data_5OBR # _entry.id 5OBR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5OBR WWPDB D_1200005548 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5OBR _pdbx_database_status.recvd_initial_deposition_date 2017-06-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rossmann, M.' 1 0000-0001-8811-3277 'Janecek, M.' 2 ? 'Hyvonen, M.' 3 0000-0001-8683-4070 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? UK ? ? primary 'Chem. Commun. (Camb.)' ? ? 1364-548X ? ? 53 ? 9372 9375 'Computationally-guided optimization of small-molecule inhibitors of the Aurora A kinase-TPX2 protein-protein interaction.' 2017 ? 10.1039/c7cc05379g 28787041 ? ? ? ? ? ? ? ? UK ? ? 1 'Sci Rep' ? ? 2045-2322 ? ? 6 ? 28528 ? 'Allosteric modulation of AURKA kinase activity by a small-molecule inhibitor of its protein-protein interaction with TPX2.' 2016 ? 10.1038/srep28528 27339427 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Cole, D.J.' 1 primary 'Janecek, M.' 2 primary 'Stokes, J.E.' 3 primary 'Rossmann, M.' 4 primary 'Faver, J.C.' 5 primary 'McKenzie, G.J.' 6 primary 'Venkitaraman, A.R.' 7 primary 'Hyvonen, M.' 8 primary 'Spring, D.R.' 9 primary 'Huggins, D.J.' 10 primary 'Jorgensen, W.L.' 11 1 'Janecek, M.' 12 1 'Rossmann, M.' 13 1 'Sharma, P.' 14 1 'Emery, A.' 15 1 'Huggins, D.J.' 16 1 'Stockwell, S.R.' 17 1 'Stokes, J.E.' 18 1 'Tan, Y.S.' 19 1 'Almeida, E.G.' 20 1 'Hardwick, B.' 21 1 'Narvaez, A.J.' 22 1 'Hyvonen, M.' 23 1 'Spring, D.R.' 24 1 'McKenzie, G.J.' 25 1 'Venkitaraman, A.R.' 26 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5OBR _cell.details ? _cell.formula_units_Z ? _cell.length_a 83.700 _cell.length_a_esd ? _cell.length_b 83.700 _cell.length_b_esd ? _cell.length_c 169.700 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5OBR _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Aurora kinase A' 31456.150 1 2.7.11.1 ? ? ? 2 non-polymer syn '2-(3-chloranyl-5-fluoranyl-phenyl)quinoline-4-carboxylic acid' 301.700 1 ? ? ? ? 3 non-polymer syn '4-({5-amino-1-[(2,6-difluorophenyl)carbonyl]-1H-1,2,4-triazol-3-yl}amino)benzenesulfonamide' 394.356 1 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 5 water nat water 18.015 15 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Aurora 2,Aurora/IPL1-related kinase 1,hARK1,Breast tumor-amplified kinase,Serine/threonine-protein kinase 15,Serine/threonine-protein kinase 6,Serine/threonine-protein kinase aurora-A ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMGSKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGY FHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSV HAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDL ISRLLKHNPSQRPMLREVLEHPWITANSSKPS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMGSKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGY FHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSV HAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDL ISRLLKHNPSQRPMLREVLEHPWITANSSKPS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 GLY n 1 5 SER n 1 6 LYS n 1 7 ARG n 1 8 GLN n 1 9 TRP n 1 10 ALA n 1 11 LEU n 1 12 GLU n 1 13 ASP n 1 14 PHE n 1 15 GLU n 1 16 ILE n 1 17 GLY n 1 18 ARG n 1 19 PRO n 1 20 LEU n 1 21 GLY n 1 22 LYS n 1 23 GLY n 1 24 LYS n 1 25 PHE n 1 26 GLY n 1 27 ASN n 1 28 VAL n 1 29 TYR n 1 30 LEU n 1 31 ALA n 1 32 ARG n 1 33 GLU n 1 34 LYS n 1 35 GLN n 1 36 SER n 1 37 LYS n 1 38 PHE n 1 39 ILE n 1 40 LEU n 1 41 ALA n 1 42 LEU n 1 43 LYS n 1 44 VAL n 1 45 LEU n 1 46 PHE n 1 47 LYS n 1 48 ALA n 1 49 GLN n 1 50 LEU n 1 51 GLU n 1 52 LYS n 1 53 ALA n 1 54 GLY n 1 55 VAL n 1 56 GLU n 1 57 HIS n 1 58 GLN n 1 59 LEU n 1 60 ARG n 1 61 ARG n 1 62 GLU n 1 63 VAL n 1 64 GLU n 1 65 ILE n 1 66 GLN n 1 67 SER n 1 68 HIS n 1 69 LEU n 1 70 ARG n 1 71 HIS n 1 72 PRO n 1 73 ASN n 1 74 ILE n 1 75 LEU n 1 76 ARG n 1 77 LEU n 1 78 TYR n 1 79 GLY n 1 80 TYR n 1 81 PHE n 1 82 HIS n 1 83 ASP n 1 84 ALA n 1 85 THR n 1 86 ARG n 1 87 VAL n 1 88 TYR n 1 89 LEU n 1 90 ILE n 1 91 LEU n 1 92 GLU n 1 93 TYR n 1 94 ALA n 1 95 PRO n 1 96 LEU n 1 97 GLY n 1 98 THR n 1 99 VAL n 1 100 TYR n 1 101 ARG n 1 102 GLU n 1 103 LEU n 1 104 GLN n 1 105 LYS n 1 106 LEU n 1 107 SER n 1 108 LYS n 1 109 PHE n 1 110 ASP n 1 111 GLU n 1 112 GLN n 1 113 ARG n 1 114 THR n 1 115 ALA n 1 116 THR n 1 117 TYR n 1 118 ILE n 1 119 THR n 1 120 GLU n 1 121 LEU n 1 122 ALA n 1 123 ASN n 1 124 ALA n 1 125 LEU n 1 126 SER n 1 127 TYR n 1 128 CYS n 1 129 HIS n 1 130 SER n 1 131 LYS n 1 132 ARG n 1 133 VAL n 1 134 ILE n 1 135 HIS n 1 136 ARG n 1 137 ASP n 1 138 ILE n 1 139 LYS n 1 140 PRO n 1 141 GLU n 1 142 ASN n 1 143 LEU n 1 144 LEU n 1 145 LEU n 1 146 GLY n 1 147 SER n 1 148 ALA n 1 149 GLY n 1 150 GLU n 1 151 LEU n 1 152 LYS n 1 153 ILE n 1 154 ALA n 1 155 ASP n 1 156 PHE n 1 157 GLY n 1 158 TRP n 1 159 SER n 1 160 VAL n 1 161 HIS n 1 162 ALA n 1 163 PRO n 1 164 SER n 1 165 SER n 1 166 ARG n 1 167 ARG n 1 168 THR n 1 169 THR n 1 170 LEU n 1 171 CYS n 1 172 GLY n 1 173 THR n 1 174 LEU n 1 175 ASP n 1 176 TYR n 1 177 LEU n 1 178 PRO n 1 179 PRO n 1 180 GLU n 1 181 MET n 1 182 ILE n 1 183 GLU n 1 184 GLY n 1 185 ARG n 1 186 MET n 1 187 HIS n 1 188 ASP n 1 189 GLU n 1 190 LYS n 1 191 VAL n 1 192 ASP n 1 193 LEU n 1 194 TRP n 1 195 SER n 1 196 LEU n 1 197 GLY n 1 198 VAL n 1 199 LEU n 1 200 CYS n 1 201 TYR n 1 202 GLU n 1 203 PHE n 1 204 LEU n 1 205 VAL n 1 206 GLY n 1 207 LYS n 1 208 PRO n 1 209 PRO n 1 210 PHE n 1 211 GLU n 1 212 ALA n 1 213 ASN n 1 214 THR n 1 215 TYR n 1 216 GLN n 1 217 GLU n 1 218 THR n 1 219 TYR n 1 220 LYS n 1 221 ARG n 1 222 ILE n 1 223 SER n 1 224 ARG n 1 225 VAL n 1 226 GLU n 1 227 PHE n 1 228 THR n 1 229 PHE n 1 230 PRO n 1 231 ASP n 1 232 PHE n 1 233 VAL n 1 234 THR n 1 235 GLU n 1 236 GLY n 1 237 ALA n 1 238 ARG n 1 239 ASP n 1 240 LEU n 1 241 ILE n 1 242 SER n 1 243 ARG n 1 244 LEU n 1 245 LEU n 1 246 LYS n 1 247 HIS n 1 248 ASN n 1 249 PRO n 1 250 SER n 1 251 GLN n 1 252 ARG n 1 253 PRO n 1 254 MET n 1 255 LEU n 1 256 ARG n 1 257 GLU n 1 258 VAL n 1 259 LEU n 1 260 GLU n 1 261 HIS n 1 262 PRO n 1 263 TRP n 1 264 ILE n 1 265 THR n 1 266 ALA n 1 267 ASN n 1 268 SER n 1 269 SER n 1 270 LYS n 1 271 PRO n 1 272 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 272 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant pUBS520 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pHAT4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AURKA_HUMAN _struct_ref.pdbx_db_accession O14965 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDAT RVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSS RRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLL KHNPSQRPMLREVLEHPWITANSSKPS ; _struct_ref.pdbx_align_begin 125 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5OBR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 272 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14965 _struct_ref_seq.db_align_beg 125 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 391 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 125 _struct_ref_seq.pdbx_auth_seq_align_end 391 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5OBR GLY A 1 ? UNP O14965 ? ? 'expression tag' 120 1 1 5OBR SER A 2 ? UNP O14965 ? ? 'expression tag' 121 2 1 5OBR MET A 3 ? UNP O14965 ? ? 'expression tag' 122 3 1 5OBR GLY A 4 ? UNP O14965 ? ? 'expression tag' 123 4 1 5OBR SER A 5 ? UNP O14965 ? ? 'expression tag' 124 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 9QT non-polymer . '2-(3-chloranyl-5-fluoranyl-phenyl)quinoline-4-carboxylic acid' ? 'C16 H9 Cl F N O2' 301.700 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SKE non-polymer . '4-({5-amino-1-[(2,6-difluorophenyl)carbonyl]-1H-1,2,4-triazol-3-yl}amino)benzenesulfonamide' ? 'C15 H12 F2 N6 O3 S' 394.356 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5OBR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.73 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.90 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '50 MM HEPES, 200 MM MAGNESIUM SULFATE, 20% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 300K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-04-04 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 1' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5OBR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.62 _reflns.d_resolution_low 41.85 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11215 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I 2 _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.2 _reflns.pdbx_Rmerge_I_obs 0.046 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 26.20 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.0 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.62 _reflns_shell.d_res_low 2.77 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1735 _reflns_shell.percent_possible_all 99.1 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.606 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.85 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5OBR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.620 _refine.ls_d_res_low 41.850 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11175 _refine.ls_number_reflns_R_free 534 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.83 _refine.ls_percent_reflns_R_free 4.78 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2260 _refine.ls_R_factor_R_free 0.2919 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2227 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.15 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.39 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2063 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 49 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 2127 _refine_hist.d_res_high 2.620 _refine_hist.d_res_low 41.850 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 2165 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.174 ? 2935 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 7.950 ? 1310 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.058 ? 312 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 419 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.6202 2.8838 . . 122 2578 100.00 . . . 0.3654 . 0.2917 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8838 3.3009 . . 141 2591 100.00 . . . 0.3454 . 0.2761 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3009 4.1582 . . 120 2661 100.00 . . . 0.3242 . 0.2147 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.1582 41.8553 . . 151 2811 100.00 . . . 0.2501 . 0.2018 . . . . . . . . . . # _struct.entry_id 5OBR _struct.title 'Aurora A kinase in complex with 2-(3-chloro-5-fluorophenyl)quinoline-4-carboxylic acid and JNJ-7706621' _struct.pdbx_descriptor 'Aurora kinase A (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5OBR _struct_keywords.text 'inhibitor, kinase, allostery, protein-protein interface, CELL CYCLE' _struct_keywords.pdbx_keywords 'CELL CYCLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 10 ? GLU A 12 ? ALA A 129 GLU A 131 5 ? 3 HELX_P HELX_P2 AA2 LYS A 47 ? GLY A 54 ? LYS A 166 GLY A 173 1 ? 8 HELX_P HELX_P3 AA3 VAL A 55 ? SER A 67 ? VAL A 174 SER A 186 1 ? 13 HELX_P HELX_P4 AA4 THR A 98 ? SER A 107 ? THR A 217 SER A 226 1 ? 10 HELX_P HELX_P5 AA5 ASP A 110 ? LYS A 131 ? ASP A 229 LYS A 250 1 ? 22 HELX_P HELX_P6 AA6 LYS A 139 ? GLU A 141 ? LYS A 258 GLU A 260 5 ? 3 HELX_P HELX_P7 AA7 PRO A 178 ? GLY A 184 ? PRO A 297 GLY A 303 1 ? 7 HELX_P HELX_P8 AA8 LYS A 190 ? GLY A 206 ? LYS A 309 GLY A 325 1 ? 17 HELX_P HELX_P9 AA9 THR A 214 ? VAL A 225 ? THR A 333 VAL A 344 1 ? 12 HELX_P HELX_P10 AB1 THR A 234 ? LEU A 245 ? THR A 353 LEU A 364 1 ? 12 HELX_P HELX_P11 AB2 ASN A 248 ? ARG A 252 ? ASN A 367 ARG A 371 5 ? 5 HELX_P HELX_P12 AB3 MET A 254 ? GLU A 260 ? MET A 373 GLU A 379 1 ? 7 HELX_P HELX_P13 AB4 HIS A 261 ? SER A 268 ? HIS A 380 SER A 387 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 14 ? LYS A 22 ? PHE A 133 LYS A 141 AA1 2 ASN A 27 ? GLU A 33 ? ASN A 146 GLU A 152 AA1 3 ILE A 39 ? PHE A 46 ? ILE A 158 PHE A 165 AA1 4 ARG A 86 ? LEU A 91 ? ARG A 205 LEU A 210 AA1 5 LEU A 77 ? HIS A 82 ? LEU A 196 HIS A 201 AA2 1 LEU A 143 ? LEU A 145 ? LEU A 262 LEU A 264 AA2 2 LEU A 151 ? ILE A 153 ? LEU A 270 ILE A 272 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 17 ? N GLY A 136 O LEU A 30 ? O LEU A 149 AA1 2 3 N ASN A 27 ? N ASN A 146 O VAL A 44 ? O VAL A 163 AA1 3 4 N LEU A 45 ? N LEU A 164 O VAL A 87 ? O VAL A 206 AA1 4 5 O ILE A 90 ? O ILE A 209 N TYR A 78 ? N TYR A 197 AA2 1 2 N LEU A 144 ? N LEU A 263 O LYS A 152 ? O LYS A 271 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A 9QT 401 ? 10 'binding site for residue 9QT A 401' AC2 Software A SKE 402 ? 10 'binding site for residue SKE A 402' AC3 Software A MG 403 ? 2 'binding site for residue MG A 403' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 LYS A 47 ? LYS A 166 . ? 1_555 ? 2 AC1 10 GLU A 56 ? GLU A 175 . ? 1_555 ? 3 AC1 10 LEU A 59 ? LEU A 178 . ? 1_555 ? 4 AC1 10 ARG A 60 ? ARG A 179 . ? 1_555 ? 5 AC1 10 VAL A 63 ? VAL A 182 . ? 1_555 ? 6 AC1 10 TYR A 80 ? TYR A 199 . ? 1_555 ? 7 AC1 10 HIS A 82 ? HIS A 201 . ? 1_555 ? 8 AC1 10 VAL A 87 ? VAL A 206 . ? 1_555 ? 9 AC1 10 MG D . ? MG A 403 . ? 10_554 ? 10 AC1 10 MG D . ? MG A 403 . ? 1_555 ? 11 AC2 10 ARG A 18 ? ARG A 137 . ? 1_555 ? 12 AC2 10 LEU A 20 ? LEU A 139 . ? 1_555 ? 13 AC2 10 VAL A 28 ? VAL A 147 . ? 1_555 ? 14 AC2 10 ALA A 41 ? ALA A 160 . ? 1_555 ? 15 AC2 10 LEU A 75 ? LEU A 194 . ? 1_555 ? 16 AC2 10 GLU A 92 ? GLU A 211 . ? 1_555 ? 17 AC2 10 ALA A 94 ? ALA A 213 . ? 1_555 ? 18 AC2 10 GLY A 97 ? GLY A 216 . ? 1_555 ? 19 AC2 10 GLU A 141 ? GLU A 260 . ? 1_555 ? 20 AC2 10 LEU A 144 ? LEU A 263 . ? 1_555 ? 21 AC3 2 9QT B . ? 9QT A 401 . ? 1_555 ? 22 AC3 2 9QT B . ? 9QT A 401 . ? 10_554 ? # _atom_sites.entry_id 5OBR _atom_sites.fract_transf_matrix[1][1] 0.011947 _atom_sites.fract_transf_matrix[1][2] 0.006898 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013796 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005893 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL F MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 120 ? ? ? A . n A 1 2 SER 2 121 ? ? ? A . n A 1 3 MET 3 122 ? ? ? A . n A 1 4 GLY 4 123 ? ? ? A . n A 1 5 SER 5 124 ? ? ? A . n A 1 6 LYS 6 125 ? ? ? A . n A 1 7 ARG 7 126 126 ARG ARG A . n A 1 8 GLN 8 127 127 GLN GLN A . n A 1 9 TRP 9 128 128 TRP TRP A . n A 1 10 ALA 10 129 129 ALA ALA A . n A 1 11 LEU 11 130 130 LEU LEU A . n A 1 12 GLU 12 131 131 GLU GLU A . n A 1 13 ASP 13 132 132 ASP ASP A . n A 1 14 PHE 14 133 133 PHE PHE A . n A 1 15 GLU 15 134 134 GLU GLU A . n A 1 16 ILE 16 135 135 ILE ILE A . n A 1 17 GLY 17 136 136 GLY GLY A . n A 1 18 ARG 18 137 137 ARG ARG A . n A 1 19 PRO 19 138 138 PRO PRO A . n A 1 20 LEU 20 139 139 LEU LEU A . n A 1 21 GLY 21 140 140 GLY GLY A . n A 1 22 LYS 22 141 141 LYS LYS A . n A 1 23 GLY 23 142 142 GLY GLY A . n A 1 24 LYS 24 143 143 LYS LYS A . n A 1 25 PHE 25 144 144 PHE PHE A . n A 1 26 GLY 26 145 145 GLY GLY A . n A 1 27 ASN 27 146 146 ASN ASN A . n A 1 28 VAL 28 147 147 VAL VAL A . n A 1 29 TYR 29 148 148 TYR TYR A . n A 1 30 LEU 30 149 149 LEU LEU A . n A 1 31 ALA 31 150 150 ALA ALA A . n A 1 32 ARG 32 151 151 ARG ARG A . n A 1 33 GLU 33 152 152 GLU GLU A . n A 1 34 LYS 34 153 153 LYS LYS A . n A 1 35 GLN 35 154 154 GLN GLN A . n A 1 36 SER 36 155 155 SER SER A . n A 1 37 LYS 37 156 156 LYS LYS A . n A 1 38 PHE 38 157 157 PHE PHE A . n A 1 39 ILE 39 158 158 ILE ILE A . n A 1 40 LEU 40 159 159 LEU LEU A . n A 1 41 ALA 41 160 160 ALA ALA A . n A 1 42 LEU 42 161 161 LEU LEU A . n A 1 43 LYS 43 162 162 LYS LYS A . n A 1 44 VAL 44 163 163 VAL VAL A . n A 1 45 LEU 45 164 164 LEU LEU A . n A 1 46 PHE 46 165 165 PHE PHE A . n A 1 47 LYS 47 166 166 LYS LYS A . n A 1 48 ALA 48 167 167 ALA ALA A . n A 1 49 GLN 49 168 168 GLN GLN A . n A 1 50 LEU 50 169 169 LEU LEU A . n A 1 51 GLU 51 170 170 GLU GLU A . n A 1 52 LYS 52 171 171 LYS LYS A . n A 1 53 ALA 53 172 172 ALA ALA A . n A 1 54 GLY 54 173 173 GLY GLY A . n A 1 55 VAL 55 174 174 VAL VAL A . n A 1 56 GLU 56 175 175 GLU GLU A . n A 1 57 HIS 57 176 176 HIS HIS A . n A 1 58 GLN 58 177 177 GLN GLN A . n A 1 59 LEU 59 178 178 LEU LEU A . n A 1 60 ARG 60 179 179 ARG ARG A . n A 1 61 ARG 61 180 180 ARG ARG A . n A 1 62 GLU 62 181 181 GLU GLU A . n A 1 63 VAL 63 182 182 VAL VAL A . n A 1 64 GLU 64 183 183 GLU GLU A . n A 1 65 ILE 65 184 184 ILE ILE A . n A 1 66 GLN 66 185 185 GLN GLN A . n A 1 67 SER 67 186 186 SER SER A . n A 1 68 HIS 68 187 187 HIS HIS A . n A 1 69 LEU 69 188 188 LEU LEU A . n A 1 70 ARG 70 189 189 ARG ARG A . n A 1 71 HIS 71 190 190 HIS HIS A . n A 1 72 PRO 72 191 191 PRO PRO A . n A 1 73 ASN 73 192 192 ASN ASN A . n A 1 74 ILE 74 193 193 ILE ILE A . n A 1 75 LEU 75 194 194 LEU LEU A . n A 1 76 ARG 76 195 195 ARG ARG A . n A 1 77 LEU 77 196 196 LEU LEU A . n A 1 78 TYR 78 197 197 TYR TYR A . n A 1 79 GLY 79 198 198 GLY GLY A . n A 1 80 TYR 80 199 199 TYR TYR A . n A 1 81 PHE 81 200 200 PHE PHE A . n A 1 82 HIS 82 201 201 HIS HIS A . n A 1 83 ASP 83 202 202 ASP ASP A . n A 1 84 ALA 84 203 203 ALA ALA A . n A 1 85 THR 85 204 204 THR THR A . n A 1 86 ARG 86 205 205 ARG ARG A . n A 1 87 VAL 87 206 206 VAL VAL A . n A 1 88 TYR 88 207 207 TYR TYR A . n A 1 89 LEU 89 208 208 LEU LEU A . n A 1 90 ILE 90 209 209 ILE ILE A . n A 1 91 LEU 91 210 210 LEU LEU A . n A 1 92 GLU 92 211 211 GLU GLU A . n A 1 93 TYR 93 212 212 TYR TYR A . n A 1 94 ALA 94 213 213 ALA ALA A . n A 1 95 PRO 95 214 214 PRO PRO A . n A 1 96 LEU 96 215 215 LEU LEU A . n A 1 97 GLY 97 216 216 GLY GLY A . n A 1 98 THR 98 217 217 THR THR A . n A 1 99 VAL 99 218 218 VAL VAL A . n A 1 100 TYR 100 219 219 TYR TYR A . n A 1 101 ARG 101 220 220 ARG ARG A . n A 1 102 GLU 102 221 221 GLU GLU A . n A 1 103 LEU 103 222 222 LEU LEU A . n A 1 104 GLN 104 223 223 GLN GLN A . n A 1 105 LYS 105 224 224 LYS LYS A . n A 1 106 LEU 106 225 225 LEU LEU A . n A 1 107 SER 107 226 226 SER SER A . n A 1 108 LYS 108 227 227 LYS LYS A . n A 1 109 PHE 109 228 228 PHE PHE A . n A 1 110 ASP 110 229 229 ASP ASP A . n A 1 111 GLU 111 230 230 GLU GLU A . n A 1 112 GLN 112 231 231 GLN GLN A . n A 1 113 ARG 113 232 232 ARG ARG A . n A 1 114 THR 114 233 233 THR THR A . n A 1 115 ALA 115 234 234 ALA ALA A . n A 1 116 THR 116 235 235 THR THR A . n A 1 117 TYR 117 236 236 TYR TYR A . n A 1 118 ILE 118 237 237 ILE ILE A . n A 1 119 THR 119 238 238 THR THR A . n A 1 120 GLU 120 239 239 GLU GLU A . n A 1 121 LEU 121 240 240 LEU LEU A . n A 1 122 ALA 122 241 241 ALA ALA A . n A 1 123 ASN 123 242 242 ASN ASN A . n A 1 124 ALA 124 243 243 ALA ALA A . n A 1 125 LEU 125 244 244 LEU LEU A . n A 1 126 SER 126 245 245 SER SER A . n A 1 127 TYR 127 246 246 TYR TYR A . n A 1 128 CYS 128 247 247 CYS CYS A . n A 1 129 HIS 129 248 248 HIS HIS A . n A 1 130 SER 130 249 249 SER SER A . n A 1 131 LYS 131 250 250 LYS LYS A . n A 1 132 ARG 132 251 251 ARG ARG A . n A 1 133 VAL 133 252 252 VAL VAL A . n A 1 134 ILE 134 253 253 ILE ILE A . n A 1 135 HIS 135 254 254 HIS HIS A . n A 1 136 ARG 136 255 255 ARG ARG A . n A 1 137 ASP 137 256 256 ASP ASP A . n A 1 138 ILE 138 257 257 ILE ILE A . n A 1 139 LYS 139 258 258 LYS LYS A . n A 1 140 PRO 140 259 259 PRO PRO A . n A 1 141 GLU 141 260 260 GLU GLU A . n A 1 142 ASN 142 261 261 ASN ASN A . n A 1 143 LEU 143 262 262 LEU LEU A . n A 1 144 LEU 144 263 263 LEU LEU A . n A 1 145 LEU 145 264 264 LEU LEU A . n A 1 146 GLY 146 265 265 GLY GLY A . n A 1 147 SER 147 266 266 SER SER A . n A 1 148 ALA 148 267 267 ALA ALA A . n A 1 149 GLY 149 268 268 GLY GLY A . n A 1 150 GLU 150 269 269 GLU GLU A . n A 1 151 LEU 151 270 270 LEU LEU A . n A 1 152 LYS 152 271 271 LYS LYS A . n A 1 153 ILE 153 272 272 ILE ILE A . n A 1 154 ALA 154 273 273 ALA ALA A . n A 1 155 ASP 155 274 274 ASP ASP A . n A 1 156 PHE 156 275 275 PHE PHE A . n A 1 157 GLY 157 276 276 GLY GLY A . n A 1 158 TRP 158 277 277 TRP TRP A . n A 1 159 SER 159 278 278 SER SER A . n A 1 160 VAL 160 279 279 VAL VAL A . n A 1 161 HIS 161 280 280 HIS HIS A . n A 1 162 ALA 162 281 ? ? ? A . n A 1 163 PRO 163 282 ? ? ? A . n A 1 164 SER 164 283 ? ? ? A . n A 1 165 SER 165 284 ? ? ? A . n A 1 166 ARG 166 285 ? ? ? A . n A 1 167 ARG 167 286 ? ? ? A . n A 1 168 THR 168 287 ? ? ? A . n A 1 169 THR 169 288 ? ? ? A . n A 1 170 LEU 170 289 ? ? ? A . n A 1 171 CYS 171 290 ? ? ? A . n A 1 172 GLY 172 291 291 GLY GLY A . n A 1 173 THR 173 292 292 THR THR A . n A 1 174 LEU 174 293 293 LEU LEU A . n A 1 175 ASP 175 294 294 ASP ASP A . n A 1 176 TYR 176 295 295 TYR TYR A . n A 1 177 LEU 177 296 296 LEU LEU A . n A 1 178 PRO 178 297 297 PRO PRO A . n A 1 179 PRO 179 298 298 PRO PRO A . n A 1 180 GLU 180 299 299 GLU GLU A . n A 1 181 MET 181 300 300 MET MET A . n A 1 182 ILE 182 301 301 ILE ILE A . n A 1 183 GLU 183 302 302 GLU GLU A . n A 1 184 GLY 184 303 303 GLY GLY A . n A 1 185 ARG 185 304 304 ARG ARG A . n A 1 186 MET 186 305 305 MET MET A . n A 1 187 HIS 187 306 306 HIS HIS A . n A 1 188 ASP 188 307 307 ASP ASP A . n A 1 189 GLU 189 308 308 GLU GLU A . n A 1 190 LYS 190 309 309 LYS LYS A . n A 1 191 VAL 191 310 310 VAL VAL A . n A 1 192 ASP 192 311 311 ASP ASP A . n A 1 193 LEU 193 312 312 LEU LEU A . n A 1 194 TRP 194 313 313 TRP TRP A . n A 1 195 SER 195 314 314 SER SER A . n A 1 196 LEU 196 315 315 LEU LEU A . n A 1 197 GLY 197 316 316 GLY GLY A . n A 1 198 VAL 198 317 317 VAL VAL A . n A 1 199 LEU 199 318 318 LEU LEU A . n A 1 200 CYS 200 319 319 CYS CYS A . n A 1 201 TYR 201 320 320 TYR TYR A . n A 1 202 GLU 202 321 321 GLU GLU A . n A 1 203 PHE 203 322 322 PHE PHE A . n A 1 204 LEU 204 323 323 LEU LEU A . n A 1 205 VAL 205 324 324 VAL VAL A . n A 1 206 GLY 206 325 325 GLY GLY A . n A 1 207 LYS 207 326 326 LYS LYS A . n A 1 208 PRO 208 327 327 PRO PRO A . n A 1 209 PRO 209 328 328 PRO PRO A . n A 1 210 PHE 210 329 329 PHE PHE A . n A 1 211 GLU 211 330 330 GLU GLU A . n A 1 212 ALA 212 331 331 ALA ALA A . n A 1 213 ASN 213 332 332 ASN ASN A . n A 1 214 THR 214 333 333 THR THR A . n A 1 215 TYR 215 334 334 TYR TYR A . n A 1 216 GLN 216 335 335 GLN GLN A . n A 1 217 GLU 217 336 336 GLU GLU A . n A 1 218 THR 218 337 337 THR THR A . n A 1 219 TYR 219 338 338 TYR TYR A . n A 1 220 LYS 220 339 339 LYS LYS A . n A 1 221 ARG 221 340 340 ARG ARG A . n A 1 222 ILE 222 341 341 ILE ILE A . n A 1 223 SER 223 342 342 SER SER A . n A 1 224 ARG 224 343 343 ARG ARG A . n A 1 225 VAL 225 344 344 VAL VAL A . n A 1 226 GLU 226 345 345 GLU GLU A . n A 1 227 PHE 227 346 346 PHE PHE A . n A 1 228 THR 228 347 347 THR THR A . n A 1 229 PHE 229 348 348 PHE PHE A . n A 1 230 PRO 230 349 349 PRO PRO A . n A 1 231 ASP 231 350 350 ASP ASP A . n A 1 232 PHE 232 351 351 PHE PHE A . n A 1 233 VAL 233 352 352 VAL VAL A . n A 1 234 THR 234 353 353 THR THR A . n A 1 235 GLU 235 354 354 GLU GLU A . n A 1 236 GLY 236 355 355 GLY GLY A . n A 1 237 ALA 237 356 356 ALA ALA A . n A 1 238 ARG 238 357 357 ARG ARG A . n A 1 239 ASP 239 358 358 ASP ASP A . n A 1 240 LEU 240 359 359 LEU LEU A . n A 1 241 ILE 241 360 360 ILE ILE A . n A 1 242 SER 242 361 361 SER SER A . n A 1 243 ARG 243 362 362 ARG ARG A . n A 1 244 LEU 244 363 363 LEU LEU A . n A 1 245 LEU 245 364 364 LEU LEU A . n A 1 246 LYS 246 365 365 LYS LYS A . n A 1 247 HIS 247 366 366 HIS HIS A . n A 1 248 ASN 248 367 367 ASN ASN A . n A 1 249 PRO 249 368 368 PRO PRO A . n A 1 250 SER 250 369 369 SER SER A . n A 1 251 GLN 251 370 370 GLN GLN A . n A 1 252 ARG 252 371 371 ARG ARG A . n A 1 253 PRO 253 372 372 PRO PRO A . n A 1 254 MET 254 373 373 MET MET A . n A 1 255 LEU 255 374 374 LEU LEU A . n A 1 256 ARG 256 375 375 ARG ARG A . n A 1 257 GLU 257 376 376 GLU GLU A . n A 1 258 VAL 258 377 377 VAL VAL A . n A 1 259 LEU 259 378 378 LEU LEU A . n A 1 260 GLU 260 379 379 GLU GLU A . n A 1 261 HIS 261 380 380 HIS HIS A . n A 1 262 PRO 262 381 381 PRO PRO A . n A 1 263 TRP 263 382 382 TRP TRP A . n A 1 264 ILE 264 383 383 ILE ILE A . n A 1 265 THR 265 384 384 THR THR A . n A 1 266 ALA 266 385 385 ALA ALA A . n A 1 267 ASN 267 386 386 ASN ASN A . n A 1 268 SER 268 387 387 SER SER A . n A 1 269 SER 269 388 388 SER SER A . n A 1 270 LYS 270 389 389 LYS LYS A . n A 1 271 PRO 271 390 390 PRO PRO A . n A 1 272 SER 272 391 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 9QT 1 401 4000 9QT 033 A . C 3 SKE 1 402 1 SKE JNJ A . D 4 MG 1 403 1 MG MG A . E 5 HOH 1 501 3 HOH HOH A . E 5 HOH 2 502 7 HOH HOH A . E 5 HOH 3 503 5 HOH HOH A . E 5 HOH 4 504 12 HOH HOH A . E 5 HOH 5 505 14 HOH HOH A . E 5 HOH 6 506 2 HOH HOH A . E 5 HOH 7 507 6 HOH HOH A . E 5 HOH 8 508 11 HOH HOH A . E 5 HOH 9 509 8 HOH HOH A . E 5 HOH 10 510 4 HOH HOH A . E 5 HOH 11 511 9 HOH HOH A . E 5 HOH 12 512 13 HOH HOH A . E 5 HOH 13 513 1 HOH HOH A . E 5 HOH 14 514 10 HOH HOH A . E 5 HOH 15 515 15 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 70 ? 1 MORE -4 ? 1 'SSA (A^2)' 13050 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id MG _pdbx_struct_special_symmetry.auth_seq_id 403 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id MG _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-08-09 2 'Structure model' 1 1 2017-08-23 3 'Structure model' 1 2 2017-08-30 4 'Structure model' 1 3 2018-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 4 'Structure model' entity_src_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.pdbx_database_id_DOI' 3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 4 2 'Structure model' '_citation.title' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 4 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 9 4 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name' 10 4 'Structure model' '_entity_src_gen.pdbx_host_org_strain' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 361 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 501 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.06 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 127 ? ? 43.25 86.06 2 1 GLU A 131 ? ? -58.70 -2.09 3 1 ASP A 202 ? ? -141.12 -156.22 4 1 SER A 226 ? ? 68.46 -56.60 5 1 ARG A 251 ? ? 39.85 67.53 6 1 ASP A 256 ? ? -169.20 86.96 7 1 ASP A 274 ? ? 49.64 111.50 8 1 PHE A 275 ? ? 91.55 -154.11 9 1 ASP A 307 ? ? -66.91 -166.90 10 1 LEU A 364 ? ? -92.72 57.54 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 126 ? CG ? A ARG 7 CG 2 1 Y 1 A ARG 126 ? CD ? A ARG 7 CD 3 1 Y 1 A ARG 126 ? NE ? A ARG 7 NE 4 1 Y 1 A ARG 126 ? CZ ? A ARG 7 CZ 5 1 Y 1 A ARG 126 ? NH1 ? A ARG 7 NH1 6 1 Y 1 A ARG 126 ? NH2 ? A ARG 7 NH2 7 1 Y 1 A GLN 127 ? CG ? A GLN 8 CG 8 1 Y 1 A GLN 127 ? CD ? A GLN 8 CD 9 1 Y 1 A GLN 127 ? OE1 ? A GLN 8 OE1 10 1 Y 1 A GLN 127 ? NE2 ? A GLN 8 NE2 11 1 Y 1 A LYS 143 ? CG ? A LYS 24 CG 12 1 Y 1 A LYS 143 ? CD ? A LYS 24 CD 13 1 Y 1 A LYS 143 ? CE ? A LYS 24 CE 14 1 Y 1 A LYS 143 ? NZ ? A LYS 24 NZ 15 1 Y 1 A ARG 255 ? CG ? A ARG 136 CG 16 1 Y 1 A ARG 255 ? CD ? A ARG 136 CD 17 1 Y 1 A ARG 255 ? NE ? A ARG 136 NE 18 1 Y 1 A ARG 255 ? CZ ? A ARG 136 CZ 19 1 Y 1 A ARG 255 ? NH1 ? A ARG 136 NH1 20 1 Y 1 A ARG 255 ? NH2 ? A ARG 136 NH2 21 1 Y 1 A TRP 277 ? CG ? A TRP 158 CG 22 1 Y 1 A TRP 277 ? CD1 ? A TRP 158 CD1 23 1 Y 1 A TRP 277 ? CD2 ? A TRP 158 CD2 24 1 Y 1 A TRP 277 ? NE1 ? A TRP 158 NE1 25 1 Y 1 A TRP 277 ? CE2 ? A TRP 158 CE2 26 1 Y 1 A TRP 277 ? CE3 ? A TRP 158 CE3 27 1 Y 1 A TRP 277 ? CZ2 ? A TRP 158 CZ2 28 1 Y 1 A TRP 277 ? CZ3 ? A TRP 158 CZ3 29 1 Y 1 A TRP 277 ? CH2 ? A TRP 158 CH2 30 1 Y 1 A HIS 280 ? CG ? A HIS 161 CG 31 1 Y 1 A HIS 280 ? ND1 ? A HIS 161 ND1 32 1 Y 1 A HIS 280 ? CD2 ? A HIS 161 CD2 33 1 Y 1 A HIS 280 ? CE1 ? A HIS 161 CE1 34 1 Y 1 A HIS 280 ? NE2 ? A HIS 161 NE2 35 1 Y 1 A LYS 389 ? CG ? A LYS 270 CG 36 1 Y 1 A LYS 389 ? CD ? A LYS 270 CD 37 1 Y 1 A LYS 389 ? CE ? A LYS 270 CE 38 1 Y 1 A LYS 389 ? NZ ? A LYS 270 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 120 ? A GLY 1 2 1 Y 1 A SER 121 ? A SER 2 3 1 Y 1 A MET 122 ? A MET 3 4 1 Y 1 A GLY 123 ? A GLY 4 5 1 Y 1 A SER 124 ? A SER 5 6 1 Y 1 A LYS 125 ? A LYS 6 7 1 Y 1 A ALA 281 ? A ALA 162 8 1 Y 1 A PRO 282 ? A PRO 163 9 1 Y 1 A SER 283 ? A SER 164 10 1 Y 1 A SER 284 ? A SER 165 11 1 Y 1 A ARG 285 ? A ARG 166 12 1 Y 1 A ARG 286 ? A ARG 167 13 1 Y 1 A THR 287 ? A THR 168 14 1 Y 1 A THR 288 ? A THR 169 15 1 Y 1 A LEU 289 ? A LEU 170 16 1 Y 1 A CYS 290 ? A CYS 171 17 1 Y 1 A SER 391 ? A SER 272 # _pdbx_audit_support.funding_organization 'Wellcome Trust' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number 090340/Z/09/Z _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-(3-chloranyl-5-fluoranyl-phenyl)quinoline-4-carboxylic acid' 9QT 3 '4-({5-amino-1-[(2,6-difluorophenyl)carbonyl]-1H-1,2,4-triazol-3-yl}amino)benzenesulfonamide' SKE 4 'MAGNESIUM ION' MG 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #