data_5ONO # _entry.id 5ONO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5ONO pdb_00005ono 10.2210/pdb5ono/pdb WWPDB D_1200006091 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-08-22 2 'Structure model' 1 1 2019-03-06 3 'Structure model' 1 2 2019-10-16 4 'Structure model' 1 3 2024-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_database_proc 4 3 'Structure model' reflns_shell 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 4 'Structure model' '_database_2.pdbx_DOI' 13 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5ONO _pdbx_database_status.recvd_initial_deposition_date 2017-08-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 5ONN _pdbx_database_related.content_type unspecified # _audit_author.name 'Bremer, E.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first 364 _citation.page_last 364 _citation.title 'Illuminating the catalytic core of ectoine synthase through structural and biochemical analysis.' _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-018-36247-w _citation.pdbx_database_id_PubMed 30674920 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Czech, L.' 1 0000-0001-7398-1186 primary 'Hoppner, A.' 2 ? primary 'Kobus, S.' 3 ? primary 'Seubert, A.' 4 ? primary 'Riclea, R.' 5 ? primary 'Dickschat, J.S.' 6 ? primary 'Heider, J.' 7 ? primary 'Smits, S.H.J.' 8 ? primary 'Bremer, E.' 9 0000-0002-2225-7005 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'L-ectoine synthase' 15715.754 1 4.2.1.108 ? ? ? 2 non-polymer syn 'FE (III) ION' 55.845 1 ? ? ? ? 3 non-polymer syn '(4S)-2-METHYL-1,4,5,6-TETRAHYDROPYRIMIDINE-4-CARBOXYLIC ACID' 142.156 1 ? ? ? ? 4 water nat water 18.015 42 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'N-acetyldiaminobutyrate dehydratase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MIVKHLEEIVDTKDDIDTTTWNSRRLLLTKDGMGFSLNDTLIKAGTETLIWYKNHVEAVYCIEGEGEIEVVGGETYPITP GMMYALDGHEKHYLRARSQMRMVCVFNPPLTGAEVHDEEGTYPLLAPITDNWSHPQFE ; _entity_poly.pdbx_seq_one_letter_code_can ;MIVKHLEEIVDTKDDIDTTTWNSRRLLLTKDGMGFSLNDTLIKAGTETLIWYKNHVEAVYCIEGEGEIEVVGGETYPITP GMMYALDGHEKHYLRARSQMRMVCVFNPPLTGAEVHDEEGTYPLLAPITDNWSHPQFE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (III) ION' FE 3 '(4S)-2-METHYL-1,4,5,6-TETRAHYDROPYRIMIDINE-4-CARBOXYLIC ACID' 4CS 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 VAL n 1 4 LYS n 1 5 HIS n 1 6 LEU n 1 7 GLU n 1 8 GLU n 1 9 ILE n 1 10 VAL n 1 11 ASP n 1 12 THR n 1 13 LYS n 1 14 ASP n 1 15 ASP n 1 16 ILE n 1 17 ASP n 1 18 THR n 1 19 THR n 1 20 THR n 1 21 TRP n 1 22 ASN n 1 23 SER n 1 24 ARG n 1 25 ARG n 1 26 LEU n 1 27 LEU n 1 28 LEU n 1 29 THR n 1 30 LYS n 1 31 ASP n 1 32 GLY n 1 33 MET n 1 34 GLY n 1 35 PHE n 1 36 SER n 1 37 LEU n 1 38 ASN n 1 39 ASP n 1 40 THR n 1 41 LEU n 1 42 ILE n 1 43 LYS n 1 44 ALA n 1 45 GLY n 1 46 THR n 1 47 GLU n 1 48 THR n 1 49 LEU n 1 50 ILE n 1 51 TRP n 1 52 TYR n 1 53 LYS n 1 54 ASN n 1 55 HIS n 1 56 VAL n 1 57 GLU n 1 58 ALA n 1 59 VAL n 1 60 TYR n 1 61 CYS n 1 62 ILE n 1 63 GLU n 1 64 GLY n 1 65 GLU n 1 66 GLY n 1 67 GLU n 1 68 ILE n 1 69 GLU n 1 70 VAL n 1 71 VAL n 1 72 GLY n 1 73 GLY n 1 74 GLU n 1 75 THR n 1 76 TYR n 1 77 PRO n 1 78 ILE n 1 79 THR n 1 80 PRO n 1 81 GLY n 1 82 MET n 1 83 MET n 1 84 TYR n 1 85 ALA n 1 86 LEU n 1 87 ASP n 1 88 GLY n 1 89 HIS n 1 90 GLU n 1 91 LYS n 1 92 HIS n 1 93 TYR n 1 94 LEU n 1 95 ARG n 1 96 ALA n 1 97 ARG n 1 98 SER n 1 99 GLN n 1 100 MET n 1 101 ARG n 1 102 MET n 1 103 VAL n 1 104 CYS n 1 105 VAL n 1 106 PHE n 1 107 ASN n 1 108 PRO n 1 109 PRO n 1 110 LEU n 1 111 THR n 1 112 GLY n 1 113 ALA n 1 114 GLU n 1 115 VAL n 1 116 HIS n 1 117 ASP n 1 118 GLU n 1 119 GLU n 1 120 GLY n 1 121 THR n 1 122 TYR n 1 123 PRO n 1 124 LEU n 1 125 LEU n 1 126 ALA n 1 127 PRO n 1 128 ILE n 1 129 THR n 1 130 ASP n 1 131 ASN n 1 132 TRP n 1 133 SER n 1 134 HIS n 1 135 PRO n 1 136 GLN n 1 137 PHE n 1 138 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 138 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ectC, BK123_26285' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Paenibacillus lautus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1401 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 4CS non-polymer . '(4S)-2-METHYL-1,4,5,6-TETRAHYDROPYRIMIDINE-4-CARBOXYLIC ACID' ECTOINE 'C6 H10 N2 O2' 142.156 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 MET 33 33 33 MET MET A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 HIS 89 89 89 HIS HIS A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 MET 102 102 102 MET MET A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 CYS 104 104 104 CYS CYS A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 TRP 132 132 132 TRP TRP A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 HIS 134 134 134 HIS HIS A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 GLU 138 138 138 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE 1 201 1 FE FE A . C 3 4CS 1 202 1 4CS 4CS A . D 4 HOH 1 301 13 HOH HOH A . D 4 HOH 2 302 25 HOH HOH A . D 4 HOH 3 303 41 HOH HOH A . D 4 HOH 4 304 24 HOH HOH A . D 4 HOH 5 305 1 HOH HOH A . D 4 HOH 6 306 7 HOH HOH A . D 4 HOH 7 307 19 HOH HOH A . D 4 HOH 8 308 31 HOH HOH A . D 4 HOH 9 309 6 HOH HOH A . D 4 HOH 10 310 9 HOH HOH A . D 4 HOH 11 311 16 HOH HOH A . D 4 HOH 12 312 29 HOH HOH A . D 4 HOH 13 313 22 HOH HOH A . D 4 HOH 14 314 11 HOH HOH A . D 4 HOH 15 315 42 HOH HOH A . D 4 HOH 16 316 38 HOH HOH A . D 4 HOH 17 317 3 HOH HOH A . D 4 HOH 18 318 40 HOH HOH A . D 4 HOH 19 319 21 HOH HOH A . D 4 HOH 20 320 23 HOH HOH A . D 4 HOH 21 321 15 HOH HOH A . D 4 HOH 22 322 30 HOH HOH A . D 4 HOH 23 323 12 HOH HOH A . D 4 HOH 24 324 4 HOH HOH A . D 4 HOH 25 325 18 HOH HOH A . D 4 HOH 26 326 35 HOH HOH A . D 4 HOH 27 327 17 HOH HOH A . D 4 HOH 28 328 2 HOH HOH A . D 4 HOH 29 329 27 HOH HOH A . D 4 HOH 30 330 10 HOH HOH A . D 4 HOH 31 331 37 HOH HOH A . D 4 HOH 32 332 14 HOH HOH A . D 4 HOH 33 333 5 HOH HOH A . D 4 HOH 34 334 20 HOH HOH A . D 4 HOH 35 335 33 HOH HOH A . D 4 HOH 36 336 28 HOH HOH A . D 4 HOH 37 337 32 HOH HOH A . D 4 HOH 38 338 34 HOH HOH A . D 4 HOH 39 339 8 HOH HOH A . D 4 HOH 40 340 36 HOH HOH A . D 4 HOH 41 341 39 HOH HOH A . D 4 HOH 42 342 26 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5ONO _cell.details ? _cell.formula_units_Z ? _cell.length_a 71.418 _cell.length_a_esd ? _cell.length_b 71.418 _cell.length_b_esd ? _cell.length_c 68.838 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5ONO _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5ONO _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.22 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.86 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'BATCH MODE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M ammonium sulfate, 0.1 M phosphate citrate pH 4.2, 20% (v/v) PEG 300, 10% (v/v) glycerol.' _exptl_crystal_grow.pdbx_pH_range 4.0-5.0 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-10-21 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.988 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.988 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5ONO _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.5 _reflns.d_resolution_low 46.01 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7282 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.4 _reflns.pdbx_Rmerge_I_obs 0.082 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5ONO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.500 _refine.ls_d_res_low 46.007 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7280 _refine.ls_number_reflns_R_free 727 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.29 _refine.ls_percent_reflns_R_free 9.99 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1906 _refine.ls_R_factor_R_free 0.2399 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1850 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 3.22 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5BXX _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.66 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.25 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1101 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.number_atoms_solvent 42 _refine_hist.number_atoms_total 1154 _refine_hist.d_res_high 2.500 _refine_hist.d_res_low 46.007 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 ? 1138 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.481 ? 1547 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 15.288 ? 415 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.054 ? 171 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 199 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5001 2.6931 . . 143 1274 99.00 . . . 0.2824 . 0.1851 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6931 2.9641 . . 141 1286 99.00 . . . 0.2669 . 0.2034 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9641 3.3929 . . 146 1297 99.00 . . . 0.2476 . 0.1961 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3929 4.2742 . . 148 1310 100.00 . . . 0.2274 . 0.1737 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.2742 46.0150 . . 149 1386 100.00 . . . 0.2142 . 0.1786 . . . . . . . . . . # _struct.entry_id 5ONO _struct.title 'Crystal Structure of Ectoine Synthase from P. lautus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5ONO _struct_keywords.text 'Ectoine, synthase, osmolyte, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A1R1AV52_PAELA _struct_ref.pdbx_db_accession A0A1R1AV52 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MIVKHLEEIVDTKDDIDTKTWNSRRLLLTKDGMGFSLNDTLIKAGTETLIWYKNHVEAVYCIEGEGEIEVIGGETYPISP GMMYALDGHEKHYLRARSQMRMVCVFNPPLTGAEVHDEEGTYPLLAPISD ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5ONO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A1R1AV52 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 130 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 130 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5ONO THR A 19 ? UNP A0A1R1AV52 LYS 19 conflict 19 1 1 5ONO VAL A 71 ? UNP A0A1R1AV52 ILE 71 conflict 71 2 1 5ONO THR A 79 ? UNP A0A1R1AV52 SER 79 conflict 79 3 1 5ONO THR A 129 ? UNP A0A1R1AV52 SER 129 conflict 129 4 1 5ONO ASN A 131 ? UNP A0A1R1AV52 ? ? 'expression tag' 131 5 1 5ONO TRP A 132 ? UNP A0A1R1AV52 ? ? 'expression tag' 132 6 1 5ONO SER A 133 ? UNP A0A1R1AV52 ? ? 'expression tag' 133 7 1 5ONO HIS A 134 ? UNP A0A1R1AV52 ? ? 'expression tag' 134 8 1 5ONO PRO A 135 ? UNP A0A1R1AV52 ? ? 'expression tag' 135 9 1 5ONO GLN A 136 ? UNP A0A1R1AV52 ? ? 'expression tag' 136 10 1 5ONO PHE A 137 ? UNP A0A1R1AV52 ? ? 'expression tag' 137 11 1 5ONO GLU A 138 ? UNP A0A1R1AV52 ? ? 'expression tag' 138 12 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8090 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 5 ? VAL A 10 ? HIS A 5 VAL A 10 1 ? 6 HELX_P HELX_P2 AA2 LEU A 28 ? GLY A 32 ? LEU A 28 GLY A 32 5 ? 5 HELX_P HELX_P3 AA3 THR A 111 ? GLU A 118 ? THR A 111 GLU A 118 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASN _struct_mon_prot_cis.label_seq_id 107 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASN _struct_mon_prot_cis.auth_seq_id 107 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 108 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 108 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.47 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 15 ? ASP A 17 ? ASP A 15 ASP A 17 AA1 2 TRP A 21 ? LEU A 27 ? TRP A 21 LEU A 27 AA1 3 SER A 36 ? ILE A 42 ? SER A 36 ILE A 42 AA1 4 MET A 100 ? ASN A 107 ? MET A 100 ASN A 107 AA1 5 VAL A 56 ? GLU A 63 ? VAL A 56 GLU A 63 AA1 6 MET A 83 ? ALA A 85 ? MET A 83 ALA A 85 AA2 1 THR A 75 ? ILE A 78 ? THR A 75 ILE A 78 AA2 2 GLY A 66 ? VAL A 70 ? GLY A 66 VAL A 70 AA2 3 HIS A 92 ? ALA A 96 ? HIS A 92 ALA A 96 AA2 4 GLU A 47 ? ILE A 50 ? GLU A 47 ILE A 50 AA2 5 THR A 121 ? LEU A 125 ? THR A 121 LEU A 125 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 16 ? N ILE A 16 O SER A 23 ? O SER A 23 AA1 2 3 N LEU A 26 ? N LEU A 26 O LEU A 37 ? O LEU A 37 AA1 3 4 N THR A 40 ? N THR A 40 O MET A 102 ? O MET A 102 AA1 4 5 O VAL A 103 ? O VAL A 103 N TYR A 60 ? N TYR A 60 AA1 5 6 N VAL A 59 ? N VAL A 59 O TYR A 84 ? O TYR A 84 AA2 1 2 O ILE A 78 ? O ILE A 78 N GLY A 66 ? N GLY A 66 AA2 2 3 N GLU A 67 ? N GLU A 67 O ARG A 95 ? O ARG A 95 AA2 3 4 O HIS A 92 ? O HIS A 92 N ILE A 50 ? N ILE A 50 AA2 4 5 N GLU A 47 ? N GLU A 47 O LEU A 124 ? O LEU A 124 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A FE 201 ? 4 'binding site for residue FE A 201' AC2 Software A 4CS 202 ? 11 'binding site for residue 4CS A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 57 ? GLU A 57 . ? 1_555 ? 2 AC1 4 TYR A 84 ? TYR A 84 . ? 1_555 ? 3 AC1 4 HIS A 92 ? HIS A 92 . ? 1_555 ? 4 AC1 4 4CS C . ? 4CS A 202 . ? 1_555 ? 5 AC2 11 TRP A 21 ? TRP A 21 . ? 1_555 ? 6 AC2 11 SER A 23 ? SER A 23 . ? 1_555 ? 7 AC2 11 ASN A 38 ? ASN A 38 . ? 1_555 ? 8 AC2 11 THR A 40 ? THR A 40 . ? 1_555 ? 9 AC2 11 TYR A 52 ? TYR A 52 . ? 1_555 ? 10 AC2 11 GLU A 57 ? GLU A 57 . ? 1_555 ? 11 AC2 11 CYS A 104 ? CYS A 104 . ? 1_555 ? 12 AC2 11 PHE A 106 ? PHE A 106 . ? 1_555 ? 13 AC2 11 FE B . ? FE A 201 . ? 1_555 ? 14 AC2 11 HOH D . ? HOH A 301 . ? 1_555 ? 15 AC2 11 HOH D . ? HOH A 309 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 4CS _pdbx_validate_close_contact.auth_seq_id_1 202 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 301 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 339 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 342 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 6_767 _pdbx_validate_symm_contact.dist 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 130 ? ? -93.39 40.87 2 1 PHE A 137 ? ? -151.83 -0.92 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 PHE _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 137 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 GLU _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 138 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 139.39 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 4CS O O N N 1 4CS C C N N 2 4CS OXT O N N 3 4CS CA C N S 4 4CS CB C N N 5 4CS CAD C N N 6 4CS NAG N N N 7 4CS CAI C N N 8 4CS CAA C N N 9 4CS N N N N 10 4CS HOXT H N N 11 4CS HA H N N 12 4CS HB1 H N N 13 4CS HB2 H N N 14 4CS HAD1 H N N 15 4CS HAD2 H N N 16 4CS HNAG H N N 17 4CS HAA1 H N N 18 4CS HAA2 H N N 19 4CS HAA3 H N N 20 ALA N N N N 21 ALA CA C N S 22 ALA C C N N 23 ALA O O N N 24 ALA CB C N N 25 ALA OXT O N N 26 ALA H H N N 27 ALA H2 H N N 28 ALA HA H N N 29 ALA HB1 H N N 30 ALA HB2 H N N 31 ALA HB3 H N N 32 ALA HXT H N N 33 ARG N N N N 34 ARG CA C N S 35 ARG C C N N 36 ARG O O N N 37 ARG CB C N N 38 ARG CG C N N 39 ARG CD C N N 40 ARG NE N N N 41 ARG CZ C N N 42 ARG NH1 N N N 43 ARG NH2 N N N 44 ARG OXT O N N 45 ARG H H N N 46 ARG H2 H N N 47 ARG HA H N N 48 ARG HB2 H N N 49 ARG HB3 H N N 50 ARG HG2 H N N 51 ARG HG3 H N N 52 ARG HD2 H N N 53 ARG HD3 H N N 54 ARG HE H N N 55 ARG HH11 H N N 56 ARG HH12 H N N 57 ARG HH21 H N N 58 ARG HH22 H N N 59 ARG HXT H N N 60 ASN N N N N 61 ASN CA C N S 62 ASN C C N N 63 ASN O O N N 64 ASN CB C N N 65 ASN CG C N N 66 ASN OD1 O N N 67 ASN ND2 N N N 68 ASN OXT O N N 69 ASN H H N N 70 ASN H2 H N N 71 ASN HA H N N 72 ASN HB2 H N N 73 ASN HB3 H N N 74 ASN HD21 H N N 75 ASN HD22 H N N 76 ASN HXT H N N 77 ASP N N N N 78 ASP CA C N S 79 ASP C C N N 80 ASP O O N N 81 ASP CB C N N 82 ASP CG C N N 83 ASP OD1 O N N 84 ASP OD2 O N N 85 ASP OXT O N N 86 ASP H H N N 87 ASP H2 H N N 88 ASP HA H N N 89 ASP HB2 H N N 90 ASP HB3 H N N 91 ASP HD2 H N N 92 ASP HXT H N N 93 CYS N N N N 94 CYS CA C N R 95 CYS C C N N 96 CYS O O N N 97 CYS CB C N N 98 CYS SG S N N 99 CYS OXT O N N 100 CYS H H N N 101 CYS H2 H N N 102 CYS HA H N N 103 CYS HB2 H N N 104 CYS HB3 H N N 105 CYS HG H N N 106 CYS HXT H N N 107 FE FE FE N N 108 GLN N N N N 109 GLN CA C N S 110 GLN C C N N 111 GLN O O N N 112 GLN CB C N N 113 GLN CG C N N 114 GLN CD C N N 115 GLN OE1 O N N 116 GLN NE2 N N N 117 GLN OXT O N N 118 GLN H H N N 119 GLN H2 H N N 120 GLN HA H N N 121 GLN HB2 H N N 122 GLN HB3 H N N 123 GLN HG2 H N N 124 GLN HG3 H N N 125 GLN HE21 H N N 126 GLN HE22 H N N 127 GLN HXT H N N 128 GLU N N N N 129 GLU CA C N S 130 GLU C C N N 131 GLU O O N N 132 GLU CB C N N 133 GLU CG C N N 134 GLU CD C N N 135 GLU OE1 O N N 136 GLU OE2 O N N 137 GLU OXT O N N 138 GLU H H N N 139 GLU H2 H N N 140 GLU HA H N N 141 GLU HB2 H N N 142 GLU HB3 H N N 143 GLU HG2 H N N 144 GLU HG3 H N N 145 GLU HE2 H N N 146 GLU HXT H N N 147 GLY N N N N 148 GLY CA C N N 149 GLY C C N N 150 GLY O O N N 151 GLY OXT O N N 152 GLY H H N N 153 GLY H2 H N N 154 GLY HA2 H N N 155 GLY HA3 H N N 156 GLY HXT H N N 157 HIS N N N N 158 HIS CA C N S 159 HIS C C N N 160 HIS O O N N 161 HIS CB C N N 162 HIS CG C Y N 163 HIS ND1 N Y N 164 HIS CD2 C Y N 165 HIS CE1 C Y N 166 HIS NE2 N Y N 167 HIS OXT O N N 168 HIS H H N N 169 HIS H2 H N N 170 HIS HA H N N 171 HIS HB2 H N N 172 HIS HB3 H N N 173 HIS HD1 H N N 174 HIS HD2 H N N 175 HIS HE1 H N N 176 HIS HE2 H N N 177 HIS HXT H N N 178 HOH O O N N 179 HOH H1 H N N 180 HOH H2 H N N 181 ILE N N N N 182 ILE CA C N S 183 ILE C C N N 184 ILE O O N N 185 ILE CB C N S 186 ILE CG1 C N N 187 ILE CG2 C N N 188 ILE CD1 C N N 189 ILE OXT O N N 190 ILE H H N N 191 ILE H2 H N N 192 ILE HA H N N 193 ILE HB H N N 194 ILE HG12 H N N 195 ILE HG13 H N N 196 ILE HG21 H N N 197 ILE HG22 H N N 198 ILE HG23 H N N 199 ILE HD11 H N N 200 ILE HD12 H N N 201 ILE HD13 H N N 202 ILE HXT H N N 203 LEU N N N N 204 LEU CA C N S 205 LEU C C N N 206 LEU O O N N 207 LEU CB C N N 208 LEU CG C N N 209 LEU CD1 C N N 210 LEU CD2 C N N 211 LEU OXT O N N 212 LEU H H N N 213 LEU H2 H N N 214 LEU HA H N N 215 LEU HB2 H N N 216 LEU HB3 H N N 217 LEU HG H N N 218 LEU HD11 H N N 219 LEU HD12 H N N 220 LEU HD13 H N N 221 LEU HD21 H N N 222 LEU HD22 H N N 223 LEU HD23 H N N 224 LEU HXT H N N 225 LYS N N N N 226 LYS CA C N S 227 LYS C C N N 228 LYS O O N N 229 LYS CB C N N 230 LYS CG C N N 231 LYS CD C N N 232 LYS CE C N N 233 LYS NZ N N N 234 LYS OXT O N N 235 LYS H H N N 236 LYS H2 H N N 237 LYS HA H N N 238 LYS HB2 H N N 239 LYS HB3 H N N 240 LYS HG2 H N N 241 LYS HG3 H N N 242 LYS HD2 H N N 243 LYS HD3 H N N 244 LYS HE2 H N N 245 LYS HE3 H N N 246 LYS HZ1 H N N 247 LYS HZ2 H N N 248 LYS HZ3 H N N 249 LYS HXT H N N 250 MET N N N N 251 MET CA C N S 252 MET C C N N 253 MET O O N N 254 MET CB C N N 255 MET CG C N N 256 MET SD S N N 257 MET CE C N N 258 MET OXT O N N 259 MET H H N N 260 MET H2 H N N 261 MET HA H N N 262 MET HB2 H N N 263 MET HB3 H N N 264 MET HG2 H N N 265 MET HG3 H N N 266 MET HE1 H N N 267 MET HE2 H N N 268 MET HE3 H N N 269 MET HXT H N N 270 PHE N N N N 271 PHE CA C N S 272 PHE C C N N 273 PHE O O N N 274 PHE CB C N N 275 PHE CG C Y N 276 PHE CD1 C Y N 277 PHE CD2 C Y N 278 PHE CE1 C Y N 279 PHE CE2 C Y N 280 PHE CZ C Y N 281 PHE OXT O N N 282 PHE H H N N 283 PHE H2 H N N 284 PHE HA H N N 285 PHE HB2 H N N 286 PHE HB3 H N N 287 PHE HD1 H N N 288 PHE HD2 H N N 289 PHE HE1 H N N 290 PHE HE2 H N N 291 PHE HZ H N N 292 PHE HXT H N N 293 PRO N N N N 294 PRO CA C N S 295 PRO C C N N 296 PRO O O N N 297 PRO CB C N N 298 PRO CG C N N 299 PRO CD C N N 300 PRO OXT O N N 301 PRO H H N N 302 PRO HA H N N 303 PRO HB2 H N N 304 PRO HB3 H N N 305 PRO HG2 H N N 306 PRO HG3 H N N 307 PRO HD2 H N N 308 PRO HD3 H N N 309 PRO HXT H N N 310 SER N N N N 311 SER CA C N S 312 SER C C N N 313 SER O O N N 314 SER CB C N N 315 SER OG O N N 316 SER OXT O N N 317 SER H H N N 318 SER H2 H N N 319 SER HA H N N 320 SER HB2 H N N 321 SER HB3 H N N 322 SER HG H N N 323 SER HXT H N N 324 THR N N N N 325 THR CA C N S 326 THR C C N N 327 THR O O N N 328 THR CB C N R 329 THR OG1 O N N 330 THR CG2 C N N 331 THR OXT O N N 332 THR H H N N 333 THR H2 H N N 334 THR HA H N N 335 THR HB H N N 336 THR HG1 H N N 337 THR HG21 H N N 338 THR HG22 H N N 339 THR HG23 H N N 340 THR HXT H N N 341 TRP N N N N 342 TRP CA C N S 343 TRP C C N N 344 TRP O O N N 345 TRP CB C N N 346 TRP CG C Y N 347 TRP CD1 C Y N 348 TRP CD2 C Y N 349 TRP NE1 N Y N 350 TRP CE2 C Y N 351 TRP CE3 C Y N 352 TRP CZ2 C Y N 353 TRP CZ3 C Y N 354 TRP CH2 C Y N 355 TRP OXT O N N 356 TRP H H N N 357 TRP H2 H N N 358 TRP HA H N N 359 TRP HB2 H N N 360 TRP HB3 H N N 361 TRP HD1 H N N 362 TRP HE1 H N N 363 TRP HE3 H N N 364 TRP HZ2 H N N 365 TRP HZ3 H N N 366 TRP HH2 H N N 367 TRP HXT H N N 368 TYR N N N N 369 TYR CA C N S 370 TYR C C N N 371 TYR O O N N 372 TYR CB C N N 373 TYR CG C Y N 374 TYR CD1 C Y N 375 TYR CD2 C Y N 376 TYR CE1 C Y N 377 TYR CE2 C Y N 378 TYR CZ C Y N 379 TYR OH O N N 380 TYR OXT O N N 381 TYR H H N N 382 TYR H2 H N N 383 TYR HA H N N 384 TYR HB2 H N N 385 TYR HB3 H N N 386 TYR HD1 H N N 387 TYR HD2 H N N 388 TYR HE1 H N N 389 TYR HE2 H N N 390 TYR HH H N N 391 TYR HXT H N N 392 VAL N N N N 393 VAL CA C N S 394 VAL C C N N 395 VAL O O N N 396 VAL CB C N N 397 VAL CG1 C N N 398 VAL CG2 C N N 399 VAL OXT O N N 400 VAL H H N N 401 VAL H2 H N N 402 VAL HA H N N 403 VAL HB H N N 404 VAL HG11 H N N 405 VAL HG12 H N N 406 VAL HG13 H N N 407 VAL HG21 H N N 408 VAL HG22 H N N 409 VAL HG23 H N N 410 VAL HXT H N N 411 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 4CS O C doub N N 1 4CS C OXT sing N N 2 4CS C CA sing N N 3 4CS OXT HOXT sing N N 4 4CS CA CB sing N N 5 4CS CA N sing N N 6 4CS CA HA sing N N 7 4CS CB CAD sing N N 8 4CS CB HB1 sing N N 9 4CS CB HB2 sing N N 10 4CS CAD NAG sing N N 11 4CS CAD HAD1 sing N N 12 4CS CAD HAD2 sing N N 13 4CS NAG CAI sing N N 14 4CS NAG HNAG sing N N 15 4CS CAI CAA sing N N 16 4CS CAI N doub N N 17 4CS CAA HAA1 sing N N 18 4CS CAA HAA2 sing N N 19 4CS CAA HAA3 sing N N 20 ALA N CA sing N N 21 ALA N H sing N N 22 ALA N H2 sing N N 23 ALA CA C sing N N 24 ALA CA CB sing N N 25 ALA CA HA sing N N 26 ALA C O doub N N 27 ALA C OXT sing N N 28 ALA CB HB1 sing N N 29 ALA CB HB2 sing N N 30 ALA CB HB3 sing N N 31 ALA OXT HXT sing N N 32 ARG N CA sing N N 33 ARG N H sing N N 34 ARG N H2 sing N N 35 ARG CA C sing N N 36 ARG CA CB sing N N 37 ARG CA HA sing N N 38 ARG C O doub N N 39 ARG C OXT sing N N 40 ARG CB CG sing N N 41 ARG CB HB2 sing N N 42 ARG CB HB3 sing N N 43 ARG CG CD sing N N 44 ARG CG HG2 sing N N 45 ARG CG HG3 sing N N 46 ARG CD NE sing N N 47 ARG CD HD2 sing N N 48 ARG CD HD3 sing N N 49 ARG NE CZ sing N N 50 ARG NE HE sing N N 51 ARG CZ NH1 sing N N 52 ARG CZ NH2 doub N N 53 ARG NH1 HH11 sing N N 54 ARG NH1 HH12 sing N N 55 ARG NH2 HH21 sing N N 56 ARG NH2 HH22 sing N N 57 ARG OXT HXT sing N N 58 ASN N CA sing N N 59 ASN N H sing N N 60 ASN N H2 sing N N 61 ASN CA C sing N N 62 ASN CA CB sing N N 63 ASN CA HA sing N N 64 ASN C O doub N N 65 ASN C OXT sing N N 66 ASN CB CG sing N N 67 ASN CB HB2 sing N N 68 ASN CB HB3 sing N N 69 ASN CG OD1 doub N N 70 ASN CG ND2 sing N N 71 ASN ND2 HD21 sing N N 72 ASN ND2 HD22 sing N N 73 ASN OXT HXT sing N N 74 ASP N CA sing N N 75 ASP N H sing N N 76 ASP N H2 sing N N 77 ASP CA C sing N N 78 ASP CA CB sing N N 79 ASP CA HA sing N N 80 ASP C O doub N N 81 ASP C OXT sing N N 82 ASP CB CG sing N N 83 ASP CB HB2 sing N N 84 ASP CB HB3 sing N N 85 ASP CG OD1 doub N N 86 ASP CG OD2 sing N N 87 ASP OD2 HD2 sing N N 88 ASP OXT HXT sing N N 89 CYS N CA sing N N 90 CYS N H sing N N 91 CYS N H2 sing N N 92 CYS CA C sing N N 93 CYS CA CB sing N N 94 CYS CA HA sing N N 95 CYS C O doub N N 96 CYS C OXT sing N N 97 CYS CB SG sing N N 98 CYS CB HB2 sing N N 99 CYS CB HB3 sing N N 100 CYS SG HG sing N N 101 CYS OXT HXT sing N N 102 GLN N CA sing N N 103 GLN N H sing N N 104 GLN N H2 sing N N 105 GLN CA C sing N N 106 GLN CA CB sing N N 107 GLN CA HA sing N N 108 GLN C O doub N N 109 GLN C OXT sing N N 110 GLN CB CG sing N N 111 GLN CB HB2 sing N N 112 GLN CB HB3 sing N N 113 GLN CG CD sing N N 114 GLN CG HG2 sing N N 115 GLN CG HG3 sing N N 116 GLN CD OE1 doub N N 117 GLN CD NE2 sing N N 118 GLN NE2 HE21 sing N N 119 GLN NE2 HE22 sing N N 120 GLN OXT HXT sing N N 121 GLU N CA sing N N 122 GLU N H sing N N 123 GLU N H2 sing N N 124 GLU CA C sing N N 125 GLU CA CB sing N N 126 GLU CA HA sing N N 127 GLU C O doub N N 128 GLU C OXT sing N N 129 GLU CB CG sing N N 130 GLU CB HB2 sing N N 131 GLU CB HB3 sing N N 132 GLU CG CD sing N N 133 GLU CG HG2 sing N N 134 GLU CG HG3 sing N N 135 GLU CD OE1 doub N N 136 GLU CD OE2 sing N N 137 GLU OE2 HE2 sing N N 138 GLU OXT HXT sing N N 139 GLY N CA sing N N 140 GLY N H sing N N 141 GLY N H2 sing N N 142 GLY CA C sing N N 143 GLY CA HA2 sing N N 144 GLY CA HA3 sing N N 145 GLY C O doub N N 146 GLY C OXT sing N N 147 GLY OXT HXT sing N N 148 HIS N CA sing N N 149 HIS N H sing N N 150 HIS N H2 sing N N 151 HIS CA C sing N N 152 HIS CA CB sing N N 153 HIS CA HA sing N N 154 HIS C O doub N N 155 HIS C OXT sing N N 156 HIS CB CG sing N N 157 HIS CB HB2 sing N N 158 HIS CB HB3 sing N N 159 HIS CG ND1 sing Y N 160 HIS CG CD2 doub Y N 161 HIS ND1 CE1 doub Y N 162 HIS ND1 HD1 sing N N 163 HIS CD2 NE2 sing Y N 164 HIS CD2 HD2 sing N N 165 HIS CE1 NE2 sing Y N 166 HIS CE1 HE1 sing N N 167 HIS NE2 HE2 sing N N 168 HIS OXT HXT sing N N 169 HOH O H1 sing N N 170 HOH O H2 sing N N 171 ILE N CA sing N N 172 ILE N H sing N N 173 ILE N H2 sing N N 174 ILE CA C sing N N 175 ILE CA CB sing N N 176 ILE CA HA sing N N 177 ILE C O doub N N 178 ILE C OXT sing N N 179 ILE CB CG1 sing N N 180 ILE CB CG2 sing N N 181 ILE CB HB sing N N 182 ILE CG1 CD1 sing N N 183 ILE CG1 HG12 sing N N 184 ILE CG1 HG13 sing N N 185 ILE CG2 HG21 sing N N 186 ILE CG2 HG22 sing N N 187 ILE CG2 HG23 sing N N 188 ILE CD1 HD11 sing N N 189 ILE CD1 HD12 sing N N 190 ILE CD1 HD13 sing N N 191 ILE OXT HXT sing N N 192 LEU N CA sing N N 193 LEU N H sing N N 194 LEU N H2 sing N N 195 LEU CA C sing N N 196 LEU CA CB sing N N 197 LEU CA HA sing N N 198 LEU C O doub N N 199 LEU C OXT sing N N 200 LEU CB CG sing N N 201 LEU CB HB2 sing N N 202 LEU CB HB3 sing N N 203 LEU CG CD1 sing N N 204 LEU CG CD2 sing N N 205 LEU CG HG sing N N 206 LEU CD1 HD11 sing N N 207 LEU CD1 HD12 sing N N 208 LEU CD1 HD13 sing N N 209 LEU CD2 HD21 sing N N 210 LEU CD2 HD22 sing N N 211 LEU CD2 HD23 sing N N 212 LEU OXT HXT sing N N 213 LYS N CA sing N N 214 LYS N H sing N N 215 LYS N H2 sing N N 216 LYS CA C sing N N 217 LYS CA CB sing N N 218 LYS CA HA sing N N 219 LYS C O doub N N 220 LYS C OXT sing N N 221 LYS CB CG sing N N 222 LYS CB HB2 sing N N 223 LYS CB HB3 sing N N 224 LYS CG CD sing N N 225 LYS CG HG2 sing N N 226 LYS CG HG3 sing N N 227 LYS CD CE sing N N 228 LYS CD HD2 sing N N 229 LYS CD HD3 sing N N 230 LYS CE NZ sing N N 231 LYS CE HE2 sing N N 232 LYS CE HE3 sing N N 233 LYS NZ HZ1 sing N N 234 LYS NZ HZ2 sing N N 235 LYS NZ HZ3 sing N N 236 LYS OXT HXT sing N N 237 MET N CA sing N N 238 MET N H sing N N 239 MET N H2 sing N N 240 MET CA C sing N N 241 MET CA CB sing N N 242 MET CA HA sing N N 243 MET C O doub N N 244 MET C OXT sing N N 245 MET CB CG sing N N 246 MET CB HB2 sing N N 247 MET CB HB3 sing N N 248 MET CG SD sing N N 249 MET CG HG2 sing N N 250 MET CG HG3 sing N N 251 MET SD CE sing N N 252 MET CE HE1 sing N N 253 MET CE HE2 sing N N 254 MET CE HE3 sing N N 255 MET OXT HXT sing N N 256 PHE N CA sing N N 257 PHE N H sing N N 258 PHE N H2 sing N N 259 PHE CA C sing N N 260 PHE CA CB sing N N 261 PHE CA HA sing N N 262 PHE C O doub N N 263 PHE C OXT sing N N 264 PHE CB CG sing N N 265 PHE CB HB2 sing N N 266 PHE CB HB3 sing N N 267 PHE CG CD1 doub Y N 268 PHE CG CD2 sing Y N 269 PHE CD1 CE1 sing Y N 270 PHE CD1 HD1 sing N N 271 PHE CD2 CE2 doub Y N 272 PHE CD2 HD2 sing N N 273 PHE CE1 CZ doub Y N 274 PHE CE1 HE1 sing N N 275 PHE CE2 CZ sing Y N 276 PHE CE2 HE2 sing N N 277 PHE CZ HZ sing N N 278 PHE OXT HXT sing N N 279 PRO N CA sing N N 280 PRO N CD sing N N 281 PRO N H sing N N 282 PRO CA C sing N N 283 PRO CA CB sing N N 284 PRO CA HA sing N N 285 PRO C O doub N N 286 PRO C OXT sing N N 287 PRO CB CG sing N N 288 PRO CB HB2 sing N N 289 PRO CB HB3 sing N N 290 PRO CG CD sing N N 291 PRO CG HG2 sing N N 292 PRO CG HG3 sing N N 293 PRO CD HD2 sing N N 294 PRO CD HD3 sing N N 295 PRO OXT HXT sing N N 296 SER N CA sing N N 297 SER N H sing N N 298 SER N H2 sing N N 299 SER CA C sing N N 300 SER CA CB sing N N 301 SER CA HA sing N N 302 SER C O doub N N 303 SER C OXT sing N N 304 SER CB OG sing N N 305 SER CB HB2 sing N N 306 SER CB HB3 sing N N 307 SER OG HG sing N N 308 SER OXT HXT sing N N 309 THR N CA sing N N 310 THR N H sing N N 311 THR N H2 sing N N 312 THR CA C sing N N 313 THR CA CB sing N N 314 THR CA HA sing N N 315 THR C O doub N N 316 THR C OXT sing N N 317 THR CB OG1 sing N N 318 THR CB CG2 sing N N 319 THR CB HB sing N N 320 THR OG1 HG1 sing N N 321 THR CG2 HG21 sing N N 322 THR CG2 HG22 sing N N 323 THR CG2 HG23 sing N N 324 THR OXT HXT sing N N 325 TRP N CA sing N N 326 TRP N H sing N N 327 TRP N H2 sing N N 328 TRP CA C sing N N 329 TRP CA CB sing N N 330 TRP CA HA sing N N 331 TRP C O doub N N 332 TRP C OXT sing N N 333 TRP CB CG sing N N 334 TRP CB HB2 sing N N 335 TRP CB HB3 sing N N 336 TRP CG CD1 doub Y N 337 TRP CG CD2 sing Y N 338 TRP CD1 NE1 sing Y N 339 TRP CD1 HD1 sing N N 340 TRP CD2 CE2 doub Y N 341 TRP CD2 CE3 sing Y N 342 TRP NE1 CE2 sing Y N 343 TRP NE1 HE1 sing N N 344 TRP CE2 CZ2 sing Y N 345 TRP CE3 CZ3 doub Y N 346 TRP CE3 HE3 sing N N 347 TRP CZ2 CH2 doub Y N 348 TRP CZ2 HZ2 sing N N 349 TRP CZ3 CH2 sing Y N 350 TRP CZ3 HZ3 sing N N 351 TRP CH2 HH2 sing N N 352 TRP OXT HXT sing N N 353 TYR N CA sing N N 354 TYR N H sing N N 355 TYR N H2 sing N N 356 TYR CA C sing N N 357 TYR CA CB sing N N 358 TYR CA HA sing N N 359 TYR C O doub N N 360 TYR C OXT sing N N 361 TYR CB CG sing N N 362 TYR CB HB2 sing N N 363 TYR CB HB3 sing N N 364 TYR CG CD1 doub Y N 365 TYR CG CD2 sing Y N 366 TYR CD1 CE1 sing Y N 367 TYR CD1 HD1 sing N N 368 TYR CD2 CE2 doub Y N 369 TYR CD2 HD2 sing N N 370 TYR CE1 CZ doub Y N 371 TYR CE1 HE1 sing N N 372 TYR CE2 CZ sing Y N 373 TYR CE2 HE2 sing N N 374 TYR CZ OH sing N N 375 TYR OH HH sing N N 376 TYR OXT HXT sing N N 377 VAL N CA sing N N 378 VAL N H sing N N 379 VAL N H2 sing N N 380 VAL CA C sing N N 381 VAL CA CB sing N N 382 VAL CA HA sing N N 383 VAL C O doub N N 384 VAL C OXT sing N N 385 VAL CB CG1 sing N N 386 VAL CB CG2 sing N N 387 VAL CB HB sing N N 388 VAL CG1 HG11 sing N N 389 VAL CG1 HG12 sing N N 390 VAL CG1 HG13 sing N N 391 VAL CG2 HG21 sing N N 392 VAL CG2 HG22 sing N N 393 VAL CG2 HG23 sing N N 394 VAL OXT HXT sing N N 395 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5BXX _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 5ONO _atom_sites.fract_transf_matrix[1][1] 0.014002 _atom_sites.fract_transf_matrix[1][2] 0.008084 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016168 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014527 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O S # loop_