data_5NMA # _entry.id 5NMA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.284 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5NMA WWPDB D_1200004346 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5NMA _pdbx_database_status.recvd_initial_deposition_date 2017-04-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rochel, N.' 1 ? 'Belorusova, A.Y.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country FR _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Eur J Med Chem' _citation.journal_id_ASTM EJMCA5 _citation.journal_id_CSD 0493 _citation.journal_id_ISSN 1768-3254 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 134 _citation.language ? _citation.page_first 86 _citation.page_last 96 _citation.title 'Structure-activity relationship study of vitamin D analogs with oxolane group in their side chain.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.ejmech.2017.03.081 _citation.pdbx_database_id_PubMed 28399453 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Belorusova, A.Y.' 1 primary 'Martinez, A.' 2 primary 'Gandara, Z.' 3 primary 'Gomez, G.' 4 primary 'Fall, Y.' 5 primary 'Rochel, N.' 6 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5NMA _cell.details ? _cell.formula_units_Z ? _cell.length_a 66.175 _cell.length_a_esd ? _cell.length_b 66.175 _cell.length_b_esd ? _cell.length_c 262.859 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5NMA _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Vitamin D3 receptor A' 34060.672 1 ? ? ? ? 2 polymer syn 'Nuclear receptor coactivator 1' 1776.072 1 2.3.1.48 ? 'UNP residues 686-700' ? 3 non-polymer syn ;(1~{R},3~{S},5~{Z})-5-[(2~{E})-2-[(1~{R},3~{a}~{S},7~{a}~{R})-7~{a}-methyl-1-[(1~{S})-1-[(2~{S},5~{S})-5-(2-oxidanylpropan-2-yl)oxolan-2-yl]ethyl]-2,3,3~{a},5,6,7-hexahydro-1~{H}-inden-4-ylidene]ethylidene]-4-methylidene-cyclohexane-1,3-diol ; 444.647 1 ? ? ? ? 4 water nat water 18.015 9 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'VDR-A,1,25-dihydroxyvitamin D3 receptor A,Nuclear receptor subfamily 1 group I member 1-A' 2 ;NCoA-1,Class E basic helix-loop-helix protein 74,bHLHe74,Protein Hin-2,RIP160,Renal carcinoma antigen NY-REN-52,Steroid receptor coactivator 1,SRC-1 ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSHMLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVREGPVTRSASRAASLHSLSDASSDSFNHSPESVDTKLNFSNL LMMYQDSGSPDSSEEDQQSRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLED MSWSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVL QAYIRIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVS ; ;GSHMLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVREGPVTRSASRAASLHSLSDASSDSFNHSPESVDTKLNFSNL LMMYQDSGSPDSSEEDQQSRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLED MSWSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVL QAYIRIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVS ; A ? 2 'polypeptide(L)' no no RHKILHRLLQEGSPS RHKILHRLLQEGSPS B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 LEU n 1 6 SER n 1 7 ASP n 1 8 GLU n 1 9 GLN n 1 10 MET n 1 11 GLN n 1 12 ILE n 1 13 ILE n 1 14 ASN n 1 15 SER n 1 16 LEU n 1 17 VAL n 1 18 GLU n 1 19 ALA n 1 20 HIS n 1 21 HIS n 1 22 LYS n 1 23 THR n 1 24 TYR n 1 25 ASP n 1 26 ASP n 1 27 SER n 1 28 TYR n 1 29 SER n 1 30 ASP n 1 31 PHE n 1 32 VAL n 1 33 ARG n 1 34 PHE n 1 35 ARG n 1 36 PRO n 1 37 PRO n 1 38 VAL n 1 39 ARG n 1 40 GLU n 1 41 GLY n 1 42 PRO n 1 43 VAL n 1 44 THR n 1 45 ARG n 1 46 SER n 1 47 ALA n 1 48 SER n 1 49 ARG n 1 50 ALA n 1 51 ALA n 1 52 SER n 1 53 LEU n 1 54 HIS n 1 55 SER n 1 56 LEU n 1 57 SER n 1 58 ASP n 1 59 ALA n 1 60 SER n 1 61 SER n 1 62 ASP n 1 63 SER n 1 64 PHE n 1 65 ASN n 1 66 HIS n 1 67 SER n 1 68 PRO n 1 69 GLU n 1 70 SER n 1 71 VAL n 1 72 ASP n 1 73 THR n 1 74 LYS n 1 75 LEU n 1 76 ASN n 1 77 PHE n 1 78 SER n 1 79 ASN n 1 80 LEU n 1 81 LEU n 1 82 MET n 1 83 MET n 1 84 TYR n 1 85 GLN n 1 86 ASP n 1 87 SER n 1 88 GLY n 1 89 SER n 1 90 PRO n 1 91 ASP n 1 92 SER n 1 93 SER n 1 94 GLU n 1 95 GLU n 1 96 ASP n 1 97 GLN n 1 98 GLN n 1 99 SER n 1 100 ARG n 1 101 LEU n 1 102 SER n 1 103 MET n 1 104 LEU n 1 105 PRO n 1 106 HIS n 1 107 LEU n 1 108 ALA n 1 109 ASP n 1 110 LEU n 1 111 VAL n 1 112 SER n 1 113 TYR n 1 114 SER n 1 115 ILE n 1 116 GLN n 1 117 LYS n 1 118 VAL n 1 119 ILE n 1 120 GLY n 1 121 PHE n 1 122 ALA n 1 123 LYS n 1 124 MET n 1 125 ILE n 1 126 PRO n 1 127 GLY n 1 128 PHE n 1 129 ARG n 1 130 ASP n 1 131 LEU n 1 132 THR n 1 133 ALA n 1 134 GLU n 1 135 ASP n 1 136 GLN n 1 137 ILE n 1 138 ALA n 1 139 LEU n 1 140 LEU n 1 141 LYS n 1 142 SER n 1 143 SER n 1 144 ALA n 1 145 ILE n 1 146 GLU n 1 147 ILE n 1 148 ILE n 1 149 MET n 1 150 LEU n 1 151 ARG n 1 152 SER n 1 153 ASN n 1 154 GLN n 1 155 SER n 1 156 PHE n 1 157 SER n 1 158 LEU n 1 159 GLU n 1 160 ASP n 1 161 MET n 1 162 SER n 1 163 TRP n 1 164 SER n 1 165 CYS n 1 166 GLY n 1 167 GLY n 1 168 PRO n 1 169 ASP n 1 170 PHE n 1 171 LYS n 1 172 TYR n 1 173 CYS n 1 174 ILE n 1 175 ASN n 1 176 ASP n 1 177 VAL n 1 178 THR n 1 179 LYS n 1 180 ALA n 1 181 GLY n 1 182 HIS n 1 183 THR n 1 184 LEU n 1 185 GLU n 1 186 LEU n 1 187 LEU n 1 188 GLU n 1 189 PRO n 1 190 LEU n 1 191 VAL n 1 192 LYS n 1 193 PHE n 1 194 GLN n 1 195 VAL n 1 196 GLY n 1 197 LEU n 1 198 LYS n 1 199 LYS n 1 200 LEU n 1 201 LYS n 1 202 LEU n 1 203 HIS n 1 204 GLU n 1 205 GLU n 1 206 GLU n 1 207 HIS n 1 208 VAL n 1 209 LEU n 1 210 LEU n 1 211 MET n 1 212 ALA n 1 213 ILE n 1 214 CYS n 1 215 LEU n 1 216 LEU n 1 217 SER n 1 218 PRO n 1 219 ASP n 1 220 ARG n 1 221 PRO n 1 222 GLY n 1 223 VAL n 1 224 GLN n 1 225 ASP n 1 226 HIS n 1 227 VAL n 1 228 ARG n 1 229 ILE n 1 230 GLU n 1 231 ALA n 1 232 LEU n 1 233 GLN n 1 234 ASP n 1 235 ARG n 1 236 LEU n 1 237 CYS n 1 238 ASP n 1 239 VAL n 1 240 LEU n 1 241 GLN n 1 242 ALA n 1 243 TYR n 1 244 ILE n 1 245 ARG n 1 246 ILE n 1 247 GLN n 1 248 HIS n 1 249 PRO n 1 250 GLY n 1 251 GLY n 1 252 ARG n 1 253 LEU n 1 254 LEU n 1 255 TYR n 1 256 ALA n 1 257 LYS n 1 258 MET n 1 259 ILE n 1 260 GLN n 1 261 LYS n 1 262 LEU n 1 263 ALA n 1 264 ASP n 1 265 LEU n 1 266 ARG n 1 267 SER n 1 268 LEU n 1 269 ASN n 1 270 GLU n 1 271 GLU n 1 272 HIS n 1 273 SER n 1 274 LYS n 1 275 GLN n 1 276 TYR n 1 277 ARG n 1 278 SER n 1 279 LEU n 1 280 SER n 1 281 PHE n 1 282 GLN n 1 283 PRO n 1 284 GLU n 1 285 HIS n 1 286 SER n 1 287 MET n 1 288 GLN n 1 289 LEU n 1 290 THR n 1 291 PRO n 1 292 LEU n 1 293 VAL n 1 294 LEU n 1 295 GLU n 1 296 VAL n 1 297 PHE n 1 298 GLY n 1 299 SER n 1 300 GLU n 1 301 VAL n 1 302 SER n 2 1 ARG n 2 2 HIS n 2 3 LYS n 2 4 ILE n 2 5 LEU n 2 6 HIS n 2 7 ARG n 2 8 LEU n 2 9 LEU n 2 10 GLN n 2 11 GLU n 2 12 GLY n 2 13 SER n 2 14 PRO n 2 15 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 302 _entity_src_gen.gene_src_common_name Zebrafish _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'vdra, nr1i1a, vdr' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Danio rerio' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7955 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 15 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP VDRA_DANRE Q9PTN2 ? 1 ;LSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVREGPVTRSASRAASLHSLSDASSDSFNHSPESVDTKLNFSNLLMMY QDSGSPDSSEEDQQSRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMSWS CGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQAYI RIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVS ; 156 2 UNP NCOA1_HUMAN Q15788 ? 2 RHKILHRLLQEGSPS 686 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5NMA A 5 ? 302 ? Q9PTN2 156 ? 453 ? 156 453 2 2 5NMA B 1 ? 15 ? Q15788 686 ? 700 ? 686 700 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5NMA GLY A 1 ? UNP Q9PTN2 ? ? 'expression tag' 152 1 1 5NMA SER A 2 ? UNP Q9PTN2 ? ? 'expression tag' 153 2 1 5NMA HIS A 3 ? UNP Q9PTN2 ? ? 'expression tag' 154 3 1 5NMA MET A 4 ? UNP Q9PTN2 ? ? 'expression tag' 155 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 9CW non-polymer . ;(1~{R},3~{S},5~{Z})-5-[(2~{E})-2-[(1~{R},3~{a}~{S},7~{a}~{R})-7~{a}-methyl-1-[(1~{S})-1-[(2~{S},5~{S})-5-(2-oxidanylpropan-2-yl)oxolan-2-yl]ethyl]-2,3,3~{a},5,6,7-hexahydro-1~{H}-inden-4-ylidene]ethylidene]-4-methylidene-cyclohexane-1,3-diol ; ? 'C28 H44 O4' 444.647 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5NMA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.94 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M BTP pH 7.0, 3 M NaOAc' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-05-29 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9786 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9786 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5NMA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.05 _reflns.d_resolution_low 44 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16429 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 72.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.095 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.05 _reflns_shell.d_res_low 2.09 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 21.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.4 _reflns_shell.pdbx_Rsym_value 0.57 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5NMA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.800 _refine.ls_d_res_low 24.825 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8608 _refine.ls_number_reflns_R_free 426 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.29 _refine.ls_percent_reflns_R_free 4.95 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2109 _refine.ls_R_factor_R_free 0.2724 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2080 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.48 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.37 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2006 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.number_atoms_solvent 9 _refine_hist.number_atoms_total 2047 _refine_hist.d_res_high 2.800 _refine_hist.d_res_low 24.825 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 2080 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.067 ? 2809 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.570 ? 1288 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.054 ? 320 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 357 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.8001 3.2045 . . 125 2304 83.00 . . . 0.3473 . 0.2802 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2045 4.0345 . . 147 2818 99.00 . . . 0.2803 . 0.2289 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0345 24.8263 . . 154 3060 100.00 . . . 0.2484 . 0.1815 . . . . . . . . . . # _struct.entry_id 5NMA _struct.title 'Structure-activity relationship study of vitamin D analogs with oxolane group in their side chain' _struct.pdbx_descriptor 'Vitamin D3 receptor A, Nuclear receptor coactivator 1 (E.C.2.3.1.48)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5NMA _struct_keywords.text 'vitamin D nuclear receptor, transcription' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 6 ? THR A 23 ? SER A 157 THR A 174 1 ? 18 HELX_P HELX_P2 AA2 TYR A 28 ? PHE A 34 ? TYR A 179 PHE A 185 5 ? 7 HELX_P HELX_P3 AA3 MET A 103 ? LYS A 123 ? MET A 254 LYS A 274 1 ? 21 HELX_P HELX_P4 AA4 THR A 132 ? SER A 152 ? THR A 283 SER A 303 1 ? 21 HELX_P HELX_P5 AA5 CYS A 173 ? LYS A 179 ? CYS A 324 LYS A 330 1 ? 7 HELX_P HELX_P6 AA6 THR A 183 ? LEU A 200 ? THR A 334 LEU A 351 1 ? 18 HELX_P HELX_P7 AA7 HIS A 203 ? LEU A 216 ? HIS A 354 LEU A 367 1 ? 14 HELX_P HELX_P8 AA8 ASP A 225 ? HIS A 248 ? ASP A 376 HIS A 399 1 ? 24 HELX_P HELX_P9 AA9 LEU A 253 ? PHE A 281 ? LEU A 404 PHE A 432 1 ? 29 HELX_P HELX_P10 AB1 GLN A 282 ? MET A 287 ? GLN A 433 MET A 438 1 ? 6 HELX_P HELX_P11 AB2 THR A 290 ? GLY A 298 ? THR A 441 GLY A 449 1 ? 9 HELX_P HELX_P12 AB3 HIS B 2 ? LEU B 9 ? HIS B 687 LEU B 694 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 156 ? SER A 157 ? PHE A 307 SER A 308 AA1 2 SER A 162 ? SER A 164 ? SER A 313 SER A 315 AA1 3 LYS A 171 ? TYR A 172 ? LYS A 322 TYR A 323 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 157 ? N SER A 308 O SER A 162 ? O SER A 313 AA1 2 3 N TRP A 163 ? N TRP A 314 O TYR A 172 ? O TYR A 323 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 9CW _struct_site.pdbx_auth_seq_id 4000 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 13 _struct_site.details 'binding site for residue 9CW A 4000' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 TYR A 24 ? TYR A 175 . ? 1_555 ? 2 AC1 13 VAL A 111 ? VAL A 262 . ? 1_555 ? 3 AC1 13 SER A 114 ? SER A 265 . ? 1_555 ? 4 AC1 13 ILE A 148 ? ILE A 299 . ? 1_555 ? 5 AC1 13 ARG A 151 ? ARG A 302 . ? 1_555 ? 6 AC1 13 SER A 152 ? SER A 303 . ? 1_555 ? 7 AC1 13 SER A 155 ? SER A 306 . ? 1_555 ? 8 AC1 13 TRP A 163 ? TRP A 314 . ? 1_555 ? 9 AC1 13 CYS A 165 ? CYS A 316 . ? 1_555 ? 10 AC1 13 VAL A 177 ? VAL A 328 . ? 1_555 ? 11 AC1 13 HIS A 182 ? HIS A 333 . ? 1_555 ? 12 AC1 13 HIS A 272 ? HIS A 423 . ? 1_555 ? 13 AC1 13 TYR A 276 ? TYR A 427 . ? 1_555 ? # _atom_sites.entry_id 5NMA _atom_sites.fract_transf_matrix[1][1] 0.015111 _atom_sites.fract_transf_matrix[1][2] 0.008725 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017449 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003804 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 152 ? ? ? A . n A 1 2 SER 2 153 ? ? ? A . n A 1 3 HIS 3 154 154 HIS HIS A . n A 1 4 MET 4 155 155 MET MET A . n A 1 5 LEU 5 156 156 LEU LEU A . n A 1 6 SER 6 157 157 SER SER A . n A 1 7 ASP 7 158 158 ASP ASP A . n A 1 8 GLU 8 159 159 GLU GLU A . n A 1 9 GLN 9 160 160 GLN GLN A . n A 1 10 MET 10 161 161 MET MET A . n A 1 11 GLN 11 162 162 GLN GLN A . n A 1 12 ILE 12 163 163 ILE ILE A . n A 1 13 ILE 13 164 164 ILE ILE A . n A 1 14 ASN 14 165 165 ASN ASN A . n A 1 15 SER 15 166 166 SER SER A . n A 1 16 LEU 16 167 167 LEU LEU A . n A 1 17 VAL 17 168 168 VAL VAL A . n A 1 18 GLU 18 169 169 GLU GLU A . n A 1 19 ALA 19 170 170 ALA ALA A . n A 1 20 HIS 20 171 171 HIS HIS A . n A 1 21 HIS 21 172 172 HIS HIS A . n A 1 22 LYS 22 173 173 LYS LYS A . n A 1 23 THR 23 174 174 THR THR A . n A 1 24 TYR 24 175 175 TYR TYR A . n A 1 25 ASP 25 176 176 ASP ASP A . n A 1 26 ASP 26 177 177 ASP ASP A . n A 1 27 SER 27 178 178 SER SER A . n A 1 28 TYR 28 179 179 TYR TYR A . n A 1 29 SER 29 180 180 SER SER A . n A 1 30 ASP 30 181 181 ASP ASP A . n A 1 31 PHE 31 182 182 PHE PHE A . n A 1 32 VAL 32 183 183 VAL VAL A . n A 1 33 ARG 33 184 184 ARG ARG A . n A 1 34 PHE 34 185 185 PHE PHE A . n A 1 35 ARG 35 186 186 ARG ARG A . n A 1 36 PRO 36 187 187 PRO PRO A . n A 1 37 PRO 37 188 188 PRO PRO A . n A 1 38 VAL 38 189 189 VAL VAL A . n A 1 39 ARG 39 190 190 ARG ARG A . n A 1 40 GLU 40 191 ? ? ? A . n A 1 41 GLY 41 192 ? ? ? A . n A 1 42 PRO 42 193 ? ? ? A . n A 1 43 VAL 43 194 ? ? ? A . n A 1 44 THR 44 195 ? ? ? A . n A 1 45 ARG 45 196 ? ? ? A . n A 1 46 SER 46 197 ? ? ? A . n A 1 47 ALA 47 198 ? ? ? A . n A 1 48 SER 48 199 ? ? ? A . n A 1 49 ARG 49 200 ? ? ? A . n A 1 50 ALA 50 201 ? ? ? A . n A 1 51 ALA 51 202 ? ? ? A . n A 1 52 SER 52 203 ? ? ? A . n A 1 53 LEU 53 204 ? ? ? A . n A 1 54 HIS 54 205 ? ? ? A . n A 1 55 SER 55 206 ? ? ? A . n A 1 56 LEU 56 207 ? ? ? A . n A 1 57 SER 57 208 ? ? ? A . n A 1 58 ASP 58 209 ? ? ? A . n A 1 59 ALA 59 210 ? ? ? A . n A 1 60 SER 60 211 ? ? ? A . n A 1 61 SER 61 212 ? ? ? A . n A 1 62 ASP 62 213 ? ? ? A . n A 1 63 SER 63 214 ? ? ? A . n A 1 64 PHE 64 215 ? ? ? A . n A 1 65 ASN 65 216 ? ? ? A . n A 1 66 HIS 66 217 ? ? ? A . n A 1 67 SER 67 218 ? ? ? A . n A 1 68 PRO 68 219 ? ? ? A . n A 1 69 GLU 69 220 ? ? ? A . n A 1 70 SER 70 221 ? ? ? A . n A 1 71 VAL 71 222 ? ? ? A . n A 1 72 ASP 72 223 ? ? ? A . n A 1 73 THR 73 224 ? ? ? A . n A 1 74 LYS 74 225 ? ? ? A . n A 1 75 LEU 75 226 ? ? ? A . n A 1 76 ASN 76 227 ? ? ? A . n A 1 77 PHE 77 228 ? ? ? A . n A 1 78 SER 78 229 ? ? ? A . n A 1 79 ASN 79 230 ? ? ? A . n A 1 80 LEU 80 231 ? ? ? A . n A 1 81 LEU 81 232 ? ? ? A . n A 1 82 MET 82 233 ? ? ? A . n A 1 83 MET 83 234 ? ? ? A . n A 1 84 TYR 84 235 ? ? ? A . n A 1 85 GLN 85 236 ? ? ? A . n A 1 86 ASP 86 237 ? ? ? A . n A 1 87 SER 87 238 ? ? ? A . n A 1 88 GLY 88 239 ? ? ? A . n A 1 89 SER 89 240 ? ? ? A . n A 1 90 PRO 90 241 ? ? ? A . n A 1 91 ASP 91 242 ? ? ? A . n A 1 92 SER 92 243 ? ? ? A . n A 1 93 SER 93 244 ? ? ? A . n A 1 94 GLU 94 245 ? ? ? A . n A 1 95 GLU 95 246 ? ? ? A . n A 1 96 ASP 96 247 ? ? ? A . n A 1 97 GLN 97 248 ? ? ? A . n A 1 98 GLN 98 249 ? ? ? A . n A 1 99 SER 99 250 ? ? ? A . n A 1 100 ARG 100 251 251 ARG ARG A . n A 1 101 LEU 101 252 252 LEU LEU A . n A 1 102 SER 102 253 253 SER SER A . n A 1 103 MET 103 254 254 MET MET A . n A 1 104 LEU 104 255 255 LEU LEU A . n A 1 105 PRO 105 256 256 PRO PRO A . n A 1 106 HIS 106 257 257 HIS HIS A . n A 1 107 LEU 107 258 258 LEU LEU A . n A 1 108 ALA 108 259 259 ALA ALA A . n A 1 109 ASP 109 260 260 ASP ASP A . n A 1 110 LEU 110 261 261 LEU LEU A . n A 1 111 VAL 111 262 262 VAL VAL A . n A 1 112 SER 112 263 263 SER SER A . n A 1 113 TYR 113 264 264 TYR TYR A . n A 1 114 SER 114 265 265 SER SER A . n A 1 115 ILE 115 266 266 ILE ILE A . n A 1 116 GLN 116 267 267 GLN GLN A . n A 1 117 LYS 117 268 268 LYS LYS A . n A 1 118 VAL 118 269 269 VAL VAL A . n A 1 119 ILE 119 270 270 ILE ILE A . n A 1 120 GLY 120 271 271 GLY GLY A . n A 1 121 PHE 121 272 272 PHE PHE A . n A 1 122 ALA 122 273 273 ALA ALA A . n A 1 123 LYS 123 274 274 LYS LYS A . n A 1 124 MET 124 275 275 MET MET A . n A 1 125 ILE 125 276 276 ILE ILE A . n A 1 126 PRO 126 277 277 PRO PRO A . n A 1 127 GLY 127 278 278 GLY GLY A . n A 1 128 PHE 128 279 279 PHE PHE A . n A 1 129 ARG 129 280 280 ARG ARG A . n A 1 130 ASP 130 281 281 ASP ASP A . n A 1 131 LEU 131 282 282 LEU LEU A . n A 1 132 THR 132 283 283 THR THR A . n A 1 133 ALA 133 284 284 ALA ALA A . n A 1 134 GLU 134 285 285 GLU GLU A . n A 1 135 ASP 135 286 286 ASP ASP A . n A 1 136 GLN 136 287 287 GLN GLN A . n A 1 137 ILE 137 288 288 ILE ILE A . n A 1 138 ALA 138 289 289 ALA ALA A . n A 1 139 LEU 139 290 290 LEU LEU A . n A 1 140 LEU 140 291 291 LEU LEU A . n A 1 141 LYS 141 292 292 LYS LYS A . n A 1 142 SER 142 293 293 SER SER A . n A 1 143 SER 143 294 294 SER SER A . n A 1 144 ALA 144 295 295 ALA ALA A . n A 1 145 ILE 145 296 296 ILE ILE A . n A 1 146 GLU 146 297 297 GLU GLU A . n A 1 147 ILE 147 298 298 ILE ILE A . n A 1 148 ILE 148 299 299 ILE ILE A . n A 1 149 MET 149 300 300 MET MET A . n A 1 150 LEU 150 301 301 LEU LEU A . n A 1 151 ARG 151 302 302 ARG ARG A . n A 1 152 SER 152 303 303 SER SER A . n A 1 153 ASN 153 304 304 ASN ASN A . n A 1 154 GLN 154 305 305 GLN GLN A . n A 1 155 SER 155 306 306 SER SER A . n A 1 156 PHE 156 307 307 PHE PHE A . n A 1 157 SER 157 308 308 SER SER A . n A 1 158 LEU 158 309 309 LEU LEU A . n A 1 159 GLU 159 310 310 GLU GLU A . n A 1 160 ASP 160 311 311 ASP ASP A . n A 1 161 MET 161 312 312 MET MET A . n A 1 162 SER 162 313 313 SER SER A . n A 1 163 TRP 163 314 314 TRP TRP A . n A 1 164 SER 164 315 315 SER SER A . n A 1 165 CYS 165 316 316 CYS CYS A . n A 1 166 GLY 166 317 317 GLY GLY A . n A 1 167 GLY 167 318 318 GLY GLY A . n A 1 168 PRO 168 319 319 PRO PRO A . n A 1 169 ASP 169 320 320 ASP ASP A . n A 1 170 PHE 170 321 321 PHE PHE A . n A 1 171 LYS 171 322 322 LYS LYS A . n A 1 172 TYR 172 323 323 TYR TYR A . n A 1 173 CYS 173 324 324 CYS CYS A . n A 1 174 ILE 174 325 325 ILE ILE A . n A 1 175 ASN 175 326 326 ASN ASN A . n A 1 176 ASP 176 327 327 ASP ASP A . n A 1 177 VAL 177 328 328 VAL VAL A . n A 1 178 THR 178 329 329 THR THR A . n A 1 179 LYS 179 330 330 LYS LYS A . n A 1 180 ALA 180 331 331 ALA ALA A . n A 1 181 GLY 181 332 332 GLY GLY A . n A 1 182 HIS 182 333 333 HIS HIS A . n A 1 183 THR 183 334 334 THR THR A . n A 1 184 LEU 184 335 335 LEU LEU A . n A 1 185 GLU 185 336 336 GLU GLU A . n A 1 186 LEU 186 337 337 LEU LEU A . n A 1 187 LEU 187 338 338 LEU LEU A . n A 1 188 GLU 188 339 339 GLU GLU A . n A 1 189 PRO 189 340 340 PRO PRO A . n A 1 190 LEU 190 341 341 LEU LEU A . n A 1 191 VAL 191 342 342 VAL VAL A . n A 1 192 LYS 192 343 343 LYS LYS A . n A 1 193 PHE 193 344 344 PHE PHE A . n A 1 194 GLN 194 345 345 GLN GLN A . n A 1 195 VAL 195 346 346 VAL VAL A . n A 1 196 GLY 196 347 347 GLY GLY A . n A 1 197 LEU 197 348 348 LEU LEU A . n A 1 198 LYS 198 349 349 LYS LYS A . n A 1 199 LYS 199 350 350 LYS LYS A . n A 1 200 LEU 200 351 351 LEU LEU A . n A 1 201 LYS 201 352 352 LYS LYS A . n A 1 202 LEU 202 353 353 LEU LEU A . n A 1 203 HIS 203 354 354 HIS HIS A . n A 1 204 GLU 204 355 355 GLU GLU A . n A 1 205 GLU 205 356 356 GLU GLU A . n A 1 206 GLU 206 357 357 GLU GLU A . n A 1 207 HIS 207 358 358 HIS HIS A . n A 1 208 VAL 208 359 359 VAL VAL A . n A 1 209 LEU 209 360 360 LEU LEU A . n A 1 210 LEU 210 361 361 LEU LEU A . n A 1 211 MET 211 362 362 MET MET A . n A 1 212 ALA 212 363 363 ALA ALA A . n A 1 213 ILE 213 364 364 ILE ILE A . n A 1 214 CYS 214 365 365 CYS CYS A . n A 1 215 LEU 215 366 366 LEU LEU A . n A 1 216 LEU 216 367 367 LEU LEU A . n A 1 217 SER 217 368 368 SER SER A . n A 1 218 PRO 218 369 369 PRO PRO A . n A 1 219 ASP 219 370 370 ASP ASP A . n A 1 220 ARG 220 371 371 ARG ARG A . n A 1 221 PRO 221 372 372 PRO PRO A . n A 1 222 GLY 222 373 373 GLY GLY A . n A 1 223 VAL 223 374 374 VAL VAL A . n A 1 224 GLN 224 375 375 GLN GLN A . n A 1 225 ASP 225 376 376 ASP ASP A . n A 1 226 HIS 226 377 377 HIS HIS A . n A 1 227 VAL 227 378 378 VAL VAL A . n A 1 228 ARG 228 379 379 ARG ARG A . n A 1 229 ILE 229 380 380 ILE ILE A . n A 1 230 GLU 230 381 381 GLU GLU A . n A 1 231 ALA 231 382 382 ALA ALA A . n A 1 232 LEU 232 383 383 LEU LEU A . n A 1 233 GLN 233 384 384 GLN GLN A . n A 1 234 ASP 234 385 385 ASP ASP A . n A 1 235 ARG 235 386 386 ARG ARG A . n A 1 236 LEU 236 387 387 LEU LEU A . n A 1 237 CYS 237 388 388 CYS CYS A . n A 1 238 ASP 238 389 389 ASP ASP A . n A 1 239 VAL 239 390 390 VAL VAL A . n A 1 240 LEU 240 391 391 LEU LEU A . n A 1 241 GLN 241 392 392 GLN GLN A . n A 1 242 ALA 242 393 393 ALA ALA A . n A 1 243 TYR 243 394 394 TYR TYR A . n A 1 244 ILE 244 395 395 ILE ILE A . n A 1 245 ARG 245 396 396 ARG ARG A . n A 1 246 ILE 246 397 397 ILE ILE A . n A 1 247 GLN 247 398 398 GLN GLN A . n A 1 248 HIS 248 399 399 HIS HIS A . n A 1 249 PRO 249 400 400 PRO PRO A . n A 1 250 GLY 250 401 401 GLY GLY A . n A 1 251 GLY 251 402 402 GLY GLY A . n A 1 252 ARG 252 403 403 ARG ARG A . n A 1 253 LEU 253 404 404 LEU LEU A . n A 1 254 LEU 254 405 405 LEU LEU A . n A 1 255 TYR 255 406 406 TYR TYR A . n A 1 256 ALA 256 407 407 ALA ALA A . n A 1 257 LYS 257 408 408 LYS LYS A . n A 1 258 MET 258 409 409 MET MET A . n A 1 259 ILE 259 410 410 ILE ILE A . n A 1 260 GLN 260 411 411 GLN GLN A . n A 1 261 LYS 261 412 412 LYS LYS A . n A 1 262 LEU 262 413 413 LEU LEU A . n A 1 263 ALA 263 414 414 ALA ALA A . n A 1 264 ASP 264 415 415 ASP ASP A . n A 1 265 LEU 265 416 416 LEU LEU A . n A 1 266 ARG 266 417 417 ARG ARG A . n A 1 267 SER 267 418 418 SER SER A . n A 1 268 LEU 268 419 419 LEU LEU A . n A 1 269 ASN 269 420 420 ASN ASN A . n A 1 270 GLU 270 421 421 GLU GLU A . n A 1 271 GLU 271 422 422 GLU GLU A . n A 1 272 HIS 272 423 423 HIS HIS A . n A 1 273 SER 273 424 424 SER SER A . n A 1 274 LYS 274 425 425 LYS LYS A . n A 1 275 GLN 275 426 426 GLN GLN A . n A 1 276 TYR 276 427 427 TYR TYR A . n A 1 277 ARG 277 428 428 ARG ARG A . n A 1 278 SER 278 429 429 SER SER A . n A 1 279 LEU 279 430 430 LEU LEU A . n A 1 280 SER 280 431 431 SER SER A . n A 1 281 PHE 281 432 432 PHE PHE A . n A 1 282 GLN 282 433 433 GLN GLN A . n A 1 283 PRO 283 434 434 PRO PRO A . n A 1 284 GLU 284 435 435 GLU GLU A . n A 1 285 HIS 285 436 436 HIS HIS A . n A 1 286 SER 286 437 437 SER SER A . n A 1 287 MET 287 438 438 MET MET A . n A 1 288 GLN 288 439 439 GLN GLN A . n A 1 289 LEU 289 440 440 LEU LEU A . n A 1 290 THR 290 441 441 THR THR A . n A 1 291 PRO 291 442 442 PRO PRO A . n A 1 292 LEU 292 443 443 LEU LEU A . n A 1 293 VAL 293 444 444 VAL VAL A . n A 1 294 LEU 294 445 445 LEU LEU A . n A 1 295 GLU 295 446 446 GLU GLU A . n A 1 296 VAL 296 447 447 VAL VAL A . n A 1 297 PHE 297 448 448 PHE PHE A . n A 1 298 GLY 298 449 449 GLY GLY A . n A 1 299 SER 299 450 450 SER SER A . n A 1 300 GLU 300 451 451 GLU GLU A . n A 1 301 VAL 301 452 452 VAL VAL A . n A 1 302 SER 302 453 ? ? ? A . n B 2 1 ARG 1 686 686 ARG ARG B . n B 2 2 HIS 2 687 687 HIS HIS B . n B 2 3 LYS 3 688 688 LYS LYS B . n B 2 4 ILE 4 689 689 ILE ILE B . n B 2 5 LEU 5 690 690 LEU LEU B . n B 2 6 HIS 6 691 691 HIS HIS B . n B 2 7 ARG 7 692 692 ARG ARG B . n B 2 8 LEU 8 693 693 LEU LEU B . n B 2 9 LEU 9 694 694 LEU LEU B . n B 2 10 GLN 10 695 695 GLN GLN B . n B 2 11 GLU 11 696 ? ? ? B . n B 2 12 GLY 12 697 ? ? ? B . n B 2 13 SER 13 698 ? ? ? B . n B 2 14 PRO 14 699 ? ? ? B . n B 2 15 SER 15 700 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 9CW 1 4000 4000 9CW ZG1 A . D 4 HOH 1 4101 4 HOH HOH A . D 4 HOH 2 4102 3 HOH HOH A . D 4 HOH 3 4103 2 HOH HOH A . D 4 HOH 4 4104 7 HOH HOH A . D 4 HOH 5 4105 8 HOH HOH A . D 4 HOH 6 4106 1 HOH HOH A . D 4 HOH 7 4107 9 HOH HOH A . D 4 HOH 8 4108 5 HOH HOH A . E 4 HOH 1 801 6 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4210 ? 1 MORE -32 ? 1 'SSA (A^2)' 22110 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_564 x,x-y+1,-z-1/6 0.5000000000 0.8660254038 0.0000000000 -33.0875000000 0.8660254038 -0.5000000000 0.0000000000 57.3092310954 0.0000000000 0.0000000000 -1.0000000000 -43.8098333333 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-05-24 2 'Structure model' 1 1 2017-09-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Author supporting evidence' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category pdbx_audit_support # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_audit_support.funding_organization' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 C A LEU 367 ? ? N A SER 368 ? ? 1.112 1.336 -0.224 0.023 Y 2 1 CD A GLU 421 ? ? OE1 A GLU 421 ? ? 1.155 1.252 -0.097 0.011 N 3 1 CD A GLU 421 ? ? OE2 A GLU 421 ? ? 1.166 1.252 -0.086 0.011 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 252 ? ? 66.30 62.88 2 1 LEU A 367 ? ? -85.01 38.03 3 1 ASP A 370 ? ? -78.44 33.08 4 1 GLN A 375 ? ? -103.67 -66.58 5 1 HIS B 687 ? ? 74.41 42.69 # _pdbx_validate_polymer_linkage.id 1 _pdbx_validate_polymer_linkage.PDB_model_num 1 _pdbx_validate_polymer_linkage.auth_atom_id_1 C _pdbx_validate_polymer_linkage.auth_asym_id_1 A _pdbx_validate_polymer_linkage.auth_comp_id_1 LEU _pdbx_validate_polymer_linkage.auth_seq_id_1 367 _pdbx_validate_polymer_linkage.PDB_ins_code_1 ? _pdbx_validate_polymer_linkage.label_alt_id_1 ? _pdbx_validate_polymer_linkage.auth_atom_id_2 N _pdbx_validate_polymer_linkage.auth_asym_id_2 A _pdbx_validate_polymer_linkage.auth_comp_id_2 SER _pdbx_validate_polymer_linkage.auth_seq_id_2 368 _pdbx_validate_polymer_linkage.PDB_ins_code_2 ? _pdbx_validate_polymer_linkage.label_alt_id_2 ? _pdbx_validate_polymer_linkage.dist 1.11 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 451 ? CG ? A GLU 300 CG 2 1 Y 1 A GLU 451 ? CD ? A GLU 300 CD 3 1 Y 1 A GLU 451 ? OE1 ? A GLU 300 OE1 4 1 Y 1 A GLU 451 ? OE2 ? A GLU 300 OE2 5 1 Y 1 A VAL 452 ? CG1 ? A VAL 301 CG1 6 1 Y 1 A VAL 452 ? CG2 ? A VAL 301 CG2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 152 ? A GLY 1 2 1 Y 1 A SER 153 ? A SER 2 3 1 Y 1 A GLU 191 ? A GLU 40 4 1 Y 1 A GLY 192 ? A GLY 41 5 1 Y 1 A PRO 193 ? A PRO 42 6 1 Y 1 A VAL 194 ? A VAL 43 7 1 Y 1 A THR 195 ? A THR 44 8 1 Y 1 A ARG 196 ? A ARG 45 9 1 Y 1 A SER 197 ? A SER 46 10 1 Y 1 A ALA 198 ? A ALA 47 11 1 Y 1 A SER 199 ? A SER 48 12 1 Y 1 A ARG 200 ? A ARG 49 13 1 Y 1 A ALA 201 ? A ALA 50 14 1 Y 1 A ALA 202 ? A ALA 51 15 1 Y 1 A SER 203 ? A SER 52 16 1 Y 1 A LEU 204 ? A LEU 53 17 1 Y 1 A HIS 205 ? A HIS 54 18 1 Y 1 A SER 206 ? A SER 55 19 1 Y 1 A LEU 207 ? A LEU 56 20 1 Y 1 A SER 208 ? A SER 57 21 1 Y 1 A ASP 209 ? A ASP 58 22 1 Y 1 A ALA 210 ? A ALA 59 23 1 Y 1 A SER 211 ? A SER 60 24 1 Y 1 A SER 212 ? A SER 61 25 1 Y 1 A ASP 213 ? A ASP 62 26 1 Y 1 A SER 214 ? A SER 63 27 1 Y 1 A PHE 215 ? A PHE 64 28 1 Y 1 A ASN 216 ? A ASN 65 29 1 Y 1 A HIS 217 ? A HIS 66 30 1 Y 1 A SER 218 ? A SER 67 31 1 Y 1 A PRO 219 ? A PRO 68 32 1 Y 1 A GLU 220 ? A GLU 69 33 1 Y 1 A SER 221 ? A SER 70 34 1 Y 1 A VAL 222 ? A VAL 71 35 1 Y 1 A ASP 223 ? A ASP 72 36 1 Y 1 A THR 224 ? A THR 73 37 1 Y 1 A LYS 225 ? A LYS 74 38 1 Y 1 A LEU 226 ? A LEU 75 39 1 Y 1 A ASN 227 ? A ASN 76 40 1 Y 1 A PHE 228 ? A PHE 77 41 1 Y 1 A SER 229 ? A SER 78 42 1 Y 1 A ASN 230 ? A ASN 79 43 1 Y 1 A LEU 231 ? A LEU 80 44 1 Y 1 A LEU 232 ? A LEU 81 45 1 Y 1 A MET 233 ? A MET 82 46 1 Y 1 A MET 234 ? A MET 83 47 1 Y 1 A TYR 235 ? A TYR 84 48 1 Y 1 A GLN 236 ? A GLN 85 49 1 Y 1 A ASP 237 ? A ASP 86 50 1 Y 1 A SER 238 ? A SER 87 51 1 Y 1 A GLY 239 ? A GLY 88 52 1 Y 1 A SER 240 ? A SER 89 53 1 Y 1 A PRO 241 ? A PRO 90 54 1 Y 1 A ASP 242 ? A ASP 91 55 1 Y 1 A SER 243 ? A SER 92 56 1 Y 1 A SER 244 ? A SER 93 57 1 Y 1 A GLU 245 ? A GLU 94 58 1 Y 1 A GLU 246 ? A GLU 95 59 1 Y 1 A ASP 247 ? A ASP 96 60 1 Y 1 A GLN 248 ? A GLN 97 61 1 Y 1 A GLN 249 ? A GLN 98 62 1 Y 1 A SER 250 ? A SER 99 63 1 Y 1 A SER 453 ? A SER 302 64 1 Y 1 B GLU 696 ? B GLU 11 65 1 Y 1 B GLY 697 ? B GLY 12 66 1 Y 1 B SER 698 ? B SER 13 67 1 Y 1 B PRO 699 ? B PRO 14 68 1 Y 1 B SER 700 ? B SER 15 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'French National Research Agency' France ANR-13-BSV8-0024-01 1 FRM France 'FRM: FDT20140930978' 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 ;(1~{R},3~{S},5~{Z})-5-[(2~{E})-2-[(1~{R},3~{a}~{S},7~{a}~{R})-7~{a}-methyl-1-[(1~{S})-1-[(2~{S},5~{S})-5-(2-oxidanylpropan-2-yl)oxolan-2-yl]ethyl]-2,3,3~{a},5,6,7-hexahydro-1~{H}-inden-4-ylidene]ethylidene]-4-methylidene-cyclohexane-1,3-diol ; 9CW 4 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #