data_5K89 # _entry.id 5K89 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5K89 pdb_00005k89 10.2210/pdb5k89/pdb WWPDB D_1000221665 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5K89 _pdbx_database_status.recvd_initial_deposition_date 2016-05-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Melville, Z.' 1 'Aligholizadeh, E.' 2 'McKnight, L.E.' 3 'Weber, D.' 4 'Pozharski, E.' 5 'Weber, D.J.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr F Struct Biol Commun' _citation.journal_id_ASTM ACSFEN _citation.journal_id_CSD ? _citation.journal_id_ISSN 2053-230X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 73 _citation.language ? _citation.page_first 215 _citation.page_last 221 _citation.title 'X-ray crystal structure of human calcium-bound S100A1.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2053230X17003983 _citation.pdbx_database_id_PubMed 28368280 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Melville, Z.' 1 ? primary 'Aligholizadeh, E.' 2 ? primary 'McKnight, L.E.' 3 ? primary 'Weber, D.J.' 4 ? primary 'Pozharski, E.' 5 ? primary 'Weber, D.J.' 6 ? # _cell.length_a 53.547 _cell.length_b 53.547 _cell.length_c 193.387 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 5K89 _cell.Z_PDB 18 _cell.pdbx_unique_axis ? # _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.entry_id 5K89 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein S100-A1' 10556.783 3 ? ? ? ? 2 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 6 ? ? ? ? 4 water nat water 18.015 14 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'S-100 protein alpha chain,S-100 protein subunit alpha,S100 calcium-binding protein A1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVA ALTVACNNFFWENS ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVA ALTVACNNFFWENS ; _entity_poly.pdbx_strand_id A,C,H _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 GLU n 1 5 LEU n 1 6 GLU n 1 7 THR n 1 8 ALA n 1 9 MET n 1 10 GLU n 1 11 THR n 1 12 LEU n 1 13 ILE n 1 14 ASN n 1 15 VAL n 1 16 PHE n 1 17 HIS n 1 18 ALA n 1 19 HIS n 1 20 SER n 1 21 GLY n 1 22 LYS n 1 23 GLU n 1 24 GLY n 1 25 ASP n 1 26 LYS n 1 27 TYR n 1 28 LYS n 1 29 LEU n 1 30 SER n 1 31 LYS n 1 32 LYS n 1 33 GLU n 1 34 LEU n 1 35 LYS n 1 36 GLU n 1 37 LEU n 1 38 LEU n 1 39 GLN n 1 40 THR n 1 41 GLU n 1 42 LEU n 1 43 SER n 1 44 GLY n 1 45 PHE n 1 46 LEU n 1 47 ASP n 1 48 ALA n 1 49 GLN n 1 50 LYS n 1 51 ASP n 1 52 VAL n 1 53 ASP n 1 54 ALA n 1 55 VAL n 1 56 ASP n 1 57 LYS n 1 58 VAL n 1 59 MET n 1 60 LYS n 1 61 GLU n 1 62 LEU n 1 63 ASP n 1 64 GLU n 1 65 ASN n 1 66 GLY n 1 67 ASP n 1 68 GLY n 1 69 GLU n 1 70 VAL n 1 71 ASP n 1 72 PHE n 1 73 GLN n 1 74 GLU n 1 75 TYR n 1 76 VAL n 1 77 VAL n 1 78 LEU n 1 79 VAL n 1 80 ALA n 1 81 ALA n 1 82 LEU n 1 83 THR n 1 84 VAL n 1 85 ALA n 1 86 CYS n 1 87 ASN n 1 88 ASN n 1 89 PHE n 1 90 PHE n 1 91 TRP n 1 92 GLU n 1 93 ASN n 1 94 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 94 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'S100A1, S100A' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pet-11b _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pUC57 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code S10A1_HUMAN _struct_ref.pdbx_db_accession P23297 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVA ALTVACNNFFWENS ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5K89 A 1 ? 94 ? P23297 1 ? 94 ? 1 94 2 1 5K89 C 1 ? 94 ? P23297 1 ? 94 ? 1 94 3 1 5K89 H 1 ? 94 ? P23297 1 ? 94 ? 1 94 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TRS non-polymer . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1' 122.143 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5K89 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.53 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.33 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.00 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 8000, calcium chloride, cacodylate' _exptl_crystal_grow.pdbx_pH_range 7.00-7.50 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-04-25 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.1271 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL7-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.1271 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL7-1 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.entry_id 5K89 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 37.644 _reflns.d_resolution_high 2.25 _reflns.number_obs 14767 _reflns.number_all ? _reflns.percent_possible_obs 92.000 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.185 _reflns.pdbx_netI_over_sigmaI 14.450 _reflns.B_iso_Wilson_estimate 50.570 _reflns.pdbx_redundancy 5.100 _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_CC_half ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_chi_squared ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.details ? # _reflns_shell.d_res_high 2.37 _reflns_shell.d_res_low 2.50 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.500 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 83.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.53800 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.00 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.entry_id 5K89 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 2.2490 _refine.ls_d_res_low 37.6440 _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 91.7300 _refine.ls_number_reflns_obs 14767 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details RANDOM _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2754 _refine.ls_R_factor_R_work 0.2746 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2905 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.1300 _refine.ls_number_reflns_R_free 757 _refine.ls_number_reflns_R_work 14010 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 82.5976 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.5300 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 2Y5I _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 167.440 _refine.B_iso_min 31.690 _refine.pdbx_overall_phase_error 45.4100 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.2490 _refine_hist.d_res_low 37.6440 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.number_atoms_solvent 14 _refine_hist.number_atoms_total 2093 _refine_hist.pdbx_number_residues_total 263 _refine_hist.pdbx_B_iso_mean_ligand 73.56 _refine_hist.pdbx_B_iso_mean_solvent 58.04 _refine_hist.pdbx_number_atoms_protein 2065 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' f_bond_d 2097 0.009 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 2815 0.959 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 320 0.059 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 361 0.006 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 763 24.733 ? ? ? # loop_ _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.pdbx_ens_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_weight 1 'X-RAY DIFFRACTION' 1 1 TORSIONAL A 812 12.419 ? ? ? ? ? ? ? 2 'X-RAY DIFFRACTION' 1 2 TORSIONAL C 812 12.419 ? ? ? ? ? ? ? 3 'X-RAY DIFFRACTION' 1 3 TORSIONAL H 812 12.419 ? ? ? ? ? ? ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id _refine_ls_shell.R_factor_obs 2.2487 2.4223 5 63.0000 1888 . 0.4565 0.4955 . 77 0.0000 1965 . 'X-RAY DIFFRACTION' . 2.4223 2.6660 5 97.0000 2893 . 0.4138 0.4564 . 149 0.0000 3042 . 'X-RAY DIFFRACTION' . 2.6660 3.0516 5 99.0000 2982 . 0.3775 0.4077 . 158 0.0000 3140 . 'X-RAY DIFFRACTION' . 3.0516 3.8441 5 99.0000 3027 . 0.2899 0.3230 . 204 0.0000 3231 . 'X-RAY DIFFRACTION' . 3.8441 37.6496 5 100.0000 3220 . 0.2121 0.2165 . 169 0.0000 3389 . 'X-RAY DIFFRACTION' . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name O or name N or name CA )) or (resid 55 and (name O or name N or name C or name CB or name CG1)) or (resid 56 and (name O or name N or name C or name CB or name CG or name OD1)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 2 ;(chain C and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name N or name CA or name C )) or (resid 55 and (name N or name CA or name CB or name CG1 or name CG2)) or (resid 56 and (name N or name CA or name CB or name CG or name OD1 or name OD2)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 3 ;(chain H and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name O or name N or name CA )) or (resid 55 and (name N or name CA or name CB or name CG1 or name CG2)) or (resid 56 and (name N or name CA or name CB or name CG or name OD1 or name OD2)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A SER 3 . A SER 3 . A SER 3 A SER 3 ? ;(chain A and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name O or name N or name CA )) or (resid 55 and (name O or name N or name C or name CB or name CG1)) or (resid 56 and (name O or name N or name C or name CB or name CG or name OD1)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 1 2 A GLU 4 . A GLU 4 . A GLU 4 A GLU 4 ? ;(chain A and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name O or name N or name CA )) or (resid 55 and (name O or name N or name C or name CB or name CG1)) or (resid 56 and (name O or name N or name C or name CB or name CG or name OD1)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 1 3 A MET 1 . A PHE 90 . A MET 1 A PHE 90 ? ;(chain A and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name O or name N or name CA )) or (resid 55 and (name O or name N or name C or name CB or name CG1)) or (resid 56 and (name O or name N or name C or name CB or name CG or name OD1)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 1 4 A MET 1 . A PHE 90 . A MET 1 A PHE 90 ? ;(chain A and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name O or name N or name CA )) or (resid 55 and (name O or name N or name C or name CB or name CG1)) or (resid 56 and (name O or name N or name C or name CB or name CG or name OD1)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 1 5 A MET 1 . A PHE 90 . A MET 1 A PHE 90 ? ;(chain A and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name O or name N or name CA )) or (resid 55 and (name O or name N or name C or name CB or name CG1)) or (resid 56 and (name O or name N or name C or name CB or name CG or name OD1)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 1 6 A MET 1 . A PHE 90 . A MET 1 A PHE 90 ? ;(chain A and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name O or name N or name CA )) or (resid 55 and (name O or name N or name C or name CB or name CG1)) or (resid 56 and (name O or name N or name C or name CB or name CG or name OD1)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 1 7 A MET 1 . A PHE 90 . A MET 1 A PHE 90 ? ;(chain A and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name O or name N or name CA )) or (resid 55 and (name O or name N or name C or name CB or name CG1)) or (resid 56 and (name O or name N or name C or name CB or name CG or name OD1)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 1 8 A MET 1 . A PHE 90 . A MET 1 A PHE 90 ? ;(chain A and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name O or name N or name CA )) or (resid 55 and (name O or name N or name C or name CB or name CG1)) or (resid 56 and (name O or name N or name C or name CB or name CG or name OD1)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 2 1 B SER 3 . B SER 3 . C SER 3 C SER 3 ? ;(chain C and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name N or name CA or name C )) or (resid 55 and (name N or name CA or name CB or name CG1 or name CG2)) or (resid 56 and (name N or name CA or name CB or name CG or name OD1 or name OD2)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 2 2 B GLU 4 . B GLU 4 . C GLU 4 C GLU 4 ? ;(chain C and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name N or name CA or name C )) or (resid 55 and (name N or name CA or name CB or name CG1 or name CG2)) or (resid 56 and (name N or name CA or name CB or name CG or name OD1 or name OD2)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 2 3 B SER 3 . B SER 94 . C SER 3 C SER 94 ? ;(chain C and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name N or name CA or name C )) or (resid 55 and (name N or name CA or name CB or name CG1 or name CG2)) or (resid 56 and (name N or name CA or name CB or name CG or name OD1 or name OD2)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 2 4 B SER 3 . B SER 94 . C SER 3 C SER 94 ? ;(chain C and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name N or name CA or name C )) or (resid 55 and (name N or name CA or name CB or name CG1 or name CG2)) or (resid 56 and (name N or name CA or name CB or name CG or name OD1 or name OD2)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 2 5 B SER 3 . B SER 94 . C SER 3 C SER 94 ? ;(chain C and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name N or name CA or name C )) or (resid 55 and (name N or name CA or name CB or name CG1 or name CG2)) or (resid 56 and (name N or name CA or name CB or name CG or name OD1 or name OD2)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 2 6 B SER 3 . B SER 94 . C SER 3 C SER 94 ? ;(chain C and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name N or name CA or name C )) or (resid 55 and (name N or name CA or name CB or name CG1 or name CG2)) or (resid 56 and (name N or name CA or name CB or name CG or name OD1 or name OD2)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 2 7 B SER 3 . B SER 94 . C SER 3 C SER 94 ? ;(chain C and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name N or name CA or name C )) or (resid 55 and (name N or name CA or name CB or name CG1 or name CG2)) or (resid 56 and (name N or name CA or name CB or name CG or name OD1 or name OD2)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 2 8 B SER 3 . B SER 94 . C SER 3 C SER 94 ? ;(chain C and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name N or name CA or name C )) or (resid 55 and (name N or name CA or name CB or name CG1 or name CG2)) or (resid 56 and (name N or name CA or name CB or name CG or name OD1 or name OD2)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 3 1 C SER 3 . C SER 3 . H SER 3 H SER 3 ? ;(chain H and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name O or name N or name CA )) or (resid 55 and (name N or name CA or name CB or name CG1 or name CG2)) or (resid 56 and (name N or name CA or name CB or name CG or name OD1 or name OD2)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 3 2 C GLU 4 . C GLU 4 . H GLU 4 H GLU 4 ? ;(chain H and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name O or name N or name CA )) or (resid 55 and (name N or name CA or name CB or name CG1 or name CG2)) or (resid 56 and (name N or name CA or name CB or name CG or name OD1 or name OD2)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 3 3 C MET 1 . C SER 94 . H MET 1 H SER 94 ? ;(chain H and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name O or name N or name CA )) or (resid 55 and (name N or name CA or name CB or name CG1 or name CG2)) or (resid 56 and (name N or name CA or name CB or name CG or name OD1 or name OD2)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 3 4 C MET 1 . C SER 94 . H MET 1 H SER 94 ? ;(chain H and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name O or name N or name CA )) or (resid 55 and (name N or name CA or name CB or name CG1 or name CG2)) or (resid 56 and (name N or name CA or name CB or name CG or name OD1 or name OD2)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 3 5 C MET 1 . C SER 94 . H MET 1 H SER 94 ? ;(chain H and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name O or name N or name CA )) or (resid 55 and (name N or name CA or name CB or name CG1 or name CG2)) or (resid 56 and (name N or name CA or name CB or name CG or name OD1 or name OD2)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 3 6 C MET 1 . C SER 94 . H MET 1 H SER 94 ? ;(chain H and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name O or name N or name CA )) or (resid 55 and (name N or name CA or name CB or name CG1 or name CG2)) or (resid 56 and (name N or name CA or name CB or name CG or name OD1 or name OD2)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 3 7 C MET 1 . C SER 94 . H MET 1 H SER 94 ? ;(chain H and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name O or name N or name CA )) or (resid 55 and (name N or name CA or name CB or name CG1 or name CG2)) or (resid 56 and (name N or name CA or name CB or name CG or name OD1 or name OD2)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; 1 3 8 C MET 1 . C SER 94 . H MET 1 H SER 94 ? ;(chain H and (resseq 3 or (resid 4 and (name N or name CA or name CB or name CG or name CD or name OE1 or name OE2)) or resseq 5:21 or resseq 24:25 or (resid 27 and (name N or name CA or name CB or name CG or name CD1 or name CE1 or name CZ or name OH )) or resseq 28:31 or resseq 33:34 or (resid 35 and (name N or name CA or name CB or name CG or name CD or name CE or name NZ )) or resseq 36:42 or resseq 44 or resseq 53 or (resid 54 and (name O or name N or name CA )) or (resid 55 and (name N or name CA or name CB or name CG1 or name CG2)) or (resid 56 and (name N or name CA or name CB or name CG or name OD1 or name OD2)) or resseq 58:59 or resseq 61:63 or resseq 65:72 or resseq 74:88)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 5K89 _struct.title 'Crystal Structure of Human Calcium-Bound S100A1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5K89 _struct_keywords.text 'S100, S100A1, calcium, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? I N N 3 ? J N N 3 ? K N N 4 ? L N N 4 ? M N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 3 ? GLY A 21 ? SER A 3 GLY A 21 1 ? 19 HELX_P HELX_P2 AA2 SER A 30 ? LEU A 42 ? SER A 30 LEU A 42 1 ? 13 HELX_P HELX_P3 AA3 ALA A 54 ? ASP A 63 ? ALA A 54 ASP A 63 1 ? 10 HELX_P HELX_P4 AA4 PHE A 72 ? PHE A 90 ? PHE A 72 PHE A 90 1 ? 19 HELX_P HELX_P5 AA5 GLU B 4 ? GLY B 21 ? GLU C 4 GLY C 21 1 ? 18 HELX_P HELX_P6 AA6 SER B 30 ? LEU B 42 ? SER C 30 LEU C 42 1 ? 13 HELX_P HELX_P7 AA7 ASP B 53 ? ASP B 63 ? ASP C 53 ASP C 63 1 ? 11 HELX_P HELX_P8 AA8 ASP B 71 ? TRP B 91 ? ASP C 71 TRP C 91 1 ? 21 HELX_P HELX_P9 AA9 SER C 3 ? GLY C 21 ? SER H 3 GLY H 21 1 ? 19 HELX_P HELX_P10 AB1 SER C 30 ? LEU C 42 ? SER H 30 LEU H 42 1 ? 13 HELX_P HELX_P11 AB2 ALA C 54 ? ASP C 63 ? ALA H 54 ASP H 63 1 ? 10 HELX_P HELX_P12 AB3 PHE C 72 ? PHE C 89 ? PHE H 72 PHE H 89 1 ? 18 HELX_P HELX_P13 AB4 PHE C 90 ? SER C 94 ? PHE H 90 SER H 94 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A SER 20 O ? ? ? 1_555 F CA . CA ? ? A SER 20 A CA 103 1_555 ? ? ? ? ? ? ? 2.386 ? ? metalc2 metalc ? ? A GLU 23 O ? ? ? 1_555 F CA . CA ? ? A GLU 23 A CA 103 1_555 ? ? ? ? ? ? ? 2.354 ? ? metalc3 metalc ? ? A ASP 25 O ? ? ? 1_555 F CA . CA ? ? A ASP 25 A CA 103 1_555 ? ? ? ? ? ? ? 2.530 ? ? metalc4 metalc ? ? A LYS 28 O ? ? ? 1_555 F CA . CA ? ? A LYS 28 A CA 103 1_555 ? ? ? ? ? ? ? 2.578 ? ? metalc5 metalc ? ? A GLU 33 OE1 ? ? ? 1_555 F CA . CA ? ? A GLU 33 A CA 103 1_555 ? ? ? ? ? ? ? 2.600 ? ? metalc6 metalc ? ? A GLU 33 OE2 ? ? ? 1_555 F CA . CA ? ? A GLU 33 A CA 103 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc7 metalc ? ? A ASP 63 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 63 A CA 102 1_555 ? ? ? ? ? ? ? 2.559 ? ? metalc8 metalc ? ? A ASN 65 OD1 ? ? ? 1_555 E CA . CA ? ? A ASN 65 A CA 102 1_555 ? ? ? ? ? ? ? 2.337 ? ? metalc9 metalc ? ? A ASP 67 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 67 A CA 102 1_555 ? ? ? ? ? ? ? 3.119 ? ? metalc10 metalc ? ? A ASP 67 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 67 A CA 102 1_555 ? ? ? ? ? ? ? 2.403 ? ? metalc11 metalc ? ? A GLU 69 O ? ? ? 1_555 E CA . CA ? ? A GLU 69 A CA 102 1_555 ? ? ? ? ? ? ? 2.257 ? ? metalc12 metalc ? ? A GLU 74 OE1 ? ? ? 1_555 E CA . CA ? ? A GLU 74 A CA 102 1_555 ? ? ? ? ? ? ? 2.476 ? ? metalc13 metalc ? ? A GLU 74 OE2 ? ? ? 1_555 E CA . CA ? ? A GLU 74 A CA 102 1_555 ? ? ? ? ? ? ? 2.975 ? ? metalc14 metalc ? ? F CA . CA ? ? ? 1_555 K HOH . O ? ? A CA 103 A HOH 202 1_555 ? ? ? ? ? ? ? 2.218 ? ? metalc15 metalc ? ? B SER 20 O ? ? ? 1_555 H CA . CA ? ? C SER 20 C CA 102 1_555 ? ? ? ? ? ? ? 2.326 ? ? metalc16 metalc ? ? B GLU 23 O ? ? ? 1_555 H CA . CA ? ? C GLU 23 C CA 102 1_555 ? ? ? ? ? ? ? 2.500 ? ? metalc17 metalc ? ? B ASP 25 O ? ? ? 1_555 H CA . CA ? ? C ASP 25 C CA 102 1_555 ? ? ? ? ? ? ? 2.405 ? ? metalc18 metalc ? ? B LYS 28 O ? ? ? 1_555 H CA . CA ? ? C LYS 28 C CA 102 1_555 ? ? ? ? ? ? ? 2.495 ? ? metalc19 metalc ? ? B GLU 33 OE1 ? ? ? 1_555 H CA . CA ? ? C GLU 33 C CA 102 1_555 ? ? ? ? ? ? ? 2.507 ? ? metalc20 metalc ? ? B GLU 33 OE2 ? ? ? 1_555 H CA . CA ? ? C GLU 33 C CA 102 1_555 ? ? ? ? ? ? ? 2.794 ? ? metalc21 metalc ? ? B ASP 63 OD2 ? ? ? 1_555 G CA . CA ? ? C ASP 63 C CA 101 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc22 metalc ? ? B ASN 65 OD1 ? ? ? 1_555 G CA . CA ? ? C ASN 65 C CA 101 1_555 ? ? ? ? ? ? ? 2.672 ? ? metalc23 metalc ? ? B ASP 67 OD1 ? ? ? 1_555 G CA . CA ? ? C ASP 67 C CA 101 1_555 ? ? ? ? ? ? ? 2.689 ? ? metalc24 metalc ? ? B GLU 69 O ? ? ? 1_555 G CA . CA ? ? C GLU 69 C CA 101 1_555 ? ? ? ? ? ? ? 2.372 ? ? metalc25 metalc ? ? B GLU 74 OE1 ? ? ? 1_555 G CA . CA ? ? C GLU 74 C CA 101 1_555 ? ? ? ? ? ? ? 2.932 ? ? metalc26 metalc ? ? B GLU 74 OE2 ? ? ? 1_555 G CA . CA ? ? C GLU 74 C CA 101 1_555 ? ? ? ? ? ? ? 2.481 ? ? metalc27 metalc ? ? G CA . CA ? ? ? 1_555 L HOH . O ? ? C CA 101 C HOH 201 1_555 ? ? ? ? ? ? ? 2.940 ? ? metalc28 metalc ? ? C SER 20 O ? ? ? 1_555 J CA . CA ? ? H SER 20 H CA 102 1_555 ? ? ? ? ? ? ? 2.326 ? ? metalc29 metalc ? ? C GLU 23 O ? ? ? 1_555 J CA . CA ? ? H GLU 23 H CA 102 1_555 ? ? ? ? ? ? ? 2.181 ? ? metalc30 metalc ? ? C ASP 25 O ? ? ? 1_555 J CA . CA ? ? H ASP 25 H CA 102 1_555 ? ? ? ? ? ? ? 2.442 ? ? metalc31 metalc ? ? C LYS 28 O ? ? ? 1_555 J CA . CA ? ? H LYS 28 H CA 102 1_555 ? ? ? ? ? ? ? 3.019 ? ? metalc32 metalc ? ? C GLU 33 OE1 ? ? ? 1_555 J CA . CA ? ? H GLU 33 H CA 102 1_555 ? ? ? ? ? ? ? 2.410 ? ? metalc33 metalc ? ? C GLU 33 OE2 ? ? ? 1_555 J CA . CA ? ? H GLU 33 H CA 102 1_555 ? ? ? ? ? ? ? 2.374 ? ? metalc34 metalc ? ? C ASP 63 OD2 ? ? ? 1_555 I CA . CA ? ? H ASP 63 H CA 101 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc35 metalc ? ? C ASN 65 OD1 ? ? ? 1_555 I CA . CA ? ? H ASN 65 H CA 101 1_555 ? ? ? ? ? ? ? 2.310 ? ? metalc36 metalc ? ? C ASP 67 OD2 ? ? ? 1_555 I CA . CA ? ? H ASP 67 H CA 101 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc37 metalc ? ? C GLU 69 O ? ? ? 1_555 I CA . CA ? ? H GLU 69 H CA 101 1_555 ? ? ? ? ? ? ? 2.294 ? ? metalc38 metalc ? ? C GLU 74 OE1 ? ? ? 1_555 I CA . CA ? ? H GLU 74 H CA 101 1_555 ? ? ? ? ? ? ? 3.172 ? ? metalc39 metalc ? ? C GLU 74 OE2 ? ? ? 1_555 I CA . CA ? ? H GLU 74 H CA 101 1_555 ? ? ? ? ? ? ? 2.709 ? ? metalc40 metalc ? ? J CA . CA ? ? ? 1_555 M HOH . O ? ? H CA 102 H HOH 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 28 ? LEU A 29 ? LYS A 28 LEU A 29 AA1 2 VAL A 70 ? ASP A 71 ? VAL A 70 ASP A 71 AA2 1 LYS C 28 ? LEU C 29 ? LYS H 28 LEU H 29 AA2 2 VAL C 70 ? ASP C 71 ? VAL H 70 ASP H 71 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 29 ? N LEU A 29 O VAL A 70 ? O VAL A 70 AA2 1 2 N LEU C 29 ? N LEU H 29 O VAL C 70 ? O VAL H 70 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A TRS 101 ? 4 'binding site for residue TRS A 101' AC2 Software A CA 102 ? 5 'binding site for residue CA A 102' AC3 Software A CA 103 ? 6 'binding site for residue CA A 103' AC4 Software C CA 101 ? 6 'binding site for residue CA C 101' AC5 Software C CA 102 ? 5 'binding site for residue CA C 102' AC6 Software H CA 101 ? 5 'binding site for residue CA H 101' AC7 Software H CA 102 ? 6 'binding site for residue CA H 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLN A 39 ? GLN A 39 . ? 1_555 ? 2 AC1 4 SER A 43 ? SER A 43 . ? 1_555 ? 3 AC1 4 GLU C 6 ? GLU H 6 . ? 5_675 ? 4 AC1 4 CYS C 86 ? CYS H 86 . ? 1_555 ? 5 AC2 5 ASP A 63 ? ASP A 63 . ? 1_555 ? 6 AC2 5 ASN A 65 ? ASN A 65 . ? 1_555 ? 7 AC2 5 ASP A 67 ? ASP A 67 . ? 1_555 ? 8 AC2 5 GLU A 69 ? GLU A 69 . ? 1_555 ? 9 AC2 5 GLU A 74 ? GLU A 74 . ? 1_555 ? 10 AC3 6 SER A 20 ? SER A 20 . ? 1_555 ? 11 AC3 6 GLU A 23 ? GLU A 23 . ? 1_555 ? 12 AC3 6 ASP A 25 ? ASP A 25 . ? 1_555 ? 13 AC3 6 LYS A 28 ? LYS A 28 . ? 1_555 ? 14 AC3 6 GLU A 33 ? GLU A 33 . ? 1_555 ? 15 AC3 6 HOH K . ? HOH A 202 . ? 1_555 ? 16 AC4 6 ASP B 63 ? ASP C 63 . ? 1_555 ? 17 AC4 6 ASN B 65 ? ASN C 65 . ? 1_555 ? 18 AC4 6 ASP B 67 ? ASP C 67 . ? 1_555 ? 19 AC4 6 GLU B 69 ? GLU C 69 . ? 1_555 ? 20 AC4 6 GLU B 74 ? GLU C 74 . ? 1_555 ? 21 AC4 6 HOH L . ? HOH C 201 . ? 1_555 ? 22 AC5 5 SER B 20 ? SER C 20 . ? 1_555 ? 23 AC5 5 GLU B 23 ? GLU C 23 . ? 1_555 ? 24 AC5 5 ASP B 25 ? ASP C 25 . ? 1_555 ? 25 AC5 5 LYS B 28 ? LYS C 28 . ? 1_555 ? 26 AC5 5 GLU B 33 ? GLU C 33 . ? 1_555 ? 27 AC6 5 ASP C 63 ? ASP H 63 . ? 1_555 ? 28 AC6 5 ASN C 65 ? ASN H 65 . ? 1_555 ? 29 AC6 5 ASP C 67 ? ASP H 67 . ? 1_555 ? 30 AC6 5 GLU C 69 ? GLU H 69 . ? 1_555 ? 31 AC6 5 GLU C 74 ? GLU H 74 . ? 1_555 ? 32 AC7 6 SER C 20 ? SER H 20 . ? 1_555 ? 33 AC7 6 GLU C 23 ? GLU H 23 . ? 1_555 ? 34 AC7 6 ASP C 25 ? ASP H 25 . ? 1_555 ? 35 AC7 6 LYS C 28 ? LYS H 28 . ? 1_555 ? 36 AC7 6 GLU C 33 ? GLU H 33 . ? 1_555 ? 37 AC7 6 HOH M . ? HOH H 201 . ? 1_555 ? # _atom_sites.entry_id 5K89 _atom_sites.fract_transf_matrix[1][1] 0.018675 _atom_sites.fract_transf_matrix[1][2] 0.010782 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021564 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005171 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol AS C CA H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ALA 48 48 ? ? ? A . n A 1 49 GLN 49 49 ? ? ? A . n A 1 50 LYS 50 50 ? ? ? A . n A 1 51 ASP 51 51 ? ? ? A . n A 1 52 VAL 52 52 ? ? ? A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 CYS 86 86 86 CYS CYS A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 TRP 91 91 ? ? ? A . n A 1 92 GLU 92 92 ? ? ? A . n A 1 93 ASN 93 93 ? ? ? A . n A 1 94 SER 94 94 ? ? ? A . n B 1 1 MET 1 1 ? ? ? C . n B 1 2 GLY 2 2 ? ? ? C . n B 1 3 SER 3 3 3 SER SER C . n B 1 4 GLU 4 4 4 GLU GLU C . n B 1 5 LEU 5 5 5 LEU LEU C . n B 1 6 GLU 6 6 6 GLU GLU C . n B 1 7 THR 7 7 7 THR THR C . n B 1 8 ALA 8 8 8 ALA ALA C . n B 1 9 MET 9 9 9 MET MET C . n B 1 10 GLU 10 10 10 GLU GLU C . n B 1 11 THR 11 11 11 THR THR C . n B 1 12 LEU 12 12 12 LEU LEU C . n B 1 13 ILE 13 13 13 ILE ILE C . n B 1 14 ASN 14 14 14 ASN ASN C . n B 1 15 VAL 15 15 15 VAL VAL C . n B 1 16 PHE 16 16 16 PHE PHE C . n B 1 17 HIS 17 17 17 HIS HIS C . n B 1 18 ALA 18 18 18 ALA ALA C . n B 1 19 HIS 19 19 19 HIS HIS C . n B 1 20 SER 20 20 20 SER SER C . n B 1 21 GLY 21 21 21 GLY GLY C . n B 1 22 LYS 22 22 22 LYS LYS C . n B 1 23 GLU 23 23 23 GLU GLU C . n B 1 24 GLY 24 24 24 GLY GLY C . n B 1 25 ASP 25 25 25 ASP ASP C . n B 1 26 LYS 26 26 26 LYS LYS C . n B 1 27 TYR 27 27 27 TYR TYR C . n B 1 28 LYS 28 28 28 LYS LYS C . n B 1 29 LEU 29 29 29 LEU LEU C . n B 1 30 SER 30 30 30 SER SER C . n B 1 31 LYS 31 31 31 LYS LYS C . n B 1 32 LYS 32 32 32 LYS LYS C . n B 1 33 GLU 33 33 33 GLU GLU C . n B 1 34 LEU 34 34 34 LEU LEU C . n B 1 35 LYS 35 35 35 LYS LYS C . n B 1 36 GLU 36 36 36 GLU GLU C . n B 1 37 LEU 37 37 37 LEU LEU C . n B 1 38 LEU 38 38 38 LEU LEU C . n B 1 39 GLN 39 39 39 GLN GLN C . n B 1 40 THR 40 40 40 THR THR C . n B 1 41 GLU 41 41 41 GLU GLU C . n B 1 42 LEU 42 42 42 LEU LEU C . n B 1 43 SER 43 43 43 SER SER C . n B 1 44 GLY 44 44 44 GLY GLY C . n B 1 45 PHE 45 45 45 PHE PHE C . n B 1 46 LEU 46 46 46 LEU LEU C . n B 1 47 ASP 47 47 47 ASP ASP C . n B 1 48 ALA 48 48 48 ALA ALA C . n B 1 49 GLN 49 49 ? ? ? C . n B 1 50 LYS 50 50 ? ? ? C . n B 1 51 ASP 51 51 ? ? ? C . n B 1 52 VAL 52 52 52 VAL VAL C . n B 1 53 ASP 53 53 53 ASP ASP C . n B 1 54 ALA 54 54 54 ALA ALA C . n B 1 55 VAL 55 55 55 VAL VAL C . n B 1 56 ASP 56 56 56 ASP ASP C . n B 1 57 LYS 57 57 57 LYS LYS C . n B 1 58 VAL 58 58 58 VAL VAL C . n B 1 59 MET 59 59 59 MET MET C . n B 1 60 LYS 60 60 60 LYS LYS C . n B 1 61 GLU 61 61 61 GLU GLU C . n B 1 62 LEU 62 62 62 LEU LEU C . n B 1 63 ASP 63 63 63 ASP ASP C . n B 1 64 GLU 64 64 64 GLU GLU C . n B 1 65 ASN 65 65 65 ASN ASN C . n B 1 66 GLY 66 66 66 GLY GLY C . n B 1 67 ASP 67 67 67 ASP ASP C . n B 1 68 GLY 68 68 68 GLY GLY C . n B 1 69 GLU 69 69 69 GLU GLU C . n B 1 70 VAL 70 70 70 VAL VAL C . n B 1 71 ASP 71 71 71 ASP ASP C . n B 1 72 PHE 72 72 72 PHE PHE C . n B 1 73 GLN 73 73 73 GLN GLN C . n B 1 74 GLU 74 74 74 GLU GLU C . n B 1 75 TYR 75 75 75 TYR TYR C . n B 1 76 VAL 76 76 76 VAL VAL C . n B 1 77 VAL 77 77 77 VAL VAL C . n B 1 78 LEU 78 78 78 LEU LEU C . n B 1 79 VAL 79 79 79 VAL VAL C . n B 1 80 ALA 80 80 80 ALA ALA C . n B 1 81 ALA 81 81 81 ALA ALA C . n B 1 82 LEU 82 82 82 LEU LEU C . n B 1 83 THR 83 83 83 THR THR C . n B 1 84 VAL 84 84 84 VAL VAL C . n B 1 85 ALA 85 85 85 ALA ALA C . n B 1 86 CYS 86 86 86 CYS CYS C . n B 1 87 ASN 87 87 87 ASN ASN C . n B 1 88 ASN 88 88 88 ASN ASN C . n B 1 89 PHE 89 89 89 PHE PHE C . n B 1 90 PHE 90 90 90 PHE PHE C . n B 1 91 TRP 91 91 91 TRP TRP C . n B 1 92 GLU 92 92 92 GLU GLU C . n B 1 93 ASN 93 93 93 ASN ASN C . n B 1 94 SER 94 94 94 SER SER C . n C 1 1 MET 1 1 1 MET MET H . n C 1 2 GLY 2 2 2 GLY GLY H . n C 1 3 SER 3 3 3 SER SER H . n C 1 4 GLU 4 4 4 GLU GLU H . n C 1 5 LEU 5 5 5 LEU LEU H . n C 1 6 GLU 6 6 6 GLU GLU H . n C 1 7 THR 7 7 7 THR THR H . n C 1 8 ALA 8 8 8 ALA ALA H . n C 1 9 MET 9 9 9 MET MET H . n C 1 10 GLU 10 10 10 GLU GLU H . n C 1 11 THR 11 11 11 THR THR H . n C 1 12 LEU 12 12 12 LEU LEU H . n C 1 13 ILE 13 13 13 ILE ILE H . n C 1 14 ASN 14 14 14 ASN ASN H . n C 1 15 VAL 15 15 15 VAL VAL H . n C 1 16 PHE 16 16 16 PHE PHE H . n C 1 17 HIS 17 17 17 HIS HIS H . n C 1 18 ALA 18 18 18 ALA ALA H . n C 1 19 HIS 19 19 19 HIS HIS H . n C 1 20 SER 20 20 20 SER SER H . n C 1 21 GLY 21 21 21 GLY GLY H . n C 1 22 LYS 22 22 22 LYS LYS H . n C 1 23 GLU 23 23 23 GLU GLU H . n C 1 24 GLY 24 24 24 GLY GLY H . n C 1 25 ASP 25 25 25 ASP ASP H . n C 1 26 LYS 26 26 26 LYS LYS H . n C 1 27 TYR 27 27 27 TYR TYR H . n C 1 28 LYS 28 28 28 LYS LYS H . n C 1 29 LEU 29 29 29 LEU LEU H . n C 1 30 SER 30 30 30 SER SER H . n C 1 31 LYS 31 31 31 LYS LYS H . n C 1 32 LYS 32 32 32 LYS LYS H . n C 1 33 GLU 33 33 33 GLU GLU H . n C 1 34 LEU 34 34 34 LEU LEU H . n C 1 35 LYS 35 35 35 LYS LYS H . n C 1 36 GLU 36 36 36 GLU GLU H . n C 1 37 LEU 37 37 37 LEU LEU H . n C 1 38 LEU 38 38 38 LEU LEU H . n C 1 39 GLN 39 39 39 GLN GLN H . n C 1 40 THR 40 40 40 THR THR H . n C 1 41 GLU 41 41 41 GLU GLU H . n C 1 42 LEU 42 42 42 LEU LEU H . n C 1 43 SER 43 43 43 SER SER H . n C 1 44 GLY 44 44 44 GLY GLY H . n C 1 45 PHE 45 45 45 PHE PHE H . n C 1 46 LEU 46 46 46 LEU LEU H . n C 1 47 ASP 47 47 ? ? ? H . n C 1 48 ALA 48 48 ? ? ? H . n C 1 49 GLN 49 49 ? ? ? H . n C 1 50 LYS 50 50 ? ? ? H . n C 1 51 ASP 51 51 ? ? ? H . n C 1 52 VAL 52 52 52 VAL VAL H . n C 1 53 ASP 53 53 53 ASP ASP H . n C 1 54 ALA 54 54 54 ALA ALA H . n C 1 55 VAL 55 55 55 VAL VAL H . n C 1 56 ASP 56 56 56 ASP ASP H . n C 1 57 LYS 57 57 57 LYS LYS H . n C 1 58 VAL 58 58 58 VAL VAL H . n C 1 59 MET 59 59 59 MET MET H . n C 1 60 LYS 60 60 60 LYS LYS H . n C 1 61 GLU 61 61 61 GLU GLU H . n C 1 62 LEU 62 62 62 LEU LEU H . n C 1 63 ASP 63 63 63 ASP ASP H . n C 1 64 GLU 64 64 64 GLU GLU H . n C 1 65 ASN 65 65 65 ASN ASN H . n C 1 66 GLY 66 66 66 GLY GLY H . n C 1 67 ASP 67 67 67 ASP ASP H . n C 1 68 GLY 68 68 68 GLY GLY H . n C 1 69 GLU 69 69 69 GLU GLU H . n C 1 70 VAL 70 70 70 VAL VAL H . n C 1 71 ASP 71 71 71 ASP ASP H . n C 1 72 PHE 72 72 72 PHE PHE H . n C 1 73 GLN 73 73 73 GLN GLN H . n C 1 74 GLU 74 74 74 GLU GLU H . n C 1 75 TYR 75 75 75 TYR TYR H . n C 1 76 VAL 76 76 76 VAL VAL H . n C 1 77 VAL 77 77 77 VAL VAL H . n C 1 78 LEU 78 78 78 LEU LEU H . n C 1 79 VAL 79 79 79 VAL VAL H . n C 1 80 ALA 80 80 80 ALA ALA H . n C 1 81 ALA 81 81 81 ALA ALA H . n C 1 82 LEU 82 82 82 LEU LEU H . n C 1 83 THR 83 83 83 THR THR H . n C 1 84 VAL 84 84 84 VAL VAL H . n C 1 85 ALA 85 85 85 ALA ALA H . n C 1 86 CYS 86 86 86 CYS CYS H . n C 1 87 ASN 87 87 87 ASN ASN H . n C 1 88 ASN 88 88 88 ASN ASN H . n C 1 89 PHE 89 89 89 PHE PHE H . n C 1 90 PHE 90 90 90 PHE PHE H . n C 1 91 TRP 91 91 91 TRP TRP H . n C 1 92 GLU 92 92 92 GLU GLU H . n C 1 93 ASN 93 93 93 ASN ASN H . n C 1 94 SER 94 94 94 SER SER H . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 2 TRS 1 101 1 TRS TRS A . E 3 CA 1 102 44 CA CA A . F 3 CA 1 103 50 CA CA A . G 3 CA 1 101 49 CA CA C . H 3 CA 1 102 52 CA CA C . I 3 CA 1 101 47 CA CA H . J 3 CA 1 102 51 CA CA H . K 4 HOH 1 201 2 HOH HOH A . K 4 HOH 2 202 9 HOH HOH A . K 4 HOH 3 203 10 HOH HOH A . K 4 HOH 4 204 15 HOH HOH A . K 4 HOH 5 205 13 HOH HOH A . K 4 HOH 6 206 5 HOH HOH A . L 4 HOH 1 201 39 HOH HOH C . L 4 HOH 2 202 7 HOH HOH C . L 4 HOH 3 203 37 HOH HOH C . L 4 HOH 4 204 4 HOH HOH C . M 4 HOH 1 201 8 HOH HOH H . M 4 HOH 2 202 20 HOH HOH H . M 4 HOH 3 203 30 HOH HOH H . M 4 HOH 4 204 25 HOH HOH H . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 B,G,H,L 1 2 A,D,E,F,K 2 1,3 C,I,J,M # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2680 ? 1 MORE -40 ? 1 'SSA (A^2)' 10080 ? 2 'ABSA (A^2)' 3220 ? 2 MORE -53 ? 2 'SSA (A^2)' 10630 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_655 y+1,x,-z -0.5000000000 0.8660254038 0.0000000000 53.5470000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 3 'crystal symmetry operation' 5_675 x-y+1,-y+2,-z+1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 92.7461245929 0.0000000000 0.0000000000 -1.0000000000 64.4623333333 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A SER 20 ? A SER 20 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 O ? A GLU 23 ? A GLU 23 ? 1_555 121.4 ? 2 O ? A SER 20 ? A SER 20 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 O ? A ASP 25 ? A ASP 25 ? 1_555 81.8 ? 3 O ? A GLU 23 ? A GLU 23 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 O ? A ASP 25 ? A ASP 25 ? 1_555 105.5 ? 4 O ? A SER 20 ? A SER 20 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 O ? A LYS 28 ? A LYS 28 ? 1_555 93.3 ? 5 O ? A GLU 23 ? A GLU 23 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 O ? A LYS 28 ? A LYS 28 ? 1_555 144.6 ? 6 O ? A ASP 25 ? A ASP 25 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 O ? A LYS 28 ? A LYS 28 ? 1_555 70.2 ? 7 O ? A SER 20 ? A SER 20 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 OE1 ? A GLU 33 ? A GLU 33 ? 1_555 77.8 ? 8 O ? A GLU 23 ? A GLU 23 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 OE1 ? A GLU 33 ? A GLU 33 ? 1_555 74.1 ? 9 O ? A ASP 25 ? A ASP 25 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 OE1 ? A GLU 33 ? A GLU 33 ? 1_555 155.2 ? 10 O ? A LYS 28 ? A LYS 28 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 OE1 ? A GLU 33 ? A GLU 33 ? 1_555 124.6 ? 11 O ? A SER 20 ? A SER 20 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 OE2 ? A GLU 33 ? A GLU 33 ? 1_555 93.9 ? 12 O ? A GLU 23 ? A GLU 23 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 OE2 ? A GLU 33 ? A GLU 33 ? 1_555 107.1 ? 13 O ? A ASP 25 ? A ASP 25 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 OE2 ? A GLU 33 ? A GLU 33 ? 1_555 143.9 ? 14 O ? A LYS 28 ? A LYS 28 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 OE2 ? A GLU 33 ? A GLU 33 ? 1_555 74.4 ? 15 OE1 ? A GLU 33 ? A GLU 33 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 OE2 ? A GLU 33 ? A GLU 33 ? 1_555 52.4 ? 16 O ? A SER 20 ? A SER 20 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 O ? K HOH . ? A HOH 202 ? 1_555 155.0 ? 17 O ? A GLU 23 ? A GLU 23 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 O ? K HOH . ? A HOH 202 ? 1_555 74.9 ? 18 O ? A ASP 25 ? A ASP 25 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 O ? K HOH . ? A HOH 202 ? 1_555 75.1 ? 19 O ? A LYS 28 ? A LYS 28 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 O ? K HOH . ? A HOH 202 ? 1_555 70.1 ? 20 OE1 ? A GLU 33 ? A GLU 33 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 O ? K HOH . ? A HOH 202 ? 1_555 126.9 ? 21 OE2 ? A GLU 33 ? A GLU 33 ? 1_555 CA ? F CA . ? A CA 103 ? 1_555 O ? K HOH . ? A HOH 202 ? 1_555 99.1 ? 22 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OD1 ? A ASN 65 ? A ASN 65 ? 1_555 67.5 ? 23 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OD1 ? A ASP 67 ? A ASP 67 ? 1_555 107.4 ? 24 OD1 ? A ASN 65 ? A ASN 65 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OD1 ? A ASP 67 ? A ASP 67 ? 1_555 70.3 ? 25 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OD2 ? A ASP 67 ? A ASP 67 ? 1_555 70.4 ? 26 OD1 ? A ASN 65 ? A ASN 65 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OD2 ? A ASP 67 ? A ASP 67 ? 1_555 76.7 ? 27 OD1 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OD2 ? A ASP 67 ? A ASP 67 ? 1_555 43.9 ? 28 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 O ? A GLU 69 ? A GLU 69 ? 1_555 92.8 ? 29 OD1 ? A ASN 65 ? A ASN 65 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 O ? A GLU 69 ? A GLU 69 ? 1_555 148.8 ? 30 OD1 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 O ? A GLU 69 ? A GLU 69 ? 1_555 94.7 ? 31 OD2 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 O ? A GLU 69 ? A GLU 69 ? 1_555 73.9 ? 32 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE1 ? A GLU 74 ? A GLU 74 ? 1_555 103.0 ? 33 OD1 ? A ASN 65 ? A ASN 65 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE1 ? A GLU 74 ? A GLU 74 ? 1_555 114.2 ? 34 OD1 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE1 ? A GLU 74 ? A GLU 74 ? 1_555 148.2 ? 35 OD2 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE1 ? A GLU 74 ? A GLU 74 ? 1_555 164.7 ? 36 O ? A GLU 69 ? A GLU 69 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE1 ? A GLU 74 ? A GLU 74 ? 1_555 93.2 ? 37 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE2 ? A GLU 74 ? A GLU 74 ? 1_555 90.0 ? 38 OD1 ? A ASN 65 ? A ASN 65 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE2 ? A GLU 74 ? A GLU 74 ? 1_555 67.9 ? 39 OD1 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE2 ? A GLU 74 ? A GLU 74 ? 1_555 123.3 ? 40 OD2 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE2 ? A GLU 74 ? A GLU 74 ? 1_555 144.0 ? 41 O ? A GLU 69 ? A GLU 69 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE2 ? A GLU 74 ? A GLU 74 ? 1_555 138.9 ? 42 OE1 ? A GLU 74 ? A GLU 74 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE2 ? A GLU 74 ? A GLU 74 ? 1_555 46.5 ? 43 O ? B SER 20 ? C SER 20 ? 1_555 CA ? H CA . ? C CA 102 ? 1_555 O ? B GLU 23 ? C GLU 23 ? 1_555 123.3 ? 44 O ? B SER 20 ? C SER 20 ? 1_555 CA ? H CA . ? C CA 102 ? 1_555 O ? B ASP 25 ? C ASP 25 ? 1_555 89.8 ? 45 O ? B GLU 23 ? C GLU 23 ? 1_555 CA ? H CA . ? C CA 102 ? 1_555 O ? B ASP 25 ? C ASP 25 ? 1_555 95.2 ? 46 O ? B SER 20 ? C SER 20 ? 1_555 CA ? H CA . ? C CA 102 ? 1_555 O ? B LYS 28 ? C LYS 28 ? 1_555 93.1 ? 47 O ? B GLU 23 ? C GLU 23 ? 1_555 CA ? H CA . ? C CA 102 ? 1_555 O ? B LYS 28 ? C LYS 28 ? 1_555 143.2 ? 48 O ? B ASP 25 ? C ASP 25 ? 1_555 CA ? H CA . ? C CA 102 ? 1_555 O ? B LYS 28 ? C LYS 28 ? 1_555 77.9 ? 49 O ? B SER 20 ? C SER 20 ? 1_555 CA ? H CA . ? C CA 102 ? 1_555 OE1 ? B GLU 33 ? C GLU 33 ? 1_555 91.0 ? 50 O ? B GLU 23 ? C GLU 23 ? 1_555 CA ? H CA . ? C CA 102 ? 1_555 OE1 ? B GLU 33 ? C GLU 33 ? 1_555 107.6 ? 51 O ? B ASP 25 ? C ASP 25 ? 1_555 CA ? H CA . ? C CA 102 ? 1_555 OE1 ? B GLU 33 ? C GLU 33 ? 1_555 151.9 ? 52 O ? B LYS 28 ? C LYS 28 ? 1_555 CA ? H CA . ? C CA 102 ? 1_555 OE1 ? B GLU 33 ? C GLU 33 ? 1_555 74.0 ? 53 O ? B SER 20 ? C SER 20 ? 1_555 CA ? H CA . ? C CA 102 ? 1_555 OE2 ? B GLU 33 ? C GLU 33 ? 1_555 69.2 ? 54 O ? B GLU 23 ? C GLU 23 ? 1_555 CA ? H CA . ? C CA 102 ? 1_555 OE2 ? B GLU 33 ? C GLU 33 ? 1_555 84.2 ? 55 O ? B ASP 25 ? C ASP 25 ? 1_555 CA ? H CA . ? C CA 102 ? 1_555 OE2 ? B GLU 33 ? C GLU 33 ? 1_555 153.7 ? 56 O ? B LYS 28 ? C LYS 28 ? 1_555 CA ? H CA . ? C CA 102 ? 1_555 OE2 ? B GLU 33 ? C GLU 33 ? 1_555 117.5 ? 57 OE1 ? B GLU 33 ? C GLU 33 ? 1_555 CA ? H CA . ? C CA 102 ? 1_555 OE2 ? B GLU 33 ? C GLU 33 ? 1_555 48.5 ? 58 OD2 ? B ASP 63 ? C ASP 63 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 OD1 ? B ASN 65 ? C ASN 65 ? 1_555 70.2 ? 59 OD2 ? B ASP 63 ? C ASP 63 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 OD1 ? B ASP 67 ? C ASP 67 ? 1_555 68.6 ? 60 OD1 ? B ASN 65 ? C ASN 65 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 OD1 ? B ASP 67 ? C ASP 67 ? 1_555 71.7 ? 61 OD2 ? B ASP 63 ? C ASP 63 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 O ? B GLU 69 ? C GLU 69 ? 1_555 91.0 ? 62 OD1 ? B ASN 65 ? C ASN 65 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 O ? B GLU 69 ? C GLU 69 ? 1_555 143.4 ? 63 OD1 ? B ASP 67 ? C ASP 67 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 O ? B GLU 69 ? C GLU 69 ? 1_555 72.2 ? 64 OD2 ? B ASP 63 ? C ASP 63 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 OE1 ? B GLU 74 ? C GLU 74 ? 1_555 96.3 ? 65 OD1 ? B ASN 65 ? C ASN 65 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 OE1 ? B GLU 74 ? C GLU 74 ? 1_555 76.6 ? 66 OD1 ? B ASP 67 ? C ASP 67 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 OE1 ? B GLU 74 ? C GLU 74 ? 1_555 147.9 ? 67 O ? B GLU 69 ? C GLU 69 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 OE1 ? B GLU 74 ? C GLU 74 ? 1_555 138.3 ? 68 OD2 ? B ASP 63 ? C ASP 63 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 OE2 ? B GLU 74 ? C GLU 74 ? 1_555 119.2 ? 69 OD1 ? B ASN 65 ? C ASN 65 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 OE2 ? B GLU 74 ? C GLU 74 ? 1_555 122.2 ? 70 OD1 ? B ASP 67 ? C ASP 67 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 OE2 ? B GLU 74 ? C GLU 74 ? 1_555 165.2 ? 71 O ? B GLU 69 ? C GLU 69 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 OE2 ? B GLU 74 ? C GLU 74 ? 1_555 94.4 ? 72 OE1 ? B GLU 74 ? C GLU 74 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 OE2 ? B GLU 74 ? C GLU 74 ? 1_555 46.8 ? 73 OD2 ? B ASP 63 ? C ASP 63 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 O ? L HOH . ? C HOH 201 ? 1_555 136.4 ? 74 OD1 ? B ASN 65 ? C ASN 65 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 O ? L HOH . ? C HOH 201 ? 1_555 86.1 ? 75 OD1 ? B ASP 67 ? C ASP 67 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 O ? L HOH . ? C HOH 201 ? 1_555 69.4 ? 76 O ? B GLU 69 ? C GLU 69 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 O ? L HOH . ? C HOH 201 ? 1_555 87.0 ? 77 OE1 ? B GLU 74 ? C GLU 74 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 O ? L HOH . ? C HOH 201 ? 1_555 113.6 ? 78 OE2 ? B GLU 74 ? C GLU 74 ? 1_555 CA ? G CA . ? C CA 101 ? 1_555 O ? L HOH . ? C HOH 201 ? 1_555 104.4 ? 79 O ? C SER 20 ? H SER 20 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 O ? C GLU 23 ? H GLU 23 ? 1_555 138.4 ? 80 O ? C SER 20 ? H SER 20 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 O ? C ASP 25 ? H ASP 25 ? 1_555 79.6 ? 81 O ? C GLU 23 ? H GLU 23 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 O ? C ASP 25 ? H ASP 25 ? 1_555 87.8 ? 82 O ? C SER 20 ? H SER 20 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 O ? C LYS 28 ? H LYS 28 ? 1_555 79.7 ? 83 O ? C GLU 23 ? H GLU 23 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 O ? C LYS 28 ? H LYS 28 ? 1_555 130.2 ? 84 O ? C ASP 25 ? H ASP 25 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 O ? C LYS 28 ? H LYS 28 ? 1_555 65.8 ? 85 O ? C SER 20 ? H SER 20 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 OE1 ? C GLU 33 ? H GLU 33 ? 1_555 94.0 ? 86 O ? C GLU 23 ? H GLU 23 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 OE1 ? C GLU 33 ? H GLU 33 ? 1_555 121.8 ? 87 O ? C ASP 25 ? H ASP 25 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 OE1 ? C GLU 33 ? H GLU 33 ? 1_555 134.2 ? 88 O ? C LYS 28 ? H LYS 28 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 OE1 ? C GLU 33 ? H GLU 33 ? 1_555 68.4 ? 89 O ? C SER 20 ? H SER 20 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 OE2 ? C GLU 33 ? H GLU 33 ? 1_555 82.3 ? 90 O ? C GLU 23 ? H GLU 23 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 OE2 ? C GLU 33 ? H GLU 33 ? 1_555 101.0 ? 91 O ? C ASP 25 ? H ASP 25 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 OE2 ? C GLU 33 ? H GLU 33 ? 1_555 160.4 ? 92 O ? C LYS 28 ? H LYS 28 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 OE2 ? C GLU 33 ? H GLU 33 ? 1_555 118.0 ? 93 OE1 ? C GLU 33 ? H GLU 33 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 OE2 ? C GLU 33 ? H GLU 33 ? 1_555 54.3 ? 94 O ? C SER 20 ? H SER 20 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 O ? M HOH . ? H HOH 201 ? 1_555 131.7 ? 95 O ? C GLU 23 ? H GLU 23 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 O ? M HOH . ? H HOH 201 ? 1_555 74.5 ? 96 O ? C ASP 25 ? H ASP 25 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 O ? M HOH . ? H HOH 201 ? 1_555 65.4 ? 97 O ? C LYS 28 ? H LYS 28 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 O ? M HOH . ? H HOH 201 ? 1_555 56.4 ? 98 OE1 ? C GLU 33 ? H GLU 33 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 O ? M HOH . ? H HOH 201 ? 1_555 88.2 ? 99 OE2 ? C GLU 33 ? H GLU 33 ? 1_555 CA ? J CA . ? H CA 102 ? 1_555 O ? M HOH . ? H HOH 201 ? 1_555 133.7 ? 100 OD2 ? C ASP 63 ? H ASP 63 ? 1_555 CA ? I CA . ? H CA 101 ? 1_555 OD1 ? C ASN 65 ? H ASN 65 ? 1_555 67.6 ? 101 OD2 ? C ASP 63 ? H ASP 63 ? 1_555 CA ? I CA . ? H CA 101 ? 1_555 OD2 ? C ASP 67 ? H ASP 67 ? 1_555 89.5 ? 102 OD1 ? C ASN 65 ? H ASN 65 ? 1_555 CA ? I CA . ? H CA 101 ? 1_555 OD2 ? C ASP 67 ? H ASP 67 ? 1_555 71.3 ? 103 OD2 ? C ASP 63 ? H ASP 63 ? 1_555 CA ? I CA . ? H CA 101 ? 1_555 O ? C GLU 69 ? H GLU 69 ? 1_555 89.4 ? 104 OD1 ? C ASN 65 ? H ASN 65 ? 1_555 CA ? I CA . ? H CA 101 ? 1_555 O ? C GLU 69 ? H GLU 69 ? 1_555 147.7 ? 105 OD2 ? C ASP 67 ? H ASP 67 ? 1_555 CA ? I CA . ? H CA 101 ? 1_555 O ? C GLU 69 ? H GLU 69 ? 1_555 86.9 ? 106 OD2 ? C ASP 63 ? H ASP 63 ? 1_555 CA ? I CA . ? H CA 101 ? 1_555 OE1 ? C GLU 74 ? H GLU 74 ? 1_555 73.1 ? 107 OD1 ? C ASN 65 ? H ASN 65 ? 1_555 CA ? I CA . ? H CA 101 ? 1_555 OE1 ? C GLU 74 ? H GLU 74 ? 1_555 70.7 ? 108 OD2 ? C ASP 67 ? H ASP 67 ? 1_555 CA ? I CA . ? H CA 101 ? 1_555 OE1 ? C GLU 74 ? H GLU 74 ? 1_555 141.8 ? 109 O ? C GLU 69 ? H GLU 69 ? 1_555 CA ? I CA . ? H CA 101 ? 1_555 OE1 ? C GLU 74 ? H GLU 74 ? 1_555 125.5 ? 110 OD2 ? C ASP 63 ? H ASP 63 ? 1_555 CA ? I CA . ? H CA 101 ? 1_555 OE2 ? C GLU 74 ? H GLU 74 ? 1_555 82.6 ? 111 OD1 ? C ASN 65 ? H ASN 65 ? 1_555 CA ? I CA . ? H CA 101 ? 1_555 OE2 ? C GLU 74 ? H GLU 74 ? 1_555 112.8 ? 112 OD2 ? C ASP 67 ? H ASP 67 ? 1_555 CA ? I CA . ? H CA 101 ? 1_555 OE2 ? C GLU 74 ? H GLU 74 ? 1_555 168.6 ? 113 O ? C GLU 69 ? H GLU 69 ? 1_555 CA ? I CA . ? H CA 101 ? 1_555 OE2 ? C GLU 74 ? H GLU 74 ? 1_555 84.8 ? 114 OE1 ? C GLU 74 ? H GLU 74 ? 1_555 CA ? I CA . ? H CA 101 ? 1_555 OE2 ? C GLU 74 ? H GLU 74 ? 1_555 42.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-04-12 2 'Structure model' 1 1 2017-09-13 3 'Structure model' 1 2 2018-05-16 4 'Structure model' 1 3 2019-12-04 5 'Structure model' 1 4 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Author supporting evidence' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Derived calculations' 9 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 2 'Structure model' pdbx_struct_assembly 3 2 'Structure model' pdbx_struct_assembly_prop 4 2 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' citation 6 4 'Structure model' pdbx_audit_support 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' database_2 10 5 'Structure model' pdbx_initial_refinement_model 11 5 'Structure model' struct_conn 12 5 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 2 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 3 2 'Structure model' '_pdbx_struct_assembly_prop.type' 4 2 'Structure model' '_pdbx_struct_assembly_prop.value' 5 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 6 3 'Structure model' '_citation.journal_abbrev' 7 3 'Structure model' '_citation.pdbx_database_id_PubMed' 8 3 'Structure model' '_citation.title' 9 4 'Structure model' '_pdbx_audit_support.funding_organization' 10 5 'Structure model' '_database_2.pdbx_DOI' 11 5 'Structure model' '_database_2.pdbx_database_accession' 12 5 'Structure model' '_struct_conn.pdbx_dist_value' 13 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 14 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 15 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 16 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 17 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 18 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 19 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 20 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 21 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 22 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 25 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 26 5 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 27 5 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 28 5 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 29 5 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 30 5 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 31 5 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 32 5 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 33 5 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 39.9559 24.6246 0.5199 0.9832 0.4980 0.4978 -0.1211 -0.0030 -0.0369 7.7309 2.0553 8.5629 5.1704 1.1995 0.0736 -0.1968 -0.3714 -0.0278 0.4611 0.4704 1.2618 -1.0934 -0.2336 -0.3073 'X-RAY DIFFRACTION' 2 ? refined 57.7507 33.2697 3.4781 0.9687 0.7685 0.3718 -0.0569 0.0041 -0.0148 9.2069 7.2908 6.3809 2.8438 3.9590 1.6367 -0.3713 0.2056 0.0958 0.9400 -0.0649 -0.5065 -0.5947 -0.2885 1.4560 'X-RAY DIFFRACTION' 3 ? refined 57.7733 37.3031 12.6531 1.5244 -0.3826 0.5133 -0.5024 -0.2743 -0.0797 2.0191 9.4311 8.9235 2.2819 0.9594 1.1070 -0.1062 0.1183 0.3043 -0.4987 1.0464 -0.0505 0.8527 -0.6916 1.0850 'X-RAY DIFFRACTION' 4 ? refined 51.9204 36.1121 18.7182 1.2447 0.7816 0.4676 -0.1601 -0.0299 -0.0776 9.3092 2.0154 2.0043 -0.5505 2.1825 -1.2278 -0.3729 -0.4386 0.5536 -1.2648 0.9909 -0.1621 1.3399 -0.3372 0.5682 'X-RAY DIFFRACTION' 5 ? refined 63.4987 29.2681 18.0276 1.3409 1.0957 0.6455 -0.0829 -0.2763 0.0635 8.1963 2.0033 2.0063 0.2304 3.9540 7.4837 0.4413 -0.1943 -0.2860 -0.8243 0.0964 -0.9595 1.9848 0.4599 1.0483 'X-RAY DIFFRACTION' 6 ? refined 59.9619 24.3605 9.1742 1.0375 0.6867 0.4585 0.0304 -0.1002 -0.0926 2.0303 6.0138 3.9245 3.1618 4.2576 2.1491 0.3474 0.2272 -0.6064 0.5563 -0.9297 -0.7318 0.4637 0.8093 1.3439 'X-RAY DIFFRACTION' 7 ? refined 43.2807 22.7023 20.2325 1.6736 0.7126 0.5718 -0.1882 0.0453 0.1302 5.7917 8.6093 6.6368 3.3369 5.3198 2.3226 0.8294 -0.8612 -0.2689 -2.2679 -0.0204 1.0205 1.9470 1.0209 -0.5096 'X-RAY DIFFRACTION' 8 ? refined 55.9896 48.5737 -11.4324 0.8104 0.9831 0.4429 -0.0335 0.0275 0.0202 5.0767 2.0503 6.0148 5.9422 -0.5493 -2.7386 -0.1952 0.2129 0.3183 0.1329 -0.2613 -0.7967 -0.8345 0.2410 -0.0537 'X-RAY DIFFRACTION' 9 ? refined 47.7166 34.0852 -14.5509 1.5443 1.1011 0.3979 -0.1913 -0.0204 -0.0803 4.1919 2.0115 6.7299 3.3148 3.3946 1.4814 -0.3448 0.3173 -0.1240 0.6064 -0.1326 -0.3210 -2.1259 1.5623 -0.5974 'X-RAY DIFFRACTION' 10 ? refined 45.2181 35.8107 -4.2429 0.9909 0.8781 0.3859 -0.2643 -0.0454 -0.0041 3.9851 9.9527 6.5279 2.3350 1.9266 -1.7455 0.2185 0.1853 -0.1382 0.3218 -0.0362 0.2733 0.1259 1.1206 -0.6705 'X-RAY DIFFRACTION' 11 ? refined 36.2216 39.6724 -1.1081 0.9141 1.3244 1.0361 -0.2748 0.0879 -0.0652 1.6422 2.0237 6.6958 2.0178 1.2236 -2.2059 0.2057 0.3974 -0.4465 -0.6482 -0.0462 1.4094 1.2273 0.7274 -1.1763 'X-RAY DIFFRACTION' 12 ? refined 38.4179 41.4005 -15.0701 1.2634 1.6365 0.5190 -0.7687 -0.3916 0.0457 6.4751 2.0065 5.9049 3.5084 2.0834 -1.2181 -0.2674 0.8372 -0.3083 0.7235 0.3362 1.7375 -1.9216 0.7282 -1.1940 'X-RAY DIFFRACTION' 13 ? refined 44.5227 51.8927 -3.3429 0.9129 1.0710 0.3734 -0.2373 0.0443 0.0751 3.4039 2.0845 6.1554 2.6298 0.7525 -1.6568 0.1964 0.1077 -0.1897 -0.1544 0.2100 0.6739 0.8320 0.0484 -0.3720 'X-RAY DIFFRACTION' 14 ? refined 49.4584 62.9179 7.3802 1.8660 1.5707 0.5567 -0.2111 0.0900 0.1920 6.8793 1.9992 2.0054 -1.1037 -0.6765 -3.3234 0.3395 -0.3934 0.0074 -0.5854 0.5883 1.1350 3.1276 -2.0074 -0.5250 'X-RAY DIFFRACTION' 15 ? refined 54.2280 45.8917 39.1864 1.6626 0.9316 0.2195 0.0952 0.0058 -0.1218 6.0098 7.5913 2.0066 1.0267 1.0546 1.0949 -0.2043 0.4899 -0.4497 -0.6753 -0.5495 -1.2305 1.4198 0.8280 0.9394 'X-RAY DIFFRACTION' 16 ? refined 49.5845 57.2507 30.1940 1.3673 0.7971 0.4498 -0.1183 0.0584 -0.0166 3.8311 7.8341 9.8446 0.9492 -1.4936 2.0116 -0.3050 0.4772 -0.2718 0.2210 0.1696 -0.4941 0.0826 -1.5737 -0.0446 'X-RAY DIFFRACTION' 17 ? refined 43.2818 65.3019 24.6270 2.0064 0.9965 0.6141 0.1701 -0.0554 0.0705 3.7694 9.6573 2.0100 1.0440 -0.5455 3.9848 -0.3999 0.2915 -0.1511 0.5843 0.9320 0.2693 -0.9428 -3.3608 -0.7650 'X-RAY DIFFRACTION' 18 ? refined 48.2338 54.2553 18.3020 1.5286 1.0416 0.4117 -0.1706 0.0001 0.0630 4.9718 7.0860 2.0143 -0.1170 -0.6312 2.9357 -0.3704 0.5631 -0.3290 0.8502 0.0425 -0.5395 -0.9650 -1.2884 -0.1755 'X-RAY DIFFRACTION' 19 ? refined 35.6815 54.8298 16.8444 1.6491 1.4825 0.8305 0.1059 -0.2705 0.1152 4.8372 5.2544 2.0004 -0.5680 -3.0386 3.9768 -0.5460 0.1847 0.1044 1.0467 -0.1172 0.8258 -1.3769 -1.4741 -2.3056 'X-RAY DIFFRACTION' 20 ? refined 40.2429 48.8816 26.3897 1.1853 1.1209 0.3578 -0.0084 -0.0570 0.0662 3.0587 6.2654 8.9662 0.1453 -0.4300 2.6716 -0.2686 0.2031 0.0263 0.3721 -0.0371 0.8745 -0.0521 -0.4150 -1.8151 'X-RAY DIFFRACTION' 21 ? refined 49.4320 29.1702 23.6385 2.0888 -0.1549 -1.0467 -0.7503 -0.6189 -1.2753 8.5449 6.4528 1.9995 6.7115 1.6057 6.3039 -0.5706 0.4526 -0.2350 0.4802 -1.6468 -0.8113 0.6349 3.1459 0.1343 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 1 A 10 '(chain A and resid 1:10)' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 11 A 31 '(chain A and resid 11:31)' ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 32 A 39 '(chain A and resid 32:39)' ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 40 A 47 '(chain A and resid 40:47)' ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 53 A 63 '(chain A and resid 53:63)' ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 64 A 81 '(chain A and resid 64:81)' ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 A 82 A 90 '(chain A and resid 82:90)' ? ? ? ? ? 'X-RAY DIFFRACTION' 8 8 C 3 C 16 '(chain C and resid 3:16)' ? ? ? ? ? 'X-RAY DIFFRACTION' 9 9 C 17 C 28 '(chain C and resid 17:28)' ? ? ? ? ? 'X-RAY DIFFRACTION' 10 10 C 29 C 42 '(chain C and resid 29:42)' ? ? ? ? ? 'X-RAY DIFFRACTION' 11 11 C 43 C 63 '(chain C and resid 43:63)' ? ? ? ? ? 'X-RAY DIFFRACTION' 12 12 C 64 C 73 '(chain C and resid 64:73)' ? ? ? ? ? 'X-RAY DIFFRACTION' 13 13 C 74 C 89 '(chain C and resid 74:89)' ? ? ? ? ? 'X-RAY DIFFRACTION' 14 14 C 90 C 94 '(chain C and resid 90:94)' ? ? ? ? ? 'X-RAY DIFFRACTION' 15 15 H 1 H 9 '(chain H and resid 1:9)' ? ? ? ? ? 'X-RAY DIFFRACTION' 16 16 H 10 H 21 '(chain H and resid 10:21)' ? ? ? ? ? 'X-RAY DIFFRACTION' 17 17 H 22 H 32 '(chain H and resid 22:32)' ? ? ? ? ? 'X-RAY DIFFRACTION' 18 18 H 33 H 45 '(chain H and resid 33:45)' ? ? ? ? ? 'X-RAY DIFFRACTION' 19 19 H 46 H 65 '(chain H and resid 46:65)' ? ? ? ? ? 'X-RAY DIFFRACTION' 20 20 H 66 H 89 '(chain H and resid 66:89)' ? ? ? ? ? 'X-RAY DIFFRACTION' 21 21 H 90 H 94 '(chain H and resid 90:94)' ? ? ? ? ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1_2155 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? Blu-Ice ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoXDS ? ? ? . 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.20 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 ? phasing ? ? ? ? ? ? ? ? ? ? ? BALBES ? ? ? . 7 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP C 47 ? ? -150.65 -144.95 2 1 ASP C 63 ? ? -69.67 82.04 3 1 ASN C 93 ? ? -66.49 79.08 4 1 SER H 43 ? ? -39.65 115.32 5 1 ASP H 53 ? ? -65.08 89.00 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 48 ? A ALA 48 2 1 Y 1 A GLN 49 ? A GLN 49 3 1 Y 1 A LYS 50 ? A LYS 50 4 1 Y 1 A ASP 51 ? A ASP 51 5 1 Y 1 A VAL 52 ? A VAL 52 6 1 Y 1 A TRP 91 ? A TRP 91 7 1 Y 1 A GLU 92 ? A GLU 92 8 1 Y 1 A ASN 93 ? A ASN 93 9 1 Y 1 A SER 94 ? A SER 94 10 1 Y 1 C MET 1 ? B MET 1 11 1 Y 1 C GLY 2 ? B GLY 2 12 1 Y 1 C GLN 49 ? B GLN 49 13 1 Y 1 C LYS 50 ? B LYS 50 14 1 Y 1 C ASP 51 ? B ASP 51 15 1 Y 1 H ASP 47 ? C ASP 47 16 1 Y 1 H ALA 48 ? C ALA 48 17 1 Y 1 H GLN 49 ? C GLN 49 18 1 Y 1 H LYS 50 ? C LYS 50 19 1 Y 1 H ASP 51 ? C ASP 51 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CA CA CA N N 47 CYS N N N N 48 CYS CA C N R 49 CYS C C N N 50 CYS O O N N 51 CYS CB C N N 52 CYS SG S N N 53 CYS OXT O N N 54 CYS H H N N 55 CYS H2 H N N 56 CYS HA H N N 57 CYS HB2 H N N 58 CYS HB3 H N N 59 CYS HG H N N 60 CYS HXT H N N 61 GLN N N N N 62 GLN CA C N S 63 GLN C C N N 64 GLN O O N N 65 GLN CB C N N 66 GLN CG C N N 67 GLN CD C N N 68 GLN OE1 O N N 69 GLN NE2 N N N 70 GLN OXT O N N 71 GLN H H N N 72 GLN H2 H N N 73 GLN HA H N N 74 GLN HB2 H N N 75 GLN HB3 H N N 76 GLN HG2 H N N 77 GLN HG3 H N N 78 GLN HE21 H N N 79 GLN HE22 H N N 80 GLN HXT H N N 81 GLU N N N N 82 GLU CA C N S 83 GLU C C N N 84 GLU O O N N 85 GLU CB C N N 86 GLU CG C N N 87 GLU CD C N N 88 GLU OE1 O N N 89 GLU OE2 O N N 90 GLU OXT O N N 91 GLU H H N N 92 GLU H2 H N N 93 GLU HA H N N 94 GLU HB2 H N N 95 GLU HB3 H N N 96 GLU HG2 H N N 97 GLU HG3 H N N 98 GLU HE2 H N N 99 GLU HXT H N N 100 GLY N N N N 101 GLY CA C N N 102 GLY C C N N 103 GLY O O N N 104 GLY OXT O N N 105 GLY H H N N 106 GLY H2 H N N 107 GLY HA2 H N N 108 GLY HA3 H N N 109 GLY HXT H N N 110 HIS N N N N 111 HIS CA C N S 112 HIS C C N N 113 HIS O O N N 114 HIS CB C N N 115 HIS CG C Y N 116 HIS ND1 N Y N 117 HIS CD2 C Y N 118 HIS CE1 C Y N 119 HIS NE2 N Y N 120 HIS OXT O N N 121 HIS H H N N 122 HIS H2 H N N 123 HIS HA H N N 124 HIS HB2 H N N 125 HIS HB3 H N N 126 HIS HD1 H N N 127 HIS HD2 H N N 128 HIS HE1 H N N 129 HIS HE2 H N N 130 HIS HXT H N N 131 HOH O O N N 132 HOH H1 H N N 133 HOH H2 H N N 134 ILE N N N N 135 ILE CA C N S 136 ILE C C N N 137 ILE O O N N 138 ILE CB C N S 139 ILE CG1 C N N 140 ILE CG2 C N N 141 ILE CD1 C N N 142 ILE OXT O N N 143 ILE H H N N 144 ILE H2 H N N 145 ILE HA H N N 146 ILE HB H N N 147 ILE HG12 H N N 148 ILE HG13 H N N 149 ILE HG21 H N N 150 ILE HG22 H N N 151 ILE HG23 H N N 152 ILE HD11 H N N 153 ILE HD12 H N N 154 ILE HD13 H N N 155 ILE HXT H N N 156 LEU N N N N 157 LEU CA C N S 158 LEU C C N N 159 LEU O O N N 160 LEU CB C N N 161 LEU CG C N N 162 LEU CD1 C N N 163 LEU CD2 C N N 164 LEU OXT O N N 165 LEU H H N N 166 LEU H2 H N N 167 LEU HA H N N 168 LEU HB2 H N N 169 LEU HB3 H N N 170 LEU HG H N N 171 LEU HD11 H N N 172 LEU HD12 H N N 173 LEU HD13 H N N 174 LEU HD21 H N N 175 LEU HD22 H N N 176 LEU HD23 H N N 177 LEU HXT H N N 178 LYS N N N N 179 LYS CA C N S 180 LYS C C N N 181 LYS O O N N 182 LYS CB C N N 183 LYS CG C N N 184 LYS CD C N N 185 LYS CE C N N 186 LYS NZ N N N 187 LYS OXT O N N 188 LYS H H N N 189 LYS H2 H N N 190 LYS HA H N N 191 LYS HB2 H N N 192 LYS HB3 H N N 193 LYS HG2 H N N 194 LYS HG3 H N N 195 LYS HD2 H N N 196 LYS HD3 H N N 197 LYS HE2 H N N 198 LYS HE3 H N N 199 LYS HZ1 H N N 200 LYS HZ2 H N N 201 LYS HZ3 H N N 202 LYS HXT H N N 203 MET N N N N 204 MET CA C N S 205 MET C C N N 206 MET O O N N 207 MET CB C N N 208 MET CG C N N 209 MET SD S N N 210 MET CE C N N 211 MET OXT O N N 212 MET H H N N 213 MET H2 H N N 214 MET HA H N N 215 MET HB2 H N N 216 MET HB3 H N N 217 MET HG2 H N N 218 MET HG3 H N N 219 MET HE1 H N N 220 MET HE2 H N N 221 MET HE3 H N N 222 MET HXT H N N 223 PHE N N N N 224 PHE CA C N S 225 PHE C C N N 226 PHE O O N N 227 PHE CB C N N 228 PHE CG C Y N 229 PHE CD1 C Y N 230 PHE CD2 C Y N 231 PHE CE1 C Y N 232 PHE CE2 C Y N 233 PHE CZ C Y N 234 PHE OXT O N N 235 PHE H H N N 236 PHE H2 H N N 237 PHE HA H N N 238 PHE HB2 H N N 239 PHE HB3 H N N 240 PHE HD1 H N N 241 PHE HD2 H N N 242 PHE HE1 H N N 243 PHE HE2 H N N 244 PHE HZ H N N 245 PHE HXT H N N 246 SER N N N N 247 SER CA C N S 248 SER C C N N 249 SER O O N N 250 SER CB C N N 251 SER OG O N N 252 SER OXT O N N 253 SER H H N N 254 SER H2 H N N 255 SER HA H N N 256 SER HB2 H N N 257 SER HB3 H N N 258 SER HG H N N 259 SER HXT H N N 260 THR N N N N 261 THR CA C N S 262 THR C C N N 263 THR O O N N 264 THR CB C N R 265 THR OG1 O N N 266 THR CG2 C N N 267 THR OXT O N N 268 THR H H N N 269 THR H2 H N N 270 THR HA H N N 271 THR HB H N N 272 THR HG1 H N N 273 THR HG21 H N N 274 THR HG22 H N N 275 THR HG23 H N N 276 THR HXT H N N 277 TRP N N N N 278 TRP CA C N S 279 TRP C C N N 280 TRP O O N N 281 TRP CB C N N 282 TRP CG C Y N 283 TRP CD1 C Y N 284 TRP CD2 C Y N 285 TRP NE1 N Y N 286 TRP CE2 C Y N 287 TRP CE3 C Y N 288 TRP CZ2 C Y N 289 TRP CZ3 C Y N 290 TRP CH2 C Y N 291 TRP OXT O N N 292 TRP H H N N 293 TRP H2 H N N 294 TRP HA H N N 295 TRP HB2 H N N 296 TRP HB3 H N N 297 TRP HD1 H N N 298 TRP HE1 H N N 299 TRP HE3 H N N 300 TRP HZ2 H N N 301 TRP HZ3 H N N 302 TRP HH2 H N N 303 TRP HXT H N N 304 TRS C C N N 305 TRS C1 C N N 306 TRS C2 C N N 307 TRS C3 C N N 308 TRS N N N N 309 TRS O1 O N N 310 TRS O2 O N N 311 TRS O3 O N N 312 TRS H11 H N N 313 TRS H12 H N N 314 TRS H21 H N N 315 TRS H22 H N N 316 TRS H31 H N N 317 TRS H32 H N N 318 TRS HN1 H N N 319 TRS HN2 H N N 320 TRS HN3 H N N 321 TRS HO1 H N N 322 TRS HO2 H N N 323 TRS HO3 H N N 324 TYR N N N N 325 TYR CA C N S 326 TYR C C N N 327 TYR O O N N 328 TYR CB C N N 329 TYR CG C Y N 330 TYR CD1 C Y N 331 TYR CD2 C Y N 332 TYR CE1 C Y N 333 TYR CE2 C Y N 334 TYR CZ C Y N 335 TYR OH O N N 336 TYR OXT O N N 337 TYR H H N N 338 TYR H2 H N N 339 TYR HA H N N 340 TYR HB2 H N N 341 TYR HB3 H N N 342 TYR HD1 H N N 343 TYR HD2 H N N 344 TYR HE1 H N N 345 TYR HE2 H N N 346 TYR HH H N N 347 TYR HXT H N N 348 VAL N N N N 349 VAL CA C N S 350 VAL C C N N 351 VAL O O N N 352 VAL CB C N N 353 VAL CG1 C N N 354 VAL CG2 C N N 355 VAL OXT O N N 356 VAL H H N N 357 VAL H2 H N N 358 VAL HA H N N 359 VAL HB H N N 360 VAL HG11 H N N 361 VAL HG12 H N N 362 VAL HG13 H N N 363 VAL HG21 H N N 364 VAL HG22 H N N 365 VAL HG23 H N N 366 VAL HXT H N N 367 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 HOH O H1 sing N N 124 HOH O H2 sing N N 125 ILE N CA sing N N 126 ILE N H sing N N 127 ILE N H2 sing N N 128 ILE CA C sing N N 129 ILE CA CB sing N N 130 ILE CA HA sing N N 131 ILE C O doub N N 132 ILE C OXT sing N N 133 ILE CB CG1 sing N N 134 ILE CB CG2 sing N N 135 ILE CB HB sing N N 136 ILE CG1 CD1 sing N N 137 ILE CG1 HG12 sing N N 138 ILE CG1 HG13 sing N N 139 ILE CG2 HG21 sing N N 140 ILE CG2 HG22 sing N N 141 ILE CG2 HG23 sing N N 142 ILE CD1 HD11 sing N N 143 ILE CD1 HD12 sing N N 144 ILE CD1 HD13 sing N N 145 ILE OXT HXT sing N N 146 LEU N CA sing N N 147 LEU N H sing N N 148 LEU N H2 sing N N 149 LEU CA C sing N N 150 LEU CA CB sing N N 151 LEU CA HA sing N N 152 LEU C O doub N N 153 LEU C OXT sing N N 154 LEU CB CG sing N N 155 LEU CB HB2 sing N N 156 LEU CB HB3 sing N N 157 LEU CG CD1 sing N N 158 LEU CG CD2 sing N N 159 LEU CG HG sing N N 160 LEU CD1 HD11 sing N N 161 LEU CD1 HD12 sing N N 162 LEU CD1 HD13 sing N N 163 LEU CD2 HD21 sing N N 164 LEU CD2 HD22 sing N N 165 LEU CD2 HD23 sing N N 166 LEU OXT HXT sing N N 167 LYS N CA sing N N 168 LYS N H sing N N 169 LYS N H2 sing N N 170 LYS CA C sing N N 171 LYS CA CB sing N N 172 LYS CA HA sing N N 173 LYS C O doub N N 174 LYS C OXT sing N N 175 LYS CB CG sing N N 176 LYS CB HB2 sing N N 177 LYS CB HB3 sing N N 178 LYS CG CD sing N N 179 LYS CG HG2 sing N N 180 LYS CG HG3 sing N N 181 LYS CD CE sing N N 182 LYS CD HD2 sing N N 183 LYS CD HD3 sing N N 184 LYS CE NZ sing N N 185 LYS CE HE2 sing N N 186 LYS CE HE3 sing N N 187 LYS NZ HZ1 sing N N 188 LYS NZ HZ2 sing N N 189 LYS NZ HZ3 sing N N 190 LYS OXT HXT sing N N 191 MET N CA sing N N 192 MET N H sing N N 193 MET N H2 sing N N 194 MET CA C sing N N 195 MET CA CB sing N N 196 MET CA HA sing N N 197 MET C O doub N N 198 MET C OXT sing N N 199 MET CB CG sing N N 200 MET CB HB2 sing N N 201 MET CB HB3 sing N N 202 MET CG SD sing N N 203 MET CG HG2 sing N N 204 MET CG HG3 sing N N 205 MET SD CE sing N N 206 MET CE HE1 sing N N 207 MET CE HE2 sing N N 208 MET CE HE3 sing N N 209 MET OXT HXT sing N N 210 PHE N CA sing N N 211 PHE N H sing N N 212 PHE N H2 sing N N 213 PHE CA C sing N N 214 PHE CA CB sing N N 215 PHE CA HA sing N N 216 PHE C O doub N N 217 PHE C OXT sing N N 218 PHE CB CG sing N N 219 PHE CB HB2 sing N N 220 PHE CB HB3 sing N N 221 PHE CG CD1 doub Y N 222 PHE CG CD2 sing Y N 223 PHE CD1 CE1 sing Y N 224 PHE CD1 HD1 sing N N 225 PHE CD2 CE2 doub Y N 226 PHE CD2 HD2 sing N N 227 PHE CE1 CZ doub Y N 228 PHE CE1 HE1 sing N N 229 PHE CE2 CZ sing Y N 230 PHE CE2 HE2 sing N N 231 PHE CZ HZ sing N N 232 PHE OXT HXT sing N N 233 SER N CA sing N N 234 SER N H sing N N 235 SER N H2 sing N N 236 SER CA C sing N N 237 SER CA CB sing N N 238 SER CA HA sing N N 239 SER C O doub N N 240 SER C OXT sing N N 241 SER CB OG sing N N 242 SER CB HB2 sing N N 243 SER CB HB3 sing N N 244 SER OG HG sing N N 245 SER OXT HXT sing N N 246 THR N CA sing N N 247 THR N H sing N N 248 THR N H2 sing N N 249 THR CA C sing N N 250 THR CA CB sing N N 251 THR CA HA sing N N 252 THR C O doub N N 253 THR C OXT sing N N 254 THR CB OG1 sing N N 255 THR CB CG2 sing N N 256 THR CB HB sing N N 257 THR OG1 HG1 sing N N 258 THR CG2 HG21 sing N N 259 THR CG2 HG22 sing N N 260 THR CG2 HG23 sing N N 261 THR OXT HXT sing N N 262 TRP N CA sing N N 263 TRP N H sing N N 264 TRP N H2 sing N N 265 TRP CA C sing N N 266 TRP CA CB sing N N 267 TRP CA HA sing N N 268 TRP C O doub N N 269 TRP C OXT sing N N 270 TRP CB CG sing N N 271 TRP CB HB2 sing N N 272 TRP CB HB3 sing N N 273 TRP CG CD1 doub Y N 274 TRP CG CD2 sing Y N 275 TRP CD1 NE1 sing Y N 276 TRP CD1 HD1 sing N N 277 TRP CD2 CE2 doub Y N 278 TRP CD2 CE3 sing Y N 279 TRP NE1 CE2 sing Y N 280 TRP NE1 HE1 sing N N 281 TRP CE2 CZ2 sing Y N 282 TRP CE3 CZ3 doub Y N 283 TRP CE3 HE3 sing N N 284 TRP CZ2 CH2 doub Y N 285 TRP CZ2 HZ2 sing N N 286 TRP CZ3 CH2 sing Y N 287 TRP CZ3 HZ3 sing N N 288 TRP CH2 HH2 sing N N 289 TRP OXT HXT sing N N 290 TRS C C1 sing N N 291 TRS C C2 sing N N 292 TRS C C3 sing N N 293 TRS C N sing N N 294 TRS C1 O1 sing N N 295 TRS C1 H11 sing N N 296 TRS C1 H12 sing N N 297 TRS C2 O2 sing N N 298 TRS C2 H21 sing N N 299 TRS C2 H22 sing N N 300 TRS C3 O3 sing N N 301 TRS C3 H31 sing N N 302 TRS C3 H32 sing N N 303 TRS N HN1 sing N N 304 TRS N HN2 sing N N 305 TRS N HN3 sing N N 306 TRS O1 HO1 sing N N 307 TRS O2 HO2 sing N N 308 TRS O3 HO3 sing N N 309 TYR N CA sing N N 310 TYR N H sing N N 311 TYR N H2 sing N N 312 TYR CA C sing N N 313 TYR CA CB sing N N 314 TYR CA HA sing N N 315 TYR C O doub N N 316 TYR C OXT sing N N 317 TYR CB CG sing N N 318 TYR CB HB2 sing N N 319 TYR CB HB3 sing N N 320 TYR CG CD1 doub Y N 321 TYR CG CD2 sing Y N 322 TYR CD1 CE1 sing Y N 323 TYR CD1 HD1 sing N N 324 TYR CD2 CE2 doub Y N 325 TYR CD2 HD2 sing N N 326 TYR CE1 CZ doub Y N 327 TYR CE1 HE1 sing N N 328 TYR CE2 CZ sing Y N 329 TYR CE2 HE2 sing N N 330 TYR CZ OH sing N N 331 TYR OH HH sing N N 332 TYR OXT HXT sing N N 333 VAL N CA sing N N 334 VAL N H sing N N 335 VAL N H2 sing N N 336 VAL CA C sing N N 337 VAL CA CB sing N N 338 VAL CA HA sing N N 339 VAL C O doub N N 340 VAL C OXT sing N N 341 VAL CB CG1 sing N N 342 VAL CB CG2 sing N N 343 VAL CB HB sing N N 344 VAL CG1 HG11 sing N N 345 VAL CG1 HG12 sing N N 346 VAL CG1 HG13 sing N N 347 VAL CG2 HG21 sing N N 348 VAL CG2 HG22 sing N N 349 VAL CG2 HG23 sing N N 350 VAL OXT HXT sing N N 351 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' CA-107331 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM-58888 2 'National Institutes of Health/National Institute of Arthritis and Musculoskeletal and Skin Diseases (NIH/NIAMS)' 'United States' AR007592 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 3 'CALCIUM ION' CA 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2Y5I _pdbx_initial_refinement_model.details ? #