data_5PB7 # _entry.id 5PB7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5PB7 WWPDB D_1001400443 # _pdbx_database_status.entry_id 5PB7 _pdbx_database_status.status_code REL _pdbx_database_status.recvd_initial_deposition_date 2017-02-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pearce, N.M.' 1 'Krojer, T.' 2 'Talon, R.' 3 'Bradley, A.R.' 4 'Fairhead, M.' 5 'Sethi, R.' 6 'Wright, N.' 7 'MacLean, E.' 8 'Collins, P.' 9 'Brandao-Neto, J.' 10 'Douangamath, A.' 11 'Renjie, Z.' 12 'Dias, A.' 13 'Vollmar, M.' 14 'Ng, J.' 15 'Brennan, P.E.' 16 'Cox, O.' 17 'Bountra, C.' 18 'Arrowsmith, C.H.' 19 'Edwards, A.' 20 'von Delft, F.' 21 # _citation.id primary _citation.title 'A multi-crystal method for extracting obscured crystallographic states from conventionally uninterpretable electron density.' _citation.journal_abbrev 'Nat Commun' _citation.journal_volume 8 _citation.page_first 15123 _citation.page_last 15123 _citation.year 2017 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2041-1723 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 28436492 _citation.pdbx_database_id_DOI 10.1038/ncomms15123 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Pearce, N.M.' 1 primary 'Krojer, T.' 2 primary 'Bradley, A.R.' 3 primary 'Collins, P.' 4 primary 'Nowak, R.P.' 5 primary 'Talon, R.' 6 primary 'Marsden, B.D.' 7 primary 'Kelm, S.' 8 primary 'Shi, J.' 9 primary 'Deane, C.M.' 10 primary 'von Delft, F.' 11 # _cell.entry_id 5PB7 _cell.length_a 81.403 _cell.length_b 96.831 _cell.length_c 57.784 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5PB7 _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bromodomain adjacent to zinc finger domain protein 2B' 16090.326 1 ? ? ? ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 3 ? ? ? ? 3 non-polymer syn '1~{H}-indazol-5-amine' 133.151 1 ? ? ? ? 4 water nat water 18.015 205 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name hWALp4 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGVDLGTENLYFQSMSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTI REKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKKWTDTFKVS ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGVDLGTENLYFQSMSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTI REKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKKWTDTFKVS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 VAL n 1 12 ASP n 1 13 LEU n 1 14 GLY n 1 15 THR n 1 16 GLU n 1 17 ASN n 1 18 LEU n 1 19 TYR n 1 20 PHE n 1 21 GLN n 1 22 SER n 1 23 MET n 1 24 SER n 1 25 VAL n 1 26 LYS n 1 27 LYS n 1 28 PRO n 1 29 LYS n 1 30 ARG n 1 31 ASP n 1 32 ASP n 1 33 SER n 1 34 LYS n 1 35 ASP n 1 36 LEU n 1 37 ALA n 1 38 LEU n 1 39 CYS n 1 40 SER n 1 41 MET n 1 42 ILE n 1 43 LEU n 1 44 THR n 1 45 GLU n 1 46 MET n 1 47 GLU n 1 48 THR n 1 49 HIS n 1 50 GLU n 1 51 ASP n 1 52 ALA n 1 53 TRP n 1 54 PRO n 1 55 PHE n 1 56 LEU n 1 57 LEU n 1 58 PRO n 1 59 VAL n 1 60 ASN n 1 61 LEU n 1 62 LYS n 1 63 LEU n 1 64 VAL n 1 65 PRO n 1 66 GLY n 1 67 TYR n 1 68 LYS n 1 69 LYS n 1 70 VAL n 1 71 ILE n 1 72 LYS n 1 73 LYS n 1 74 PRO n 1 75 MET n 1 76 ASP n 1 77 PHE n 1 78 SER n 1 79 THR n 1 80 ILE n 1 81 ARG n 1 82 GLU n 1 83 LYS n 1 84 LEU n 1 85 SER n 1 86 SER n 1 87 GLY n 1 88 GLN n 1 89 TYR n 1 90 PRO n 1 91 ASN n 1 92 LEU n 1 93 GLU n 1 94 THR n 1 95 PHE n 1 96 ALA n 1 97 LEU n 1 98 ASP n 1 99 VAL n 1 100 ARG n 1 101 LEU n 1 102 VAL n 1 103 PHE n 1 104 ASP n 1 105 ASN n 1 106 CYS n 1 107 GLU n 1 108 THR n 1 109 PHE n 1 110 ASN n 1 111 GLU n 1 112 ASP n 1 113 ASP n 1 114 SER n 1 115 ASP n 1 116 ILE n 1 117 GLY n 1 118 ARG n 1 119 ALA n 1 120 GLY n 1 121 HIS n 1 122 ASN n 1 123 MET n 1 124 ARG n 1 125 LYS n 1 126 TYR n 1 127 PHE n 1 128 GLU n 1 129 LYS n 1 130 LYS n 1 131 TRP n 1 132 THR n 1 133 ASP n 1 134 THR n 1 135 PHE n 1 136 LYS n 1 137 VAL n 1 138 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 138 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BAZ2B, KIAA1476' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BAZ2B_HUMAN _struct_ref.pdbx_db_accession Q9UIF8 _struct_ref.pdbx_db_isoform Q9UIF8-2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTIREKLSSGQYPNLETFALDVRLVF DNCETFNEDDSDIGRAGHNMRKYFEKKWTDTFKVS ; _struct_ref.pdbx_align_begin 1954 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5PB7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 24 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 138 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UIF8 _struct_ref_seq.db_align_beg 1954 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 2068 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1858 _struct_ref_seq.pdbx_auth_seq_align_end 1972 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5PB7 MET A 1 ? UNP Q9UIF8 ? ? 'expression tag' 1835 1 1 5PB7 HIS A 2 ? UNP Q9UIF8 ? ? 'expression tag' 1836 2 1 5PB7 HIS A 3 ? UNP Q9UIF8 ? ? 'expression tag' 1837 3 1 5PB7 HIS A 4 ? UNP Q9UIF8 ? ? 'expression tag' 1838 4 1 5PB7 HIS A 5 ? UNP Q9UIF8 ? ? 'expression tag' 1839 5 1 5PB7 HIS A 6 ? UNP Q9UIF8 ? ? 'expression tag' 1840 6 1 5PB7 HIS A 7 ? UNP Q9UIF8 ? ? 'expression tag' 1841 7 1 5PB7 SER A 8 ? UNP Q9UIF8 ? ? 'expression tag' 1842 8 1 5PB7 SER A 9 ? UNP Q9UIF8 ? ? 'expression tag' 1843 9 1 5PB7 GLY A 10 ? UNP Q9UIF8 ? ? 'expression tag' 1844 10 1 5PB7 VAL A 11 ? UNP Q9UIF8 ? ? 'expression tag' 1845 11 1 5PB7 ASP A 12 ? UNP Q9UIF8 ? ? 'expression tag' 1846 12 1 5PB7 LEU A 13 ? UNP Q9UIF8 ? ? 'expression tag' 1847 13 1 5PB7 GLY A 14 ? UNP Q9UIF8 ? ? 'expression tag' 1848 14 1 5PB7 THR A 15 ? UNP Q9UIF8 ? ? 'expression tag' 1849 15 1 5PB7 GLU A 16 ? UNP Q9UIF8 ? ? 'expression tag' 1850 16 1 5PB7 ASN A 17 ? UNP Q9UIF8 ? ? 'expression tag' 1851 17 1 5PB7 LEU A 18 ? UNP Q9UIF8 ? ? 'expression tag' 1852 18 1 5PB7 TYR A 19 ? UNP Q9UIF8 ? ? 'expression tag' 1853 19 1 5PB7 PHE A 20 ? UNP Q9UIF8 ? ? 'expression tag' 1854 20 1 5PB7 GLN A 21 ? UNP Q9UIF8 ? ? 'expression tag' 1855 21 1 5PB7 SER A 22 ? UNP Q9UIF8 ? ? 'expression tag' 1856 22 1 5PB7 MET A 23 ? UNP Q9UIF8 ? ? 'expression tag' 1857 23 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 8H4 non-polymer . '1~{H}-indazol-5-amine' ? 'C7 H7 N3' 133.151 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 5PB7 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.pdbx_mosaicity 0.160 _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.density_Matthews 3.54 _exptl_crystal.density_diffrn ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_percent_sol 65.24 _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 7 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.pdbx_details '30% PEG600 -- 0.1M MES pH 6.0' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.crystal_id 1 _diffrn.ambient_temp_details ? # _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.pdbx_collection_date 2013-03-10 _diffrn_detector.diffrn_id 1 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9200 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.pdbx_wavelength_list 0.9200 _diffrn_source.pdbx_synchrotron_site Diamond _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_wavelength ? # _reflns.entry_id 5PB7 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 28.890 _reflns.d_resolution_high 1.650 _reflns.number_obs 25139 _reflns.number_all ? _reflns.percent_possible_obs 91.100 _reflns.pdbx_Rmerge_I_obs 0.070 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 14.000 _reflns.B_iso_Wilson_estimate 27.890 _reflns.pdbx_redundancy 6.900 _reflns.pdbx_Rrim_I_all 0.076 _reflns.pdbx_Rpim_I_all 0.029 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_number_measured_all 173049 _reflns.pdbx_scaling_rejects 0 _reflns.pdbx_chi_squared ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.details ? # loop_ _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_CC_half 1 1 1.650 1.680 ? 4184 ? ? 0.996 ? ? ? 5.000 ? 1.400 ? 839 ? ? ? ? 60.700 1.104 0.462 0.736 1 2 8.900 28.890 ? 1262 ? ? 0.034 ? ? ? 6.200 ? 37.700 ? 204 ? ? ? ? 96.900 0.037 0.014 0.999 # _refine.entry_id 5PB7 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 1.6550 _refine.ls_d_res_low 28.890 _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 90.8500 _refine.ls_number_reflns_obs 25100 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details ? _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1785 _refine.ls_R_factor_R_work 0.1772 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2031 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.0100 _refine.ls_number_reflns_R_free 1257 _refine.ls_number_reflns_R_work 23843 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 34.0056 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.2400 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 3G0L _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 86.110 _refine.B_iso_min 17.060 _refine.pdbx_overall_phase_error 24.1100 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.6550 _refine_hist.d_res_low 28.890 _refine_hist.pdbx_number_atoms_ligand 45 _refine_hist.number_atoms_solvent 207 _refine_hist.number_atoms_total 1178 _refine_hist.pdbx_number_residues_total 115 _refine_hist.pdbx_B_iso_mean_ligand 45.58 _refine_hist.pdbx_B_iso_mean_solvent 47.81 _refine_hist.pdbx_number_atoms_protein 926 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' f_bond_d 1050 0.007 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 1419 1.000 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 151 0.040 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 184 0.004 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 426 13.162 ? ? ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id 1.6547 1.7209 9 79.0000 2271 . 0.3417 0.3928 . 123 . 2394 . 'X-RAY DIFFRACTION' 1.7209 1.7992 9 94.0000 2694 . 0.2812 0.3122 . 141 . 2835 . 'X-RAY DIFFRACTION' 1.7992 1.8941 9 93.0000 2659 . 0.2432 0.2755 . 162 . 2821 . 'X-RAY DIFFRACTION' 1.8941 2.0127 9 93.0000 2702 . 0.2074 0.2328 . 127 . 2829 . 'X-RAY DIFFRACTION' 2.0127 2.1681 9 92.0000 2642 . 0.1845 0.2442 . 140 . 2782 . 'X-RAY DIFFRACTION' 2.1681 2.3861 9 85.0000 2474 . 0.1772 0.2150 . 129 . 2603 . 'X-RAY DIFFRACTION' 2.3861 2.7312 9 96.0000 2819 . 0.1720 0.1901 . 125 . 2944 . 'X-RAY DIFFRACTION' 2.7312 3.4401 9 94.0000 2758 . 0.1720 0.1955 . 164 . 2922 . 'X-RAY DIFFRACTION' 3.4401 28.8964 9 92.0000 2824 . 0.1528 0.1717 . 146 . 2970 . 'X-RAY DIFFRACTION' # _struct.entry_id 5PB7 _struct.title 'PanDDA analysis group deposition -- Crystal Structure of BAZ2B in complex with N09440a' _struct.pdbx_descriptor 'Bromodomain adjacent to zinc finger domain protein 2B' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 5PB7 _struct_keywords.text 'PanDDA, SGC - Diamond I04-1 fragment screening, bromodomain, epigenetics, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 34 ? THR A 48 ? LYS A 1868 THR A 1882 1 ? 15 HELX_P HELX_P2 AA2 HIS A 49 ? LEU A 56 ? HIS A 1883 LEU A 1890 5 ? 8 HELX_P HELX_P3 AA3 GLY A 66 ? ILE A 71 ? GLY A 1900 ILE A 1905 1 ? 6 HELX_P HELX_P4 AA4 ASP A 76 ? SER A 86 ? ASP A 1910 SER A 1920 1 ? 11 HELX_P HELX_P5 AA5 ASN A 91 ? ASN A 110 ? ASN A 1925 ASN A 1944 1 ? 20 HELX_P HELX_P6 AA6 SER A 114 ? LYS A 136 ? SER A 1948 LYS A 1970 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A EDO 2001 ? 8 'binding site for residue EDO A 2001' AC2 Software A EDO 2002 ? 8 'binding site for residue EDO A 2002' AC3 Software A EDO 2003 ? 2 'binding site for residue EDO A 2003' AC4 Software A 8H4 2004 ? 9 'binding site for residue 8H4 A 2004' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 TYR A 67 ? TYR A 1901 . ? 1_555 ? 2 AC1 8 CYS A 106 ? CYS A 1940 . ? 1_555 ? 3 AC1 8 PHE A 109 ? PHE A 1943 . ? 1_555 ? 4 AC1 8 ASN A 110 ? ASN A 1944 . ? 1_555 ? 5 AC1 8 ILE A 116 ? ILE A 1950 . ? 1_555 ? 6 AC1 8 8H4 E . ? 8H4 A 2004 . ? 1_555 ? 7 AC1 8 HOH F . ? HOH A 2102 . ? 1_555 ? 8 AC1 8 HOH F . ? HOH A 2110 . ? 1_555 ? 9 AC2 8 8H4 E . ? 8H4 A 2004 . ? 1_555 ? 10 AC2 8 HOH F . ? HOH A 2107 . ? 1_555 ? 11 AC2 8 HOH F . ? HOH A 2213 . ? 1_555 ? 12 AC2 8 HOH F . ? HOH A 2245 . ? 1_555 ? 13 AC2 8 HOH F . ? HOH A 2266 . ? 1_555 ? 14 AC2 8 HOH F . ? HOH A 2281 . ? 1_555 ? 15 AC2 8 HOH F . ? HOH A 2286 . ? 1_555 ? 16 AC2 8 HOH F . ? HOH A 2301 . ? 1_555 ? 17 AC3 2 GLU A 45 ? GLU A 1879 . ? 1_555 ? 18 AC3 2 THR A 134 ? THR A 1968 . ? 1_555 ? 19 AC4 9 PRO A 65 ? PRO A 1899 . ? 4_566 ? 20 AC4 9 ASN A 110 ? ASN A 1944 . ? 1_555 ? 21 AC4 9 ILE A 116 ? ILE A 1950 . ? 1_555 ? 22 AC4 9 EDO B . ? EDO A 2001 . ? 1_555 ? 23 AC4 9 EDO C . ? EDO A 2002 . ? 1_555 ? 24 AC4 9 HOH F . ? HOH A 2235 . ? 1_555 ? 25 AC4 9 HOH F . ? HOH A 2281 . ? 1_555 ? 26 AC4 9 HOH F . ? HOH A 2286 . ? 1_555 ? 27 AC4 9 HOH F . ? HOH A 2290 . ? 1_555 ? # _atom_sites.entry_id 5PB7 _atom_sites.fract_transf_matrix[1][1] 0.012285 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010327 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017306 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1835 ? ? ? A . n A 1 2 HIS 2 1836 ? ? ? A . n A 1 3 HIS 3 1837 ? ? ? A . n A 1 4 HIS 4 1838 ? ? ? A . n A 1 5 HIS 5 1839 ? ? ? A . n A 1 6 HIS 6 1840 ? ? ? A . n A 1 7 HIS 7 1841 ? ? ? A . n A 1 8 SER 8 1842 ? ? ? A . n A 1 9 SER 9 1843 ? ? ? A . n A 1 10 GLY 10 1844 ? ? ? A . n A 1 11 VAL 11 1845 ? ? ? A . n A 1 12 ASP 12 1846 ? ? ? A . n A 1 13 LEU 13 1847 ? ? ? A . n A 1 14 GLY 14 1848 ? ? ? A . n A 1 15 THR 15 1849 ? ? ? A . n A 1 16 GLU 16 1850 ? ? ? A . n A 1 17 ASN 17 1851 ? ? ? A . n A 1 18 LEU 18 1852 ? ? ? A . n A 1 19 TYR 19 1853 ? ? ? A . n A 1 20 PHE 20 1854 ? ? ? A . n A 1 21 GLN 21 1855 ? ? ? A . n A 1 22 SER 22 1856 1856 SER SER A . n A 1 23 MET 23 1857 1857 MET MET A . n A 1 24 SER 24 1858 1858 SER SER A . n A 1 25 VAL 25 1859 1859 VAL VAL A . n A 1 26 LYS 26 1860 1860 LYS LYS A . n A 1 27 LYS 27 1861 1861 LYS LYS A . n A 1 28 PRO 28 1862 1862 PRO PRO A . n A 1 29 LYS 29 1863 1863 LYS LYS A . n A 1 30 ARG 30 1864 1864 ARG ARG A . n A 1 31 ASP 31 1865 1865 ASP ASP A . n A 1 32 ASP 32 1866 1866 ASP ASP A . n A 1 33 SER 33 1867 1867 SER SER A . n A 1 34 LYS 34 1868 1868 LYS LYS A . n A 1 35 ASP 35 1869 1869 ASP ASP A . n A 1 36 LEU 36 1870 1870 LEU LEU A . n A 1 37 ALA 37 1871 1871 ALA ALA A . n A 1 38 LEU 38 1872 1872 LEU LEU A . n A 1 39 CYS 39 1873 1873 CYS CYS A . n A 1 40 SER 40 1874 1874 SER SER A . n A 1 41 MET 41 1875 1875 MET MET A . n A 1 42 ILE 42 1876 1876 ILE ILE A . n A 1 43 LEU 43 1877 1877 LEU LEU A . n A 1 44 THR 44 1878 1878 THR THR A . n A 1 45 GLU 45 1879 1879 GLU GLU A . n A 1 46 MET 46 1880 1880 MET MET A . n A 1 47 GLU 47 1881 1881 GLU GLU A . n A 1 48 THR 48 1882 1882 THR THR A . n A 1 49 HIS 49 1883 1883 HIS HIS A . n A 1 50 GLU 50 1884 1884 GLU GLU A . n A 1 51 ASP 51 1885 1885 ASP ASP A . n A 1 52 ALA 52 1886 1886 ALA ALA A . n A 1 53 TRP 53 1887 1887 TRP TRP A . n A 1 54 PRO 54 1888 1888 PRO PRO A . n A 1 55 PHE 55 1889 1889 PHE PHE A . n A 1 56 LEU 56 1890 1890 LEU LEU A . n A 1 57 LEU 57 1891 1891 LEU LEU A . n A 1 58 PRO 58 1892 1892 PRO PRO A . n A 1 59 VAL 59 1893 1893 VAL VAL A . n A 1 60 ASN 60 1894 1894 ASN ASN A . n A 1 61 LEU 61 1895 1895 LEU LEU A . n A 1 62 LYS 62 1896 1896 LYS LYS A . n A 1 63 LEU 63 1897 1897 LEU LEU A . n A 1 64 VAL 64 1898 1898 VAL VAL A . n A 1 65 PRO 65 1899 1899 PRO PRO A . n A 1 66 GLY 66 1900 1900 GLY GLY A . n A 1 67 TYR 67 1901 1901 TYR TYR A . n A 1 68 LYS 68 1902 1902 LYS LYS A . n A 1 69 LYS 69 1903 1903 LYS LYS A . n A 1 70 VAL 70 1904 1904 VAL VAL A . n A 1 71 ILE 71 1905 1905 ILE ILE A . n A 1 72 LYS 72 1906 1906 LYS LYS A . n A 1 73 LYS 73 1907 1907 LYS LYS A . n A 1 74 PRO 74 1908 1908 PRO PRO A . n A 1 75 MET 75 1909 1909 MET MET A . n A 1 76 ASP 76 1910 1910 ASP ASP A . n A 1 77 PHE 77 1911 1911 PHE PHE A . n A 1 78 SER 78 1912 1912 SER SER A . n A 1 79 THR 79 1913 1913 THR THR A . n A 1 80 ILE 80 1914 1914 ILE ILE A . n A 1 81 ARG 81 1915 1915 ARG ARG A . n A 1 82 GLU 82 1916 1916 GLU GLU A . n A 1 83 LYS 83 1917 1917 LYS LYS A . n A 1 84 LEU 84 1918 1918 LEU LEU A . n A 1 85 SER 85 1919 1919 SER SER A . n A 1 86 SER 86 1920 1920 SER SER A . n A 1 87 GLY 87 1921 1921 GLY GLY A . n A 1 88 GLN 88 1922 1922 GLN GLN A . n A 1 89 TYR 89 1923 1923 TYR TYR A . n A 1 90 PRO 90 1924 1924 PRO PRO A . n A 1 91 ASN 91 1925 1925 ASN ASN A . n A 1 92 LEU 92 1926 1926 LEU LEU A . n A 1 93 GLU 93 1927 1927 GLU GLU A . n A 1 94 THR 94 1928 1928 THR THR A . n A 1 95 PHE 95 1929 1929 PHE PHE A . n A 1 96 ALA 96 1930 1930 ALA ALA A . n A 1 97 LEU 97 1931 1931 LEU LEU A . n A 1 98 ASP 98 1932 1932 ASP ASP A . n A 1 99 VAL 99 1933 1933 VAL VAL A . n A 1 100 ARG 100 1934 1934 ARG ARG A . n A 1 101 LEU 101 1935 1935 LEU LEU A . n A 1 102 VAL 102 1936 1936 VAL VAL A . n A 1 103 PHE 103 1937 1937 PHE PHE A . n A 1 104 ASP 104 1938 1938 ASP ASP A . n A 1 105 ASN 105 1939 1939 ASN ASN A . n A 1 106 CYS 106 1940 1940 CYS CYS A . n A 1 107 GLU 107 1941 1941 GLU GLU A . n A 1 108 THR 108 1942 1942 THR THR A . n A 1 109 PHE 109 1943 1943 PHE PHE A . n A 1 110 ASN 110 1944 1944 ASN ASN A . n A 1 111 GLU 111 1945 1945 GLU GLU A . n A 1 112 ASP 112 1946 1946 ASP ASP A . n A 1 113 ASP 113 1947 1947 ASP ASP A . n A 1 114 SER 114 1948 1948 SER SER A . n A 1 115 ASP 115 1949 1949 ASP ASP A . n A 1 116 ILE 116 1950 1950 ILE ILE A . n A 1 117 GLY 117 1951 1951 GLY GLY A . n A 1 118 ARG 118 1952 1952 ARG ARG A . n A 1 119 ALA 119 1953 1953 ALA ALA A . n A 1 120 GLY 120 1954 1954 GLY GLY A . n A 1 121 HIS 121 1955 1955 HIS HIS A . n A 1 122 ASN 122 1956 1956 ASN ASN A . n A 1 123 MET 123 1957 1957 MET MET A . n A 1 124 ARG 124 1958 1958 ARG ARG A . n A 1 125 LYS 125 1959 1959 LYS LYS A . n A 1 126 TYR 126 1960 1960 TYR TYR A . n A 1 127 PHE 127 1961 1961 PHE PHE A . n A 1 128 GLU 128 1962 1962 GLU GLU A . n A 1 129 LYS 129 1963 1963 LYS LYS A . n A 1 130 LYS 130 1964 1964 LYS LYS A . n A 1 131 TRP 131 1965 1965 TRP TRP A . n A 1 132 THR 132 1966 1966 THR THR A . n A 1 133 ASP 133 1967 1967 ASP ASP A . n A 1 134 THR 134 1968 1968 THR THR A . n A 1 135 PHE 135 1969 1969 PHE PHE A . n A 1 136 LYS 136 1970 1970 LYS LYS A . n A 1 137 VAL 137 1971 ? ? ? A . n A 1 138 SER 138 1972 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 2001 1 EDO EDO A . C 2 EDO 1 2002 2 EDO EDO A . D 2 EDO 1 2003 3 EDO EDO A . E 3 8H4 1 2004 1 8H4 LIG A . F 4 HOH 1 2101 84 HOH HOH A . F 4 HOH 2 2102 38 HOH HOH A . F 4 HOH 3 2103 72 HOH HOH A . F 4 HOH 4 2104 100 HOH HOH A . F 4 HOH 5 2105 21 HOH HOH A . F 4 HOH 6 2106 114 HOH HOH A . F 4 HOH 7 2107 22 HOH HOH A . F 4 HOH 8 2108 169 HOH HOH A . F 4 HOH 9 2109 36 HOH HOH A . F 4 HOH 10 2110 19 HOH HOH A . F 4 HOH 11 2111 74 HOH HOH A . F 4 HOH 12 2112 92 HOH HOH A . F 4 HOH 13 2113 44 HOH HOH A . F 4 HOH 14 2114 40 HOH HOH A . F 4 HOH 15 2115 14 HOH HOH A . F 4 HOH 16 2116 146 HOH HOH A . F 4 HOH 17 2117 37 HOH HOH A . F 4 HOH 18 2118 20 HOH HOH A . F 4 HOH 19 2119 107 HOH HOH A . F 4 HOH 20 2120 39 HOH HOH A . F 4 HOH 21 2121 32 HOH HOH A . F 4 HOH 22 2122 34 HOH HOH A . F 4 HOH 23 2123 47 HOH HOH A . F 4 HOH 24 2124 61 HOH HOH A . F 4 HOH 25 2125 208 HOH HOH A . F 4 HOH 26 2126 26 HOH HOH A . F 4 HOH 27 2127 70 HOH HOH A . F 4 HOH 28 2128 2 HOH HOH A . F 4 HOH 29 2129 88 HOH HOH A . F 4 HOH 30 2130 46 HOH HOH A . F 4 HOH 31 2131 93 HOH HOH A . F 4 HOH 32 2132 68 HOH HOH A . F 4 HOH 33 2133 139 HOH HOH A . F 4 HOH 34 2134 73 HOH HOH A . F 4 HOH 35 2135 52 HOH HOH A . F 4 HOH 36 2136 163 HOH HOH A . F 4 HOH 37 2137 7 HOH HOH A . F 4 HOH 38 2138 6 HOH HOH A . F 4 HOH 39 2139 10 HOH HOH A . F 4 HOH 40 2140 23 HOH HOH A . F 4 HOH 41 2141 45 HOH HOH A . F 4 HOH 42 2142 152 HOH HOH A . F 4 HOH 43 2143 35 HOH HOH A . F 4 HOH 44 2144 75 HOH HOH A . F 4 HOH 45 2145 91 HOH HOH A . F 4 HOH 46 2146 62 HOH HOH A . F 4 HOH 47 2147 41 HOH HOH A . F 4 HOH 48 2148 9 HOH HOH A . F 4 HOH 49 2149 145 HOH HOH A . F 4 HOH 50 2150 48 HOH HOH A . F 4 HOH 51 2151 90 HOH HOH A . F 4 HOH 52 2152 5 HOH HOH A . F 4 HOH 53 2153 182 HOH HOH A . F 4 HOH 54 2154 51 HOH HOH A . F 4 HOH 55 2155 4 HOH HOH A . F 4 HOH 56 2156 16 HOH HOH A . F 4 HOH 57 2157 193 HOH HOH A . F 4 HOH 58 2158 76 HOH HOH A . F 4 HOH 59 2159 80 HOH HOH A . F 4 HOH 60 2160 189 HOH HOH A . F 4 HOH 61 2161 25 HOH HOH A . F 4 HOH 62 2162 190 HOH HOH A . F 4 HOH 63 2163 206 HOH HOH A . F 4 HOH 64 2164 81 HOH HOH A . F 4 HOH 65 2165 30 HOH HOH A . F 4 HOH 66 2166 28 HOH HOH A . F 4 HOH 67 2167 144 HOH HOH A . F 4 HOH 68 2168 137 HOH HOH A . F 4 HOH 69 2169 54 HOH HOH A . F 4 HOH 70 2170 149 HOH HOH A . F 4 HOH 71 2171 174 HOH HOH A . F 4 HOH 72 2172 17 HOH HOH A . F 4 HOH 73 2173 27 HOH HOH A . F 4 HOH 74 2174 15 HOH HOH A . F 4 HOH 75 2175 148 HOH HOH A . F 4 HOH 76 2176 1 HOH HOH A . F 4 HOH 77 2177 117 HOH HOH A . F 4 HOH 78 2178 196 HOH HOH A . F 4 HOH 79 2179 209 HOH HOH A . F 4 HOH 80 2180 120 HOH HOH A . F 4 HOH 81 2181 18 HOH HOH A . F 4 HOH 82 2182 63 HOH HOH A . F 4 HOH 83 2183 105 HOH HOH A . F 4 HOH 84 2184 56 HOH HOH A . F 4 HOH 85 2185 12 HOH HOH A . F 4 HOH 86 2186 57 HOH HOH A . F 4 HOH 87 2187 166 HOH HOH A . F 4 HOH 88 2188 53 HOH HOH A . F 4 HOH 89 2189 158 HOH HOH A . F 4 HOH 90 2190 207 HOH HOH A . F 4 HOH 91 2191 191 HOH HOH A . F 4 HOH 92 2192 24 HOH HOH A . F 4 HOH 93 2193 50 HOH HOH A . F 4 HOH 94 2194 64 HOH HOH A . F 4 HOH 95 2195 106 HOH HOH A . F 4 HOH 96 2196 77 HOH HOH A . F 4 HOH 97 2197 164 HOH HOH A . F 4 HOH 98 2198 171 HOH HOH A . F 4 HOH 99 2199 173 HOH HOH A . F 4 HOH 100 2200 170 HOH HOH A . F 4 HOH 101 2201 33 HOH HOH A . F 4 HOH 102 2202 65 HOH HOH A . F 4 HOH 103 2203 85 HOH HOH A . F 4 HOH 104 2204 172 HOH HOH A . F 4 HOH 105 2205 66 HOH HOH A . F 4 HOH 106 2206 8 HOH HOH A . F 4 HOH 107 2207 11 HOH HOH A . F 4 HOH 108 2208 29 HOH HOH A . F 4 HOH 109 2209 156 HOH HOH A . F 4 HOH 110 2210 154 HOH HOH A . F 4 HOH 111 2211 59 HOH HOH A . F 4 HOH 112 2212 126 HOH HOH A . F 4 HOH 113 2213 101 HOH HOH A . F 4 HOH 114 2214 95 HOH HOH A . F 4 HOH 115 2215 3 HOH HOH A . F 4 HOH 116 2216 98 HOH HOH A . F 4 HOH 117 2217 205 HOH HOH A . F 4 HOH 118 2218 103 HOH HOH A . F 4 HOH 119 2219 147 HOH HOH A . F 4 HOH 120 2220 83 HOH HOH A . F 4 HOH 121 2221 201 HOH HOH A . F 4 HOH 122 2222 181 HOH HOH A . F 4 HOH 123 2223 138 HOH HOH A . F 4 HOH 124 2224 113 HOH HOH A . F 4 HOH 125 2225 178 HOH HOH A . F 4 HOH 126 2226 160 HOH HOH A . F 4 HOH 127 2227 124 HOH HOH A . F 4 HOH 128 2228 162 HOH HOH A . F 4 HOH 129 2229 99 HOH HOH A . F 4 HOH 130 2230 153 HOH HOH A . F 4 HOH 131 2231 82 HOH HOH A . F 4 HOH 132 2232 69 HOH HOH A . F 4 HOH 133 2233 157 HOH HOH A . F 4 HOH 134 2234 132 HOH HOH A . F 4 HOH 135 2235 129 HOH HOH A . F 4 HOH 136 2236 188 HOH HOH A . F 4 HOH 137 2237 168 HOH HOH A . F 4 HOH 138 2238 143 HOH HOH A . F 4 HOH 139 2239 130 HOH HOH A . F 4 HOH 140 2240 194 HOH HOH A . F 4 HOH 141 2241 185 HOH HOH A . F 4 HOH 142 2242 97 HOH HOH A . F 4 HOH 143 2243 108 HOH HOH A . F 4 HOH 144 2244 141 HOH HOH A . F 4 HOH 145 2245 135 HOH HOH A . F 4 HOH 146 2246 123 HOH HOH A . F 4 HOH 147 2247 187 HOH HOH A . F 4 HOH 148 2248 161 HOH HOH A . F 4 HOH 149 2249 119 HOH HOH A . F 4 HOH 150 2250 176 HOH HOH A . F 4 HOH 151 2251 31 HOH HOH A . F 4 HOH 152 2252 43 HOH HOH A . F 4 HOH 153 2253 102 HOH HOH A . F 4 HOH 154 2254 192 HOH HOH A . F 4 HOH 155 2255 96 HOH HOH A . F 4 HOH 156 2256 60 HOH HOH A . F 4 HOH 157 2257 49 HOH HOH A . F 4 HOH 158 2258 198 HOH HOH A . F 4 HOH 159 2259 199 HOH HOH A . F 4 HOH 160 2260 112 HOH HOH A . F 4 HOH 161 2261 183 HOH HOH A . F 4 HOH 162 2262 151 HOH HOH A . F 4 HOH 163 2263 195 HOH HOH A . F 4 HOH 164 2264 71 HOH HOH A . F 4 HOH 165 2265 150 HOH HOH A . F 4 HOH 166 2266 134 HOH HOH A . F 4 HOH 167 2267 184 HOH HOH A . F 4 HOH 168 2268 86 HOH HOH A . F 4 HOH 169 2269 79 HOH HOH A . F 4 HOH 170 2270 58 HOH HOH A . F 4 HOH 171 2271 202 HOH HOH A . F 4 HOH 172 2272 128 HOH HOH A . F 4 HOH 173 2273 110 HOH HOH A . F 4 HOH 174 2274 94 HOH HOH A . F 4 HOH 175 2275 89 HOH HOH A . F 4 HOH 176 2276 136 HOH HOH A . F 4 HOH 177 2277 104 HOH HOH A . F 4 HOH 178 2278 55 HOH HOH A . F 4 HOH 179 2279 42 HOH HOH A . F 4 HOH 180 2280 155 HOH HOH A . F 4 HOH 181 2281 115 HOH HOH A . F 4 HOH 182 2282 118 HOH HOH A . F 4 HOH 183 2283 78 HOH HOH A . F 4 HOH 184 2284 87 HOH HOH A . F 4 HOH 185 2285 111 HOH HOH A . F 4 HOH 186 2286 127 HOH HOH A . F 4 HOH 187 2287 109 HOH HOH A . F 4 HOH 188 2288 180 HOH HOH A . F 4 HOH 189 2289 159 HOH HOH A . F 4 HOH 190 2290 121 HOH HOH A . F 4 HOH 191 2291 197 HOH HOH A . F 4 HOH 192 2292 186 HOH HOH A . F 4 HOH 193 2293 165 HOH HOH A . F 4 HOH 194 2294 179 HOH HOH A . F 4 HOH 195 2295 67 HOH HOH A . F 4 HOH 196 2296 204 HOH HOH A . F 4 HOH 197 2297 140 HOH HOH A . F 4 HOH 198 2298 131 HOH HOH A . F 4 HOH 199 2299 177 HOH HOH A . F 4 HOH 200 2300 175 HOH HOH A . F 4 HOH 201 2301 142 HOH HOH A . F 4 HOH 202 2302 122 HOH HOH A . F 4 HOH 203 2303 203 HOH HOH A . F 4 HOH 204 2304 133 HOH HOH A . F 4 HOH 205 2305 125 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-03-15 2 'Structure model' 1 1 2017-09-27 3 'Structure model' 1 2 2017-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_deposit_group 2 3 'Structure model' pdbx_deposit_group # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_deposit_group.group_id' 2 2 'Structure model' '_pdbx_deposit_group.group_title' 3 2 'Structure model' '_pdbx_deposit_group.group_type' 4 3 'Structure model' '_pdbx_deposit_group.group_title' # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 PHENIX 1.9_1682 ? package 'Paul D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 2 Aimless 0.1.29 21/08/12 program 'Phil Evans' ? 'data scaling' http://www.mrc-lmb.cam.ac.uk/harry/pre/aimless.html ? ? 3 PDB_EXTRACT 3.23 'SEP. 23, 2016' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 4 XDS . ? program ? ? 'data reduction' ? ? ? 5 REFMAC . ? program ? ? phasing ? ? ? # _pdbx_entry_details.nonpolymer_details ; yes c1cc2c(cc1N)cn[nH]2 13.39 42.18 42.18 c1cc2c(cc1N)cn[nH]2 4 - High Confidence None 0.55 40.329 1.3196269744474523 0.93700000000000006 0.156 1.1000000000000001 0.23792835055957454 ; _pdbx_entry_details.entry_id 5PB7 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 2230 ? ? O A HOH 2262 ? ? 2.14 2 1 O A HOH 2231 ? ? O A HOH 2280 ? ? 2.16 3 1 O A HOH 2184 ? ? O A HOH 2208 ? ? 2.18 4 1 O A HOH 2293 ? ? O A HOH 2297 ? ? 2.19 5 1 O A HOH 2107 ? ? O A HOH 2218 ? ? 2.19 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 1947 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id B _pdbx_validate_torsion.phi -100.63 _pdbx_validate_torsion.psi 64.54 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 2300 ? 5.94 . 2 1 O C A HOH 2301 ? . 6.22 3 1 O C A HOH 2302 ? . 6.35 4 1 O ? A HOH 2303 ? 6.89 . 5 1 O ? A HOH 2304 ? 7.20 . 6 1 O ? A HOH 2305 ? 8.07 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 1860 ? CG ? A LYS 26 CG 2 1 Y 1 A LYS 1860 ? CD ? A LYS 26 CD 3 1 Y 1 A LYS 1860 ? CE ? A LYS 26 CE 4 1 Y 1 A LYS 1860 ? NZ ? A LYS 26 NZ 5 1 Y 1 A LYS 1863 ? CG ? A LYS 29 CG 6 1 Y 1 A LYS 1863 ? CD ? A LYS 29 CD 7 1 Y 1 A LYS 1863 ? CE ? A LYS 29 CE 8 1 Y 1 A LYS 1863 ? NZ ? A LYS 29 NZ 9 1 Y 1 A LYS 1868 ? CE ? A LYS 34 CE 10 1 Y 1 A LYS 1868 ? NZ ? A LYS 34 NZ 11 1 Y 1 A LYS 1970 ? CG ? A LYS 136 CG 12 1 Y 1 A LYS 1970 ? CD ? A LYS 136 CD 13 1 Y 1 A LYS 1970 ? CE ? A LYS 136 CE 14 1 Y 1 A LYS 1970 ? NZ ? A LYS 136 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1835 ? A MET 1 2 1 Y 1 A HIS 1836 ? A HIS 2 3 1 Y 1 A HIS 1837 ? A HIS 3 4 1 Y 1 A HIS 1838 ? A HIS 4 5 1 Y 1 A HIS 1839 ? A HIS 5 6 1 Y 1 A HIS 1840 ? A HIS 6 7 1 Y 1 A HIS 1841 ? A HIS 7 8 1 Y 1 A SER 1842 ? A SER 8 9 1 Y 1 A SER 1843 ? A SER 9 10 1 Y 1 A GLY 1844 ? A GLY 10 11 1 Y 1 A VAL 1845 ? A VAL 11 12 1 Y 1 A ASP 1846 ? A ASP 12 13 1 Y 1 A LEU 1847 ? A LEU 13 14 1 Y 1 A GLY 1848 ? A GLY 14 15 1 Y 1 A THR 1849 ? A THR 15 16 1 Y 1 A GLU 1850 ? A GLU 16 17 1 Y 1 A ASN 1851 ? A ASN 17 18 1 Y 1 A LEU 1852 ? A LEU 18 19 1 Y 1 A TYR 1853 ? A TYR 19 20 1 Y 1 A PHE 1854 ? A PHE 20 21 1 Y 1 A GLN 1855 ? A GLN 21 22 1 Y 1 A VAL 1971 ? A VAL 137 23 1 Y 1 A SER 1972 ? A SER 138 # _pdbx_deposit_group.group_id G_1002018 _pdbx_deposit_group.group_description ;bromodomain of human BAZ2B screened against the ZENOBIA Fragment Library by X-ray Crystallography at the XChem facility of Diamond Light Source beamline I04-1. Check out the PanDDA event maps at https://zenodo.org/record/290199/files/0_index.html ; _pdbx_deposit_group.group_title 'PanDDA analysis group deposition of models with modelled events (e.g. bound ligands)' _pdbx_deposit_group.group_type 'changed state' # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 '1~{H}-indazol-5-amine' 8H4 4 water HOH #