data_5O3J # _entry.id 5O3J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5O3J pdb_00005o3j 10.2210/pdb5o3j/pdb WWPDB D_1200005093 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-07-05 2 'Structure model' 1 1 2017-08-09 3 'Structure model' 1 2 2019-10-16 4 'Structure model' 1 3 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' reflns_shell 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.name' 6 4 'Structure model' '_database_2.pdbx_DOI' 7 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5O3J _pdbx_database_status.recvd_initial_deposition_date 2017-05-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sonntag, M.' 1 ? 'Jagtap, P.K.A.' 2 0000-0002-9457-4130 'Hennig, J.' 3 ? 'Sattler, M.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Angew. Chem. Int. Ed. Engl.' _citation.journal_id_ASTM ACIEAY _citation.journal_id_CSD 0179 _citation.journal_id_ISSN 1521-3773 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 56 _citation.language ? _citation.page_first 9322 _citation.page_last 9325 _citation.title 'Segmental, Domain-Selective Perdeuteration and Small-Angle Neutron Scattering for Structural Analysis of Multi-Domain Proteins.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/anie.201702904 _citation.pdbx_database_id_PubMed 28636238 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sonntag, M.' 1 ? primary 'Jagtap, P.K.A.' 2 ? primary 'Simon, B.' 3 ? primary 'Appavou, M.S.' 4 ? primary 'Geerlof, A.' 5 ? primary 'Stehle, R.' 6 ? primary 'Gabel, F.' 7 ? primary 'Hennig, J.' 8 ? primary 'Sattler, M.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nucleolysin TIA-1 isoform p40' 8888.953 1 ? ? 'RRM2 domain, UNP Residues 93-170' ? 2 polymer syn ;RNA (5'-R(P*UP*UP*C)-3') ; 872.556 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNA-binding protein TIA-1,T-cell-restricted intracellular antigen-1,TIA-1,p40-TIA-1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GANHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNW GANHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNW A ? 2 polyribonucleotide no no UUC UUC B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 ASN n 1 4 HIS n 1 5 PHE n 1 6 HIS n 1 7 VAL n 1 8 PHE n 1 9 VAL n 1 10 GLY n 1 11 ASP n 1 12 LEU n 1 13 SER n 1 14 PRO n 1 15 GLU n 1 16 ILE n 1 17 THR n 1 18 THR n 1 19 GLU n 1 20 ASP n 1 21 ILE n 1 22 LYS n 1 23 ALA n 1 24 ALA n 1 25 PHE n 1 26 ALA n 1 27 PRO n 1 28 PHE n 1 29 GLY n 1 30 ARG n 1 31 ILE n 1 32 SER n 1 33 ASP n 1 34 ALA n 1 35 ARG n 1 36 VAL n 1 37 VAL n 1 38 LYS n 1 39 ASP n 1 40 MET n 1 41 ALA n 1 42 THR n 1 43 GLY n 1 44 LYS n 1 45 SER n 1 46 LYS n 1 47 GLY n 1 48 TYR n 1 49 GLY n 1 50 PHE n 1 51 VAL n 1 52 SER n 1 53 PHE n 1 54 PHE n 1 55 ASN n 1 56 LYS n 1 57 TRP n 1 58 ASP n 1 59 ALA n 1 60 GLU n 1 61 ASN n 1 62 ALA n 1 63 ILE n 1 64 GLN n 1 65 GLN n 1 66 MET n 1 67 GLY n 1 68 GLY n 1 69 GLN n 1 70 TRP n 1 71 LEU n 1 72 GLY n 1 73 GLY n 1 74 ARG n 1 75 GLN n 1 76 ILE n 1 77 ARG n 1 78 THR n 1 79 ASN n 1 80 TRP n 2 1 U n 2 2 U n 2 3 C n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 80 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TIA1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 3 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C 'RNA linking' y "CYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O8 P' 323.197 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U 'RNA linking' y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 -4 GLY GLY A . n A 1 2 ALA 2 -3 -3 ALA ALA A . n A 1 3 ASN 3 -2 -2 ASN ASN A . n A 1 4 HIS 4 -1 -1 HIS HIS A . n A 1 5 PHE 5 0 0 PHE PHE A . n A 1 6 HIS 6 1 1 HIS HIS A . n A 1 7 VAL 7 2 2 VAL VAL A . n A 1 8 PHE 8 3 3 PHE PHE A . n A 1 9 VAL 9 4 4 VAL VAL A . n A 1 10 GLY 10 5 5 GLY GLY A . n A 1 11 ASP 11 6 6 ASP ASP A . n A 1 12 LEU 12 7 7 LEU LEU A . n A 1 13 SER 13 8 8 SER SER A . n A 1 14 PRO 14 9 9 PRO PRO A . n A 1 15 GLU 15 10 10 GLU GLU A . n A 1 16 ILE 16 11 11 ILE ILE A . n A 1 17 THR 17 12 12 THR THR A . n A 1 18 THR 18 13 13 THR THR A . n A 1 19 GLU 19 14 14 GLU GLU A . n A 1 20 ASP 20 15 15 ASP ASP A . n A 1 21 ILE 21 16 16 ILE ILE A . n A 1 22 LYS 22 17 17 LYS LYS A . n A 1 23 ALA 23 18 18 ALA ALA A . n A 1 24 ALA 24 19 19 ALA ALA A . n A 1 25 PHE 25 20 20 PHE PHE A . n A 1 26 ALA 26 21 21 ALA ALA A . n A 1 27 PRO 27 22 22 PRO PRO A . n A 1 28 PHE 28 23 23 PHE PHE A . n A 1 29 GLY 29 24 24 GLY GLY A . n A 1 30 ARG 30 25 25 ARG ARG A . n A 1 31 ILE 31 26 26 ILE ILE A . n A 1 32 SER 32 27 27 SER SER A . n A 1 33 ASP 33 28 28 ASP ASP A . n A 1 34 ALA 34 29 29 ALA ALA A . n A 1 35 ARG 35 30 30 ARG ARG A . n A 1 36 VAL 36 31 31 VAL VAL A . n A 1 37 VAL 37 32 32 VAL VAL A . n A 1 38 LYS 38 33 33 LYS LYS A . n A 1 39 ASP 39 34 34 ASP ASP A . n A 1 40 MET 40 35 35 MET MET A . n A 1 41 ALA 41 36 36 ALA ALA A . n A 1 42 THR 42 37 37 THR THR A . n A 1 43 GLY 43 38 38 GLY GLY A . n A 1 44 LYS 44 39 39 LYS LYS A . n A 1 45 SER 45 40 40 SER SER A . n A 1 46 LYS 46 41 41 LYS LYS A . n A 1 47 GLY 47 42 42 GLY GLY A . n A 1 48 TYR 48 43 43 TYR TYR A . n A 1 49 GLY 49 44 44 GLY GLY A . n A 1 50 PHE 50 45 45 PHE PHE A . n A 1 51 VAL 51 46 46 VAL VAL A . n A 1 52 SER 52 47 47 SER SER A . n A 1 53 PHE 53 48 48 PHE PHE A . n A 1 54 PHE 54 49 49 PHE PHE A . n A 1 55 ASN 55 50 50 ASN ASN A . n A 1 56 LYS 56 51 51 LYS LYS A . n A 1 57 TRP 57 52 52 TRP TRP A . n A 1 58 ASP 58 53 53 ASP ASP A . n A 1 59 ALA 59 54 54 ALA ALA A . n A 1 60 GLU 60 55 55 GLU GLU A . n A 1 61 ASN 61 56 56 ASN ASN A . n A 1 62 ALA 62 57 57 ALA ALA A . n A 1 63 ILE 63 58 58 ILE ILE A . n A 1 64 GLN 64 59 59 GLN GLN A . n A 1 65 GLN 65 60 60 GLN GLN A . n A 1 66 MET 66 61 61 MET MET A . n A 1 67 GLY 67 62 62 GLY GLY A . n A 1 68 GLY 68 63 63 GLY GLY A . n A 1 69 GLN 69 64 64 GLN GLN A . n A 1 70 TRP 70 65 65 TRP TRP A . n A 1 71 LEU 71 66 66 LEU LEU A . n A 1 72 GLY 72 67 67 GLY GLY A . n A 1 73 GLY 73 68 68 GLY GLY A . n A 1 74 ARG 74 69 69 ARG ARG A . n A 1 75 GLN 75 70 70 GLN GLN A . n A 1 76 ILE 76 71 71 ILE ILE A . n A 1 77 ARG 77 72 72 ARG ARG A . n A 1 78 THR 78 73 73 THR THR A . n A 1 79 ASN 79 74 74 ASN ASN A . n A 1 80 TRP 80 75 75 TRP TRP A . n B 2 1 U 1 1 1 U U B . n B 2 2 U 2 2 2 U U B . n B 2 3 C 3 3 3 C C B . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 10 ? OE1 ? A GLU 15 OE1 2 1 Y 1 A GLU 10 ? OE2 ? A GLU 15 OE2 3 1 Y 1 A ILE 11 ? CD1 ? A ILE 16 CD1 4 1 Y 1 A GLU 14 ? CG ? A GLU 19 CG 5 1 Y 1 A GLU 14 ? CD ? A GLU 19 CD 6 1 Y 1 A GLU 14 ? OE1 ? A GLU 19 OE1 7 1 Y 1 A GLU 14 ? OE2 ? A GLU 19 OE2 8 1 Y 1 A ILE 16 ? CD1 ? A ILE 21 CD1 9 1 Y 1 A LYS 17 ? CG ? A LYS 22 CG 10 1 Y 1 A LYS 17 ? CD ? A LYS 22 CD 11 1 Y 1 A LYS 17 ? CE ? A LYS 22 CE 12 1 Y 1 A LYS 17 ? NZ ? A LYS 22 NZ 13 1 Y 1 A ARG 25 ? NH1 ? A ARG 30 NH1 14 1 Y 1 A ARG 25 ? NH2 ? A ARG 30 NH2 15 1 Y 1 A LYS 33 ? CD ? A LYS 38 CD 16 1 Y 1 A LYS 33 ? CE ? A LYS 38 CE 17 1 Y 1 A LYS 33 ? NZ ? A LYS 38 NZ 18 1 Y 1 A MET 35 ? CG ? A MET 40 CG 19 1 Y 1 A MET 35 ? SD ? A MET 40 SD 20 1 Y 1 A MET 35 ? CE ? A MET 40 CE 21 1 Y 1 A LYS 39 ? CD ? A LYS 44 CD 22 1 Y 1 A LYS 39 ? CE ? A LYS 44 CE 23 1 Y 1 A LYS 39 ? NZ ? A LYS 44 NZ 24 1 Y 1 A LYS 41 ? CD ? A LYS 46 CD 25 1 Y 1 A LYS 41 ? CE ? A LYS 46 CE 26 1 Y 1 A LYS 41 ? NZ ? A LYS 46 NZ 27 1 Y 1 A LYS 51 ? CE ? A LYS 56 CE 28 1 Y 1 A LYS 51 ? NZ ? A LYS 56 NZ 29 1 Y 1 B C 3 ? "O5'" ? B C 3 "O5'" 30 1 Y 1 B C 3 ? "C5'" ? B C 3 "C5'" 31 1 Y 1 B C 3 ? "C4'" ? B C 3 "C4'" 32 1 Y 1 B C 3 ? "O4'" ? B C 3 "O4'" 33 1 Y 1 B C 3 ? "C3'" ? B C 3 "C3'" 34 1 Y 1 B C 3 ? "O3'" ? B C 3 "O3'" 35 1 Y 1 B C 3 ? "C2'" ? B C 3 "C2'" 36 1 Y 1 B C 3 ? "O2'" ? B C 3 "O2'" 37 1 Y 1 B C 3 ? "C1'" ? B C 3 "C1'" 38 1 Y 1 B C 3 ? N1 ? B C 3 N1 39 1 Y 1 B C 3 ? C2 ? B C 3 C2 40 1 Y 1 B C 3 ? O2 ? B C 3 O2 41 1 Y 1 B C 3 ? N3 ? B C 3 N3 42 1 Y 1 B C 3 ? C4 ? B C 3 C4 43 1 Y 1 B C 3 ? N4 ? B C 3 N4 44 1 Y 1 B C 3 ? C5 ? B C 3 C5 45 1 Y 1 B C 3 ? C6 ? B C 3 C6 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0151 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5O3J _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.310 _cell.length_a_esd ? _cell.length_b 44.310 _cell.length_b_esd ? _cell.length_c 85.720 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5O3J _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5O3J _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.49 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.57 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '50mM MES pH6, 5mM MgSO4, 5% PEG4000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-02-01 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.99 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.99 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5O3J _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.97 _reflns.d_resolution_low 35.02 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 1980 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.8 _reflns.pdbx_Rmerge_I_obs 0.0867 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.34 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.93 _reflns.pdbx_R_split ? # _refine.aniso_B[1][1] 2.32 _refine.aniso_B[1][2] 1.16 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 2.32 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -7.52 _refine.B_iso_max ? _refine.B_iso_mean 84.381 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.919 _refine.correlation_coeff_Fo_to_Fc_free 0.909 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5O3J _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.97 _refine.ls_d_res_low 35.02 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 1859 _refine.ls_number_reflns_R_free 98 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.14 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.25387 _refine.ls_R_factor_R_free 0.31160 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.25095 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3BS9 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.557 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 31.878 _refine.overall_SU_ML 0.526 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 600 _refine_hist.pdbx_number_atoms_nucleic_acid 43 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 643 _refine_hist.d_res_high 2.97 _refine_hist.d_res_low 35.02 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 0.019 663 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 551 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 0.906 1.834 906 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.837 3.000 1253 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.452 5.000 79 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.787 23.667 30 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.793 15.000 79 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 10.869 15.000 4 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.062 0.200 94 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 759 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 176 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.483 8.832 319 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.483 8.838 318 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.641 13.248 397 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.638 13.240 398 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 0.920 9.093 344 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 0.911 9.078 341 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 1.701 13.634 509 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 3.956 ? 715 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 3.959 ? 714 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.967 _refine_ls_shell.d_res_low 3.044 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 6 _refine_ls_shell.number_reflns_R_work 126 _refine_ls_shell.percent_reflns_obs 96.35 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.415 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.310 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 5O3J _struct.title 'Crystal structure of TIA-1 RRM2 in complex with RNA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5O3J _struct_keywords.text 'TIA-1, RNA binding protein, RRM' _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP TIA1_HUMAN P31483 P31483-2 1 NHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNW 93 2 PDB 5O3J 5O3J ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5O3J A 3 ? 80 ? P31483 93 ? 170 ? -2 75 2 2 5O3J B 1 ? 3 ? 5O3J 1 ? 3 ? 1 3 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5O3J GLY A 1 ? UNP P31483 ? ? 'expression tag' -4 1 1 5O3J ALA A 2 ? UNP P31483 ? ? 'expression tag' -3 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4930 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 17 ? ALA A 26 ? THR A 12 ALA A 21 1 ? 10 HELX_P HELX_P2 AA2 ASN A 55 ? MET A 66 ? ASN A 50 MET A 61 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 31 ? LYS A 38 ? ILE A 26 LYS A 33 AA1 2 SER A 45 ? PHE A 53 ? SER A 40 PHE A 48 AA1 3 PHE A 5 ? GLY A 10 ? PHE A 0 GLY A 5 AA1 4 ARG A 77 ? ASN A 79 ? ARG A 72 ASN A 74 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 33 ? N ASP A 28 O SER A 52 ? O SER A 47 AA1 2 3 O GLY A 49 ? O GLY A 44 N VAL A 9 ? N VAL A 4 AA1 3 4 N PHE A 8 ? N PHE A 3 O ASN A 79 ? O ASN A 74 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 53 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 178.89 _pdbx_validate_torsion.psi -55.33 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 C OP3 O N N 74 C P P N N 75 C OP1 O N N 76 C OP2 O N N 77 C "O5'" O N N 78 C "C5'" C N N 79 C "C4'" C N R 80 C "O4'" O N N 81 C "C3'" C N S 82 C "O3'" O N N 83 C "C2'" C N R 84 C "O2'" O N N 85 C "C1'" C N R 86 C N1 N N N 87 C C2 C N N 88 C O2 O N N 89 C N3 N N N 90 C C4 C N N 91 C N4 N N N 92 C C5 C N N 93 C C6 C N N 94 C HOP3 H N N 95 C HOP2 H N N 96 C "H5'" H N N 97 C "H5''" H N N 98 C "H4'" H N N 99 C "H3'" H N N 100 C "HO3'" H N N 101 C "H2'" H N N 102 C "HO2'" H N N 103 C "H1'" H N N 104 C H41 H N N 105 C H42 H N N 106 C H5 H N N 107 C H6 H N N 108 GLN N N N N 109 GLN CA C N S 110 GLN C C N N 111 GLN O O N N 112 GLN CB C N N 113 GLN CG C N N 114 GLN CD C N N 115 GLN OE1 O N N 116 GLN NE2 N N N 117 GLN OXT O N N 118 GLN H H N N 119 GLN H2 H N N 120 GLN HA H N N 121 GLN HB2 H N N 122 GLN HB3 H N N 123 GLN HG2 H N N 124 GLN HG3 H N N 125 GLN HE21 H N N 126 GLN HE22 H N N 127 GLN HXT H N N 128 GLU N N N N 129 GLU CA C N S 130 GLU C C N N 131 GLU O O N N 132 GLU CB C N N 133 GLU CG C N N 134 GLU CD C N N 135 GLU OE1 O N N 136 GLU OE2 O N N 137 GLU OXT O N N 138 GLU H H N N 139 GLU H2 H N N 140 GLU HA H N N 141 GLU HB2 H N N 142 GLU HB3 H N N 143 GLU HG2 H N N 144 GLU HG3 H N N 145 GLU HE2 H N N 146 GLU HXT H N N 147 GLY N N N N 148 GLY CA C N N 149 GLY C C N N 150 GLY O O N N 151 GLY OXT O N N 152 GLY H H N N 153 GLY H2 H N N 154 GLY HA2 H N N 155 GLY HA3 H N N 156 GLY HXT H N N 157 HIS N N N N 158 HIS CA C N S 159 HIS C C N N 160 HIS O O N N 161 HIS CB C N N 162 HIS CG C Y N 163 HIS ND1 N Y N 164 HIS CD2 C Y N 165 HIS CE1 C Y N 166 HIS NE2 N Y N 167 HIS OXT O N N 168 HIS H H N N 169 HIS H2 H N N 170 HIS HA H N N 171 HIS HB2 H N N 172 HIS HB3 H N N 173 HIS HD1 H N N 174 HIS HD2 H N N 175 HIS HE1 H N N 176 HIS HE2 H N N 177 HIS HXT H N N 178 ILE N N N N 179 ILE CA C N S 180 ILE C C N N 181 ILE O O N N 182 ILE CB C N S 183 ILE CG1 C N N 184 ILE CG2 C N N 185 ILE CD1 C N N 186 ILE OXT O N N 187 ILE H H N N 188 ILE H2 H N N 189 ILE HA H N N 190 ILE HB H N N 191 ILE HG12 H N N 192 ILE HG13 H N N 193 ILE HG21 H N N 194 ILE HG22 H N N 195 ILE HG23 H N N 196 ILE HD11 H N N 197 ILE HD12 H N N 198 ILE HD13 H N N 199 ILE HXT H N N 200 LEU N N N N 201 LEU CA C N S 202 LEU C C N N 203 LEU O O N N 204 LEU CB C N N 205 LEU CG C N N 206 LEU CD1 C N N 207 LEU CD2 C N N 208 LEU OXT O N N 209 LEU H H N N 210 LEU H2 H N N 211 LEU HA H N N 212 LEU HB2 H N N 213 LEU HB3 H N N 214 LEU HG H N N 215 LEU HD11 H N N 216 LEU HD12 H N N 217 LEU HD13 H N N 218 LEU HD21 H N N 219 LEU HD22 H N N 220 LEU HD23 H N N 221 LEU HXT H N N 222 LYS N N N N 223 LYS CA C N S 224 LYS C C N N 225 LYS O O N N 226 LYS CB C N N 227 LYS CG C N N 228 LYS CD C N N 229 LYS CE C N N 230 LYS NZ N N N 231 LYS OXT O N N 232 LYS H H N N 233 LYS H2 H N N 234 LYS HA H N N 235 LYS HB2 H N N 236 LYS HB3 H N N 237 LYS HG2 H N N 238 LYS HG3 H N N 239 LYS HD2 H N N 240 LYS HD3 H N N 241 LYS HE2 H N N 242 LYS HE3 H N N 243 LYS HZ1 H N N 244 LYS HZ2 H N N 245 LYS HZ3 H N N 246 LYS HXT H N N 247 MET N N N N 248 MET CA C N S 249 MET C C N N 250 MET O O N N 251 MET CB C N N 252 MET CG C N N 253 MET SD S N N 254 MET CE C N N 255 MET OXT O N N 256 MET H H N N 257 MET H2 H N N 258 MET HA H N N 259 MET HB2 H N N 260 MET HB3 H N N 261 MET HG2 H N N 262 MET HG3 H N N 263 MET HE1 H N N 264 MET HE2 H N N 265 MET HE3 H N N 266 MET HXT H N N 267 PHE N N N N 268 PHE CA C N S 269 PHE C C N N 270 PHE O O N N 271 PHE CB C N N 272 PHE CG C Y N 273 PHE CD1 C Y N 274 PHE CD2 C Y N 275 PHE CE1 C Y N 276 PHE CE2 C Y N 277 PHE CZ C Y N 278 PHE OXT O N N 279 PHE H H N N 280 PHE H2 H N N 281 PHE HA H N N 282 PHE HB2 H N N 283 PHE HB3 H N N 284 PHE HD1 H N N 285 PHE HD2 H N N 286 PHE HE1 H N N 287 PHE HE2 H N N 288 PHE HZ H N N 289 PHE HXT H N N 290 PRO N N N N 291 PRO CA C N S 292 PRO C C N N 293 PRO O O N N 294 PRO CB C N N 295 PRO CG C N N 296 PRO CD C N N 297 PRO OXT O N N 298 PRO H H N N 299 PRO HA H N N 300 PRO HB2 H N N 301 PRO HB3 H N N 302 PRO HG2 H N N 303 PRO HG3 H N N 304 PRO HD2 H N N 305 PRO HD3 H N N 306 PRO HXT H N N 307 SER N N N N 308 SER CA C N S 309 SER C C N N 310 SER O O N N 311 SER CB C N N 312 SER OG O N N 313 SER OXT O N N 314 SER H H N N 315 SER H2 H N N 316 SER HA H N N 317 SER HB2 H N N 318 SER HB3 H N N 319 SER HG H N N 320 SER HXT H N N 321 THR N N N N 322 THR CA C N S 323 THR C C N N 324 THR O O N N 325 THR CB C N R 326 THR OG1 O N N 327 THR CG2 C N N 328 THR OXT O N N 329 THR H H N N 330 THR H2 H N N 331 THR HA H N N 332 THR HB H N N 333 THR HG1 H N N 334 THR HG21 H N N 335 THR HG22 H N N 336 THR HG23 H N N 337 THR HXT H N N 338 TRP N N N N 339 TRP CA C N S 340 TRP C C N N 341 TRP O O N N 342 TRP CB C N N 343 TRP CG C Y N 344 TRP CD1 C Y N 345 TRP CD2 C Y N 346 TRP NE1 N Y N 347 TRP CE2 C Y N 348 TRP CE3 C Y N 349 TRP CZ2 C Y N 350 TRP CZ3 C Y N 351 TRP CH2 C Y N 352 TRP OXT O N N 353 TRP H H N N 354 TRP H2 H N N 355 TRP HA H N N 356 TRP HB2 H N N 357 TRP HB3 H N N 358 TRP HD1 H N N 359 TRP HE1 H N N 360 TRP HE3 H N N 361 TRP HZ2 H N N 362 TRP HZ3 H N N 363 TRP HH2 H N N 364 TRP HXT H N N 365 TYR N N N N 366 TYR CA C N S 367 TYR C C N N 368 TYR O O N N 369 TYR CB C N N 370 TYR CG C Y N 371 TYR CD1 C Y N 372 TYR CD2 C Y N 373 TYR CE1 C Y N 374 TYR CE2 C Y N 375 TYR CZ C Y N 376 TYR OH O N N 377 TYR OXT O N N 378 TYR H H N N 379 TYR H2 H N N 380 TYR HA H N N 381 TYR HB2 H N N 382 TYR HB3 H N N 383 TYR HD1 H N N 384 TYR HD2 H N N 385 TYR HE1 H N N 386 TYR HE2 H N N 387 TYR HH H N N 388 TYR HXT H N N 389 U OP3 O N N 390 U P P N N 391 U OP1 O N N 392 U OP2 O N N 393 U "O5'" O N N 394 U "C5'" C N N 395 U "C4'" C N R 396 U "O4'" O N N 397 U "C3'" C N S 398 U "O3'" O N N 399 U "C2'" C N R 400 U "O2'" O N N 401 U "C1'" C N R 402 U N1 N N N 403 U C2 C N N 404 U O2 O N N 405 U N3 N N N 406 U C4 C N N 407 U O4 O N N 408 U C5 C N N 409 U C6 C N N 410 U HOP3 H N N 411 U HOP2 H N N 412 U "H5'" H N N 413 U "H5''" H N N 414 U "H4'" H N N 415 U "H3'" H N N 416 U "HO3'" H N N 417 U "H2'" H N N 418 U "HO2'" H N N 419 U "H1'" H N N 420 U H3 H N N 421 U H5 H N N 422 U H6 H N N 423 VAL N N N N 424 VAL CA C N S 425 VAL C C N N 426 VAL O O N N 427 VAL CB C N N 428 VAL CG1 C N N 429 VAL CG2 C N N 430 VAL OXT O N N 431 VAL H H N N 432 VAL H2 H N N 433 VAL HA H N N 434 VAL HB H N N 435 VAL HG11 H N N 436 VAL HG12 H N N 437 VAL HG13 H N N 438 VAL HG21 H N N 439 VAL HG22 H N N 440 VAL HG23 H N N 441 VAL HXT H N N 442 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 C OP3 P sing N N 70 C OP3 HOP3 sing N N 71 C P OP1 doub N N 72 C P OP2 sing N N 73 C P "O5'" sing N N 74 C OP2 HOP2 sing N N 75 C "O5'" "C5'" sing N N 76 C "C5'" "C4'" sing N N 77 C "C5'" "H5'" sing N N 78 C "C5'" "H5''" sing N N 79 C "C4'" "O4'" sing N N 80 C "C4'" "C3'" sing N N 81 C "C4'" "H4'" sing N N 82 C "O4'" "C1'" sing N N 83 C "C3'" "O3'" sing N N 84 C "C3'" "C2'" sing N N 85 C "C3'" "H3'" sing N N 86 C "O3'" "HO3'" sing N N 87 C "C2'" "O2'" sing N N 88 C "C2'" "C1'" sing N N 89 C "C2'" "H2'" sing N N 90 C "O2'" "HO2'" sing N N 91 C "C1'" N1 sing N N 92 C "C1'" "H1'" sing N N 93 C N1 C2 sing N N 94 C N1 C6 sing N N 95 C C2 O2 doub N N 96 C C2 N3 sing N N 97 C N3 C4 doub N N 98 C C4 N4 sing N N 99 C C4 C5 sing N N 100 C N4 H41 sing N N 101 C N4 H42 sing N N 102 C C5 C6 doub N N 103 C C5 H5 sing N N 104 C C6 H6 sing N N 105 GLN N CA sing N N 106 GLN N H sing N N 107 GLN N H2 sing N N 108 GLN CA C sing N N 109 GLN CA CB sing N N 110 GLN CA HA sing N N 111 GLN C O doub N N 112 GLN C OXT sing N N 113 GLN CB CG sing N N 114 GLN CB HB2 sing N N 115 GLN CB HB3 sing N N 116 GLN CG CD sing N N 117 GLN CG HG2 sing N N 118 GLN CG HG3 sing N N 119 GLN CD OE1 doub N N 120 GLN CD NE2 sing N N 121 GLN NE2 HE21 sing N N 122 GLN NE2 HE22 sing N N 123 GLN OXT HXT sing N N 124 GLU N CA sing N N 125 GLU N H sing N N 126 GLU N H2 sing N N 127 GLU CA C sing N N 128 GLU CA CB sing N N 129 GLU CA HA sing N N 130 GLU C O doub N N 131 GLU C OXT sing N N 132 GLU CB CG sing N N 133 GLU CB HB2 sing N N 134 GLU CB HB3 sing N N 135 GLU CG CD sing N N 136 GLU CG HG2 sing N N 137 GLU CG HG3 sing N N 138 GLU CD OE1 doub N N 139 GLU CD OE2 sing N N 140 GLU OE2 HE2 sing N N 141 GLU OXT HXT sing N N 142 GLY N CA sing N N 143 GLY N H sing N N 144 GLY N H2 sing N N 145 GLY CA C sing N N 146 GLY CA HA2 sing N N 147 GLY CA HA3 sing N N 148 GLY C O doub N N 149 GLY C OXT sing N N 150 GLY OXT HXT sing N N 151 HIS N CA sing N N 152 HIS N H sing N N 153 HIS N H2 sing N N 154 HIS CA C sing N N 155 HIS CA CB sing N N 156 HIS CA HA sing N N 157 HIS C O doub N N 158 HIS C OXT sing N N 159 HIS CB CG sing N N 160 HIS CB HB2 sing N N 161 HIS CB HB3 sing N N 162 HIS CG ND1 sing Y N 163 HIS CG CD2 doub Y N 164 HIS ND1 CE1 doub Y N 165 HIS ND1 HD1 sing N N 166 HIS CD2 NE2 sing Y N 167 HIS CD2 HD2 sing N N 168 HIS CE1 NE2 sing Y N 169 HIS CE1 HE1 sing N N 170 HIS NE2 HE2 sing N N 171 HIS OXT HXT sing N N 172 ILE N CA sing N N 173 ILE N H sing N N 174 ILE N H2 sing N N 175 ILE CA C sing N N 176 ILE CA CB sing N N 177 ILE CA HA sing N N 178 ILE C O doub N N 179 ILE C OXT sing N N 180 ILE CB CG1 sing N N 181 ILE CB CG2 sing N N 182 ILE CB HB sing N N 183 ILE CG1 CD1 sing N N 184 ILE CG1 HG12 sing N N 185 ILE CG1 HG13 sing N N 186 ILE CG2 HG21 sing N N 187 ILE CG2 HG22 sing N N 188 ILE CG2 HG23 sing N N 189 ILE CD1 HD11 sing N N 190 ILE CD1 HD12 sing N N 191 ILE CD1 HD13 sing N N 192 ILE OXT HXT sing N N 193 LEU N CA sing N N 194 LEU N H sing N N 195 LEU N H2 sing N N 196 LEU CA C sing N N 197 LEU CA CB sing N N 198 LEU CA HA sing N N 199 LEU C O doub N N 200 LEU C OXT sing N N 201 LEU CB CG sing N N 202 LEU CB HB2 sing N N 203 LEU CB HB3 sing N N 204 LEU CG CD1 sing N N 205 LEU CG CD2 sing N N 206 LEU CG HG sing N N 207 LEU CD1 HD11 sing N N 208 LEU CD1 HD12 sing N N 209 LEU CD1 HD13 sing N N 210 LEU CD2 HD21 sing N N 211 LEU CD2 HD22 sing N N 212 LEU CD2 HD23 sing N N 213 LEU OXT HXT sing N N 214 LYS N CA sing N N 215 LYS N H sing N N 216 LYS N H2 sing N N 217 LYS CA C sing N N 218 LYS CA CB sing N N 219 LYS CA HA sing N N 220 LYS C O doub N N 221 LYS C OXT sing N N 222 LYS CB CG sing N N 223 LYS CB HB2 sing N N 224 LYS CB HB3 sing N N 225 LYS CG CD sing N N 226 LYS CG HG2 sing N N 227 LYS CG HG3 sing N N 228 LYS CD CE sing N N 229 LYS CD HD2 sing N N 230 LYS CD HD3 sing N N 231 LYS CE NZ sing N N 232 LYS CE HE2 sing N N 233 LYS CE HE3 sing N N 234 LYS NZ HZ1 sing N N 235 LYS NZ HZ2 sing N N 236 LYS NZ HZ3 sing N N 237 LYS OXT HXT sing N N 238 MET N CA sing N N 239 MET N H sing N N 240 MET N H2 sing N N 241 MET CA C sing N N 242 MET CA CB sing N N 243 MET CA HA sing N N 244 MET C O doub N N 245 MET C OXT sing N N 246 MET CB CG sing N N 247 MET CB HB2 sing N N 248 MET CB HB3 sing N N 249 MET CG SD sing N N 250 MET CG HG2 sing N N 251 MET CG HG3 sing N N 252 MET SD CE sing N N 253 MET CE HE1 sing N N 254 MET CE HE2 sing N N 255 MET CE HE3 sing N N 256 MET OXT HXT sing N N 257 PHE N CA sing N N 258 PHE N H sing N N 259 PHE N H2 sing N N 260 PHE CA C sing N N 261 PHE CA CB sing N N 262 PHE CA HA sing N N 263 PHE C O doub N N 264 PHE C OXT sing N N 265 PHE CB CG sing N N 266 PHE CB HB2 sing N N 267 PHE CB HB3 sing N N 268 PHE CG CD1 doub Y N 269 PHE CG CD2 sing Y N 270 PHE CD1 CE1 sing Y N 271 PHE CD1 HD1 sing N N 272 PHE CD2 CE2 doub Y N 273 PHE CD2 HD2 sing N N 274 PHE CE1 CZ doub Y N 275 PHE CE1 HE1 sing N N 276 PHE CE2 CZ sing Y N 277 PHE CE2 HE2 sing N N 278 PHE CZ HZ sing N N 279 PHE OXT HXT sing N N 280 PRO N CA sing N N 281 PRO N CD sing N N 282 PRO N H sing N N 283 PRO CA C sing N N 284 PRO CA CB sing N N 285 PRO CA HA sing N N 286 PRO C O doub N N 287 PRO C OXT sing N N 288 PRO CB CG sing N N 289 PRO CB HB2 sing N N 290 PRO CB HB3 sing N N 291 PRO CG CD sing N N 292 PRO CG HG2 sing N N 293 PRO CG HG3 sing N N 294 PRO CD HD2 sing N N 295 PRO CD HD3 sing N N 296 PRO OXT HXT sing N N 297 SER N CA sing N N 298 SER N H sing N N 299 SER N H2 sing N N 300 SER CA C sing N N 301 SER CA CB sing N N 302 SER CA HA sing N N 303 SER C O doub N N 304 SER C OXT sing N N 305 SER CB OG sing N N 306 SER CB HB2 sing N N 307 SER CB HB3 sing N N 308 SER OG HG sing N N 309 SER OXT HXT sing N N 310 THR N CA sing N N 311 THR N H sing N N 312 THR N H2 sing N N 313 THR CA C sing N N 314 THR CA CB sing N N 315 THR CA HA sing N N 316 THR C O doub N N 317 THR C OXT sing N N 318 THR CB OG1 sing N N 319 THR CB CG2 sing N N 320 THR CB HB sing N N 321 THR OG1 HG1 sing N N 322 THR CG2 HG21 sing N N 323 THR CG2 HG22 sing N N 324 THR CG2 HG23 sing N N 325 THR OXT HXT sing N N 326 TRP N CA sing N N 327 TRP N H sing N N 328 TRP N H2 sing N N 329 TRP CA C sing N N 330 TRP CA CB sing N N 331 TRP CA HA sing N N 332 TRP C O doub N N 333 TRP C OXT sing N N 334 TRP CB CG sing N N 335 TRP CB HB2 sing N N 336 TRP CB HB3 sing N N 337 TRP CG CD1 doub Y N 338 TRP CG CD2 sing Y N 339 TRP CD1 NE1 sing Y N 340 TRP CD1 HD1 sing N N 341 TRP CD2 CE2 doub Y N 342 TRP CD2 CE3 sing Y N 343 TRP NE1 CE2 sing Y N 344 TRP NE1 HE1 sing N N 345 TRP CE2 CZ2 sing Y N 346 TRP CE3 CZ3 doub Y N 347 TRP CE3 HE3 sing N N 348 TRP CZ2 CH2 doub Y N 349 TRP CZ2 HZ2 sing N N 350 TRP CZ3 CH2 sing Y N 351 TRP CZ3 HZ3 sing N N 352 TRP CH2 HH2 sing N N 353 TRP OXT HXT sing N N 354 TYR N CA sing N N 355 TYR N H sing N N 356 TYR N H2 sing N N 357 TYR CA C sing N N 358 TYR CA CB sing N N 359 TYR CA HA sing N N 360 TYR C O doub N N 361 TYR C OXT sing N N 362 TYR CB CG sing N N 363 TYR CB HB2 sing N N 364 TYR CB HB3 sing N N 365 TYR CG CD1 doub Y N 366 TYR CG CD2 sing Y N 367 TYR CD1 CE1 sing Y N 368 TYR CD1 HD1 sing N N 369 TYR CD2 CE2 doub Y N 370 TYR CD2 HD2 sing N N 371 TYR CE1 CZ doub Y N 372 TYR CE1 HE1 sing N N 373 TYR CE2 CZ sing Y N 374 TYR CE2 HE2 sing N N 375 TYR CZ OH sing N N 376 TYR OH HH sing N N 377 TYR OXT HXT sing N N 378 U OP3 P sing N N 379 U OP3 HOP3 sing N N 380 U P OP1 doub N N 381 U P OP2 sing N N 382 U P "O5'" sing N N 383 U OP2 HOP2 sing N N 384 U "O5'" "C5'" sing N N 385 U "C5'" "C4'" sing N N 386 U "C5'" "H5'" sing N N 387 U "C5'" "H5''" sing N N 388 U "C4'" "O4'" sing N N 389 U "C4'" "C3'" sing N N 390 U "C4'" "H4'" sing N N 391 U "O4'" "C1'" sing N N 392 U "C3'" "O3'" sing N N 393 U "C3'" "C2'" sing N N 394 U "C3'" "H3'" sing N N 395 U "O3'" "HO3'" sing N N 396 U "C2'" "O2'" sing N N 397 U "C2'" "C1'" sing N N 398 U "C2'" "H2'" sing N N 399 U "O2'" "HO2'" sing N N 400 U "C1'" N1 sing N N 401 U "C1'" "H1'" sing N N 402 U N1 C2 sing N N 403 U N1 C6 sing N N 404 U C2 O2 doub N N 405 U C2 N3 sing N N 406 U N3 C4 sing N N 407 U N3 H3 sing N N 408 U C4 O4 doub N N 409 U C4 C5 sing N N 410 U C5 C6 doub N N 411 U C5 H5 sing N N 412 U C6 H6 sing N N 413 VAL N CA sing N N 414 VAL N H sing N N 415 VAL N H2 sing N N 416 VAL CA C sing N N 417 VAL CA CB sing N N 418 VAL CA HA sing N N 419 VAL C O doub N N 420 VAL C OXT sing N N 421 VAL CB CG1 sing N N 422 VAL CB CG2 sing N N 423 VAL CB HB sing N N 424 VAL CG1 HG11 sing N N 425 VAL CG1 HG12 sing N N 426 VAL CG1 HG13 sing N N 427 VAL CG2 HG21 sing N N 428 VAL CG2 HG22 sing N N 429 VAL CG2 HG23 sing N N 430 VAL OXT HXT sing N N 431 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3BS9 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5O3J _atom_sites.fract_transf_matrix[1][1] 0.022568 _atom_sites.fract_transf_matrix[1][2] 0.013030 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026060 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011666 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_