13 GLN n 1 14 PHE n 1 15 LEU n 1 16 ASP n 1 17 GLY n 1 18 GLU n 1 19 LYS n 1 20 ASP n 1 21 GLY n 1 22 LEU n 1 23 ASP n 1 24 SER n 1 25 GLN n 1 26 THR n 1 27 PRO n 1 28 LEU n 1 29 PHE n 1 30 GLU n 1 31 LEU n 1 32 ASN n 1 33 ILE n 1 34 VAL n 1 35 ASP n 1 36 SER n 1 37 ALA n 1 38 ALA n 1 39 ILE n 1 40 PHE n 1 41 ASP n 1 42 LEU n 1 43 VAL n 1 44 ASP n 1 45 PHE n 1 46 LEU n 1 47 ARG n 1 48 GLN n 1 49 GLU n 1 50 SER n 1 51 LYS n 1 52 VAL n 1 53 SER n 1 54 ILE n 1 55 GLY n 1 56 MET n 1 57 GLN n 1 58 GLU n 1 59 ILE n 1 60 HIS n 1 61 PRO n 1 62 ALA n 1 63 ASN n 1 64 PHE n 1 65 ALA n 1 66 THR n 1 67 VAL n 1 68 GLN n 1 69 SER n 1 70 MET n 1 71 VAL n 1 72 ALA n 1 73 LEU n 1 74 VAL n 1 75 GLN n 1 76 ARG n 1 77 LEU n 1 78 LYS n 1 79 ALA n 1 80 HIS n 1 81 PRO n 1 82 GLU n 1 83 GLN n 1 84 GLY n 1 85 GLY n 1 86 ALA n 1 87 ALA n 1 88 LEU n 1 89 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 89 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene pigG _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Serratia sp.' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 616 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5W265_9ENTR _struct_ref.pdbx_db_accession Q5W265 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLESKLINHIATQFLDGEKDGLDSQTPLFELNIVDSAAIFDLVDFLRQESKVSIGMQEIHPANFATVQSMVALVQRLKAH PEQGGAA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5JDX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 87 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5W265 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 87 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 87 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5JDX LEU A 88 ? UNP Q5W265 ? ? 'expression tag' 88 1 1 5JDX GLU A 89 ? UNP Q5W265 ? ? 'expression tag' 89 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PNS non-polymer . "4'-PHOSPHOPANTETHEINE" ? 'C11 H23 N2 O7 P S' 358.348 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D HNCACB' 1 isotropic 3 1 1 '3D HNCO' 1 isotropic 4 1 1 '3D CBCA(CO)NH' 1 isotropic 5 1 1 '3D 1H-15N NOESY' 1 isotropic 6 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 7 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic 8 1 1 '2D 1H-13C HSQC' 1 isotropic 9 1 1 '3D HCCH-TOCSY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 25 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label Conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units C # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.5 mM [U-13C; U-15N] PigG, 50 mM KPi, 5 mM TCEP, .1 % sodium azide, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 15N-13C_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model vs800 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 5JDX _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 5JDX _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5JDX _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 2 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 3 'chemical shift assignment' Sparky ? Goddard 4 'peak picking' Sparky ? Goddard # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5JDX _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5JDX _struct.title 'PigG holo' _struct.pdbx_descriptor 'Putative peptidyl carrier protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5JDX _struct_keywords.text 'peptidyl carrier protein, prodigiosin, pyrrole, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 1 ? ASP A 16 ? MET A 1 ASP A 16 1 ? 16 HELX_P HELX_P2 AA2 ASP A 35 ? SER A 50 ? ASP A 35 SER A 50 1 ? 16 HELX_P HELX_P3 AA3 THR A 66 ? LYS A 78 ? THR A 66 LYS A 78 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id SER _struct_conn.ptnr1_label_seq_id 36 _struct_conn.ptnr1_label_atom_id OG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id PNS _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id P24 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id SER _struct_conn.ptnr1_auth_seq_id 36 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id PNS _struct_conn.ptnr2_auth_seq_id 101 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.588 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id PNS _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'binding site for residue PNS A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 SER A 36 ? SER A 36 . ? 1_555 ? 2 AC1 3 MET A 56 ? MET A 56 . ? 1_555 ? 3 AC1 3 ILE A 59 ? ILE A 59 . ? 1_555 ? # _atom_sites.entry_id 5JDX _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 GLU 89 89 89 GLU GLU A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id PNS _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 136 _pdbx_nonpoly_scheme.pdb_mon_id PNS _pdbx_nonpoly_scheme.auth_mon_id PNS _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-08-23 2 'Structure model' 1 1 2017-09-27 3 'Structure model' 1 2 2019-12-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' pdbx_audit_support 3 3 'Structure model' pdbx_nmr_software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_pdbx_audit_support.funding_organization' 3 3 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 PigG 1.5 ? mM '[U-13C; U-15N]' 1 KPi 50 ? mM 'natural abundance' 1 TCEP 5 ? mM 'natural abundance' 1 'sodium azide' .1 ? % 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 20 ? ? -161.99 115.60 2 1 PRO A 27 ? ? -67.98 98.97 3 2 ASP A 20 ? ? -160.41 113.60 4 2 PRO A 27 ? ? -66.49 96.42 5 2 ALA A 86 ? ? -67.18 90.04 6 3 ASP A 16 ? ? 71.47 30.85 7 3 ASP A 20 ? ? -160.67 115.42 8 3 ILE A 59 ? ? -66.46 93.67 9 4 LEU A 2 ? ? -158.16 -44.24 10 5 ILE A 59 ? ? -68.07 95.62 11 6 ASP A 20 ? ? -175.16 139.97 12 6 ALA A 87 ? ? -160.42 117.46 13 7 LEU A 2 ? ? -145.22 -46.20 14 7 ASP A 20 ? ? -162.32 116.64 15 9 PRO A 27 ? ? -67.49 99.61 16 9 ALA A 86 ? ? 74.02 -60.31 17 10 ASP A 20 ? ? -165.46 109.11 18 10 PRO A 81 ? ? -71.32 -70.49 19 10 ALA A 86 ? ? 72.44 -15.95 20 11 ASP A 20 ? ? -170.97 129.20 21 11 LYS A 51 ? ? 62.43 60.68 22 11 LEU A 88 ? ? -59.96 100.81 23 13 ASP A 20 ? ? -175.06 134.50 24 13 GLN A 83 ? ? -120.78 -67.39 25 14 ASP A 20 ? ? -162.94 108.34 26 14 PRO A 27 ? ? -69.56 95.26 27 15 GLU A 82 ? ? -162.61 100.29 28 15 ALA A 87 ? ? -99.43 42.51 29 15 LEU A 88 ? ? -63.13 96.60 30 16 LEU A 2 ? ? -142.03 37.82 31 16 LYS A 51 ? ? 61.48 60.31 32 16 ILE A 59 ? ? -65.69 96.50 33 19 GLU A 82 ? ? -172.85 97.46 34 19 ALA A 86 ? ? -165.44 114.06 35 20 ILE A 59 ? ? -69.41 89.22 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' CA009523 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM095970 2 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name "4'-PHOSPHOPANTETHEINE" _pdbx_entity_nonpoly.comp_id PNS #