data_5T5D # _entry.id 5T5D # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5T5D pdb_00005t5d 10.2210/pdb5t5d/pdb WWPDB D_1000223651 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-10-26 2 'Structure model' 1 1 2017-02-22 3 'Structure model' 1 2 2017-04-26 4 'Structure model' 1 3 2024-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5T5D _pdbx_database_status.recvd_initial_deposition_date 2016-08-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Higgins, M.A.' 1 'Boraston, A.B.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proteins _citation.journal_id_ASTM PSFGEY _citation.journal_id_CSD 0867 _citation.journal_id_ISSN 1097-0134 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 85 _citation.language ? _citation.page_first 963 _citation.page_last 968 _citation.title 'Structural characterization of the PTS IIA and IIB proteins associated with pneumococcal fucose utilization.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/prot.25264 _citation.pdbx_database_id_PubMed 28168775 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Higgins, M.A.' 1 ? primary 'Hamilton, A.M.' 2 ? primary 'Boraston, A.B.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PTS system, IIB component' 18513.504 1 ? ? ? ? 2 water nat water 18.015 57 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMASSIEFVRIDDRLVHGQVVTTWLKKYDIEQVIIVNDRISEDKTRQSILKISAPVGLKIVFFSVKRFVEVLNSVPIK KRTMLIYTNPKDVYDSIEGNLKLEYLNVGQMSKTEENEKVTGGVALGEEDKYYFKKIVDKGTRVEIQMVPNDKVTMLEKF L ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMASSIEFVRIDDRLVHGQVVTTWLKKYDIEQVIIVNDRISEDKTRQSILKISAPVGLKIVFFSVKRFVEVLNSVPIK KRTMLIYTNPKDVYDSIEGNLKLEYLNVGQMSKTEENEKVTGGVALGEEDKYYFKKIVDKGTRVEIQMVPNDKVTMLEKF L ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 SER n 1 7 SER n 1 8 ILE n 1 9 GLU n 1 10 PHE n 1 11 VAL n 1 12 ARG n 1 13 ILE n 1 14 ASP n 1 15 ASP n 1 16 ARG n 1 17 LEU n 1 18 VAL n 1 19 HIS n 1 20 GLY n 1 21 GLN n 1 22 VAL n 1 23 VAL n 1 24 THR n 1 25 THR n 1 26 TRP n 1 27 LEU n 1 28 LYS n 1 29 LYS n 1 30 TYR n 1 31 ASP n 1 32 ILE n 1 33 GLU n 1 34 GLN n 1 35 VAL n 1 36 ILE n 1 37 ILE n 1 38 VAL n 1 39 ASN n 1 40 ASP n 1 41 ARG n 1 42 ILE n 1 43 SER n 1 44 GLU n 1 45 ASP n 1 46 LYS n 1 47 THR n 1 48 ARG n 1 49 GLN n 1 50 SER n 1 51 ILE n 1 52 LEU n 1 53 LYS n 1 54 ILE n 1 55 SER n 1 56 ALA n 1 57 PRO n 1 58 VAL n 1 59 GLY n 1 60 LEU n 1 61 LYS n 1 62 ILE n 1 63 VAL n 1 64 PHE n 1 65 PHE n 1 66 SER n 1 67 VAL n 1 68 LYS n 1 69 ARG n 1 70 PHE n 1 71 VAL n 1 72 GLU n 1 73 VAL n 1 74 LEU n 1 75 ASN n 1 76 SER n 1 77 VAL n 1 78 PRO n 1 79 ILE n 1 80 LYS n 1 81 LYS n 1 82 ARG n 1 83 THR n 1 84 MET n 1 85 LEU n 1 86 ILE n 1 87 TYR n 1 88 THR n 1 89 ASN n 1 90 PRO n 1 91 LYS n 1 92 ASP n 1 93 VAL n 1 94 TYR n 1 95 ASP n 1 96 SER n 1 97 ILE n 1 98 GLU n 1 99 GLY n 1 100 ASN n 1 101 LEU n 1 102 LYS n 1 103 LEU n 1 104 GLU n 1 105 TYR n 1 106 LEU n 1 107 ASN n 1 108 VAL n 1 109 GLY n 1 110 GLN n 1 111 MET n 1 112 SER n 1 113 LYS n 1 114 THR n 1 115 GLU n 1 116 GLU n 1 117 ASN n 1 118 GLU n 1 119 LYS n 1 120 VAL n 1 121 THR n 1 122 GLY n 1 123 GLY n 1 124 VAL n 1 125 ALA n 1 126 LEU n 1 127 GLY n 1 128 GLU n 1 129 GLU n 1 130 ASP n 1 131 LYS n 1 132 TYR n 1 133 TYR n 1 134 PHE n 1 135 LYS n 1 136 LYS n 1 137 ILE n 1 138 VAL n 1 139 ASP n 1 140 LYS n 1 141 GLY n 1 142 THR n 1 143 ARG n 1 144 VAL n 1 145 GLU n 1 146 ILE n 1 147 GLN n 1 148 MET n 1 149 VAL n 1 150 PRO n 1 151 ASN n 1 152 ASP n 1 153 LYS n 1 154 VAL n 1 155 THR n 1 156 MET n 1 157 LEU n 1 158 GLU n 1 159 LYS n 1 160 PHE n 1 161 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 161 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SP_2163 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC BAA-334 / TIGR4' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 170187 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 ? ? ? A . n A 1 2 SER 2 -3 ? ? ? A . n A 1 3 HIS 3 -2 ? ? ? A . n A 1 4 MET 4 -1 ? ? ? A . n A 1 5 ALA 5 0 ? ? ? A . n A 1 6 SER 6 1 ? ? ? A . n A 1 7 SER 7 2 2 SER SER A . n A 1 8 ILE 8 3 3 ILE ILE A . n A 1 9 GLU 9 4 4 GLU GLU A . n A 1 10 PHE 10 5 5 PHE PHE A . n A 1 11 VAL 11 6 6 VAL VAL A . n A 1 12 ARG 12 7 7 ARG ARG A . n A 1 13 ILE 13 8 8 ILE ILE A . n A 1 14 ASP 14 9 9 ASP ASP A . n A 1 15 ASP 15 10 10 ASP ASP A . n A 1 16 ARG 16 11 11 ARG ARG A . n A 1 17 LEU 17 12 12 LEU LEU A . n A 1 18 VAL 18 13 13 VAL VAL A . n A 1 19 HIS 19 14 14 HIS HIS A . n A 1 20 GLY 20 15 15 GLY GLY A . n A 1 21 GLN 21 16 16 GLN GLN A . n A 1 22 VAL 22 17 17 VAL VAL A . n A 1 23 VAL 23 18 18 VAL VAL A . n A 1 24 THR 24 19 19 THR THR A . n A 1 25 THR 25 20 20 THR THR A . n A 1 26 TRP 26 21 21 TRP TRP A . n A 1 27 LEU 27 22 22 LEU LEU A . n A 1 28 LYS 28 23 23 LYS LYS A . n A 1 29 LYS 29 24 24 LYS LYS A . n A 1 30 TYR 30 25 25 TYR TYR A . n A 1 31 ASP 31 26 26 ASP ASP A . n A 1 32 ILE 32 27 27 ILE ILE A . n A 1 33 GLU 33 28 28 GLU GLU A . n A 1 34 GLN 34 29 29 GLN GLN A . n A 1 35 VAL 35 30 30 VAL VAL A . n A 1 36 ILE 36 31 31 ILE ILE A . n A 1 37 ILE 37 32 32 ILE ILE A . n A 1 38 VAL 38 33 33 VAL VAL A . n A 1 39 ASN 39 34 34 ASN ASN A . n A 1 40 ASP 40 35 35 ASP ASP A . n A 1 41 ARG 41 36 36 ARG ARG A . n A 1 42 ILE 42 37 37 ILE ILE A . n A 1 43 SER 43 38 38 SER SER A . n A 1 44 GLU 44 39 39 GLU GLU A . n A 1 45 ASP 45 40 40 ASP ASP A . n A 1 46 LYS 46 41 41 LYS LYS A . n A 1 47 THR 47 42 42 THR THR A . n A 1 48 ARG 48 43 43 ARG ARG A . n A 1 49 GLN 49 44 44 GLN GLN A . n A 1 50 SER 50 45 45 SER SER A . n A 1 51 ILE 51 46 46 ILE ILE A . n A 1 52 LEU 52 47 47 LEU LEU A . n A 1 53 LYS 53 48 48 LYS LYS A . n A 1 54 ILE 54 49 49 ILE ILE A . n A 1 55 SER 55 50 50 SER SER A . n A 1 56 ALA 56 51 51 ALA ALA A . n A 1 57 PRO 57 52 52 PRO PRO A . n A 1 58 VAL 58 53 53 VAL VAL A . n A 1 59 GLY 59 54 54 GLY GLY A . n A 1 60 LEU 60 55 55 LEU LEU A . n A 1 61 LYS 61 56 56 LYS LYS A . n A 1 62 ILE 62 57 57 ILE ILE A . n A 1 63 VAL 63 58 58 VAL VAL A . n A 1 64 PHE 64 59 59 PHE PHE A . n A 1 65 PHE 65 60 60 PHE PHE A . n A 1 66 SER 66 61 61 SER SER A . n A 1 67 VAL 67 62 62 VAL VAL A . n A 1 68 LYS 68 63 63 LYS LYS A . n A 1 69 ARG 69 64 64 ARG ARG A . n A 1 70 PHE 70 65 65 PHE PHE A . n A 1 71 VAL 71 66 66 VAL VAL A . n A 1 72 GLU 72 67 67 GLU GLU A . n A 1 73 VAL 73 68 68 VAL VAL A . n A 1 74 LEU 74 69 69 LEU LEU A . n A 1 75 ASN 75 70 70 ASN ASN A . n A 1 76 SER 76 71 71 SER SER A . n A 1 77 VAL 77 72 72 VAL VAL A . n A 1 78 PRO 78 73 73 PRO PRO A . n A 1 79 ILE 79 74 74 ILE ILE A . n A 1 80 LYS 80 75 75 LYS LYS A . n A 1 81 LYS 81 76 76 LYS LYS A . n A 1 82 ARG 82 77 77 ARG ARG A . n A 1 83 THR 83 78 78 THR THR A . n A 1 84 MET 84 79 79 MET MET A . n A 1 85 LEU 85 80 80 LEU LEU A . n A 1 86 ILE 86 81 81 ILE ILE A . n A 1 87 TYR 87 82 82 TYR TYR A . n A 1 88 THR 88 83 83 THR THR A . n A 1 89 ASN 89 84 84 ASN ASN A . n A 1 90 PRO 90 85 85 PRO PRO A . n A 1 91 LYS 91 86 86 LYS LYS A . n A 1 92 ASP 92 87 87 ASP ASP A . n A 1 93 VAL 93 88 88 VAL VAL A . n A 1 94 TYR 94 89 89 TYR TYR A . n A 1 95 ASP 95 90 90 ASP ASP A . n A 1 96 SER 96 91 91 SER SER A . n A 1 97 ILE 97 92 92 ILE ILE A . n A 1 98 GLU 98 93 93 GLU GLU A . n A 1 99 GLY 99 94 94 GLY GLY A . n A 1 100 ASN 100 95 95 ASN ASN A . n A 1 101 LEU 101 96 96 LEU LEU A . n A 1 102 LYS 102 97 97 LYS LYS A . n A 1 103 LEU 103 98 98 LEU LEU A . n A 1 104 GLU 104 99 99 GLU GLU A . n A 1 105 TYR 105 100 100 TYR TYR A . n A 1 106 LEU 106 101 101 LEU LEU A . n A 1 107 ASN 107 102 102 ASN ASN A . n A 1 108 VAL 108 103 103 VAL VAL A . n A 1 109 GLY 109 104 104 GLY GLY A . n A 1 110 GLN 110 105 105 GLN GLN A . n A 1 111 MET 111 106 106 MET MET A . n A 1 112 SER 112 107 107 SER SER A . n A 1 113 LYS 113 108 ? ? ? A . n A 1 114 THR 114 109 ? ? ? A . n A 1 115 GLU 115 110 ? ? ? A . n A 1 116 GLU 116 111 ? ? ? A . n A 1 117 ASN 117 112 ? ? ? A . n A 1 118 GLU 118 113 113 GLU GLU A . n A 1 119 LYS 119 114 114 LYS LYS A . n A 1 120 VAL 120 115 115 VAL VAL A . n A 1 121 THR 121 116 116 THR THR A . n A 1 122 GLY 122 117 117 GLY GLY A . n A 1 123 GLY 123 118 118 GLY GLY A . n A 1 124 VAL 124 119 119 VAL VAL A . n A 1 125 ALA 125 120 120 ALA ALA A . n A 1 126 LEU 126 121 121 LEU LEU A . n A 1 127 GLY 127 122 122 GLY GLY A . n A 1 128 GLU 128 123 123 GLU GLU A . n A 1 129 GLU 129 124 124 GLU GLU A . n A 1 130 ASP 130 125 125 ASP ASP A . n A 1 131 LYS 131 126 126 LYS LYS A . n A 1 132 TYR 132 127 127 TYR TYR A . n A 1 133 TYR 133 128 128 TYR TYR A . n A 1 134 PHE 134 129 129 PHE PHE A . n A 1 135 LYS 135 130 130 LYS LYS A . n A 1 136 LYS 136 131 131 LYS LYS A . n A 1 137 ILE 137 132 132 ILE ILE A . n A 1 138 VAL 138 133 133 VAL VAL A . n A 1 139 ASP 139 134 134 ASP ASP A . n A 1 140 LYS 140 135 135 LYS LYS A . n A 1 141 GLY 141 136 136 GLY GLY A . n A 1 142 THR 142 137 137 THR THR A . n A 1 143 ARG 143 138 138 ARG ARG A . n A 1 144 VAL 144 139 139 VAL VAL A . n A 1 145 GLU 145 140 140 GLU GLU A . n A 1 146 ILE 146 141 141 ILE ILE A . n A 1 147 GLN 147 142 142 GLN GLN A . n A 1 148 MET 148 143 143 MET MET A . n A 1 149 VAL 149 144 144 VAL VAL A . n A 1 150 PRO 150 145 145 PRO PRO A . n A 1 151 ASN 151 146 146 ASN ASN A . n A 1 152 ASP 152 147 147 ASP ASP A . n A 1 153 LYS 153 148 148 LYS LYS A . n A 1 154 VAL 154 149 149 VAL VAL A . n A 1 155 THR 155 150 150 THR THR A . n A 1 156 MET 156 151 151 MET MET A . n A 1 157 LEU 157 152 152 LEU LEU A . n A 1 158 GLU 158 153 153 GLU GLU A . n A 1 159 LYS 159 154 154 LYS LYS A . n A 1 160 PHE 160 155 155 PHE PHE A . n A 1 161 LEU 161 156 156 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 103 HOH HOH A . B 2 HOH 2 202 16 HOH HOH A . B 2 HOH 3 203 88 HOH HOH A . B 2 HOH 4 204 10 HOH HOH A . B 2 HOH 5 205 120 HOH HOH A . B 2 HOH 6 206 8 HOH HOH A . B 2 HOH 7 207 81 HOH HOH A . B 2 HOH 8 208 57 HOH HOH A . B 2 HOH 9 209 70 HOH HOH A . B 2 HOH 10 210 14 HOH HOH A . B 2 HOH 11 211 35 HOH HOH A . B 2 HOH 12 212 104 HOH HOH A . B 2 HOH 13 213 9 HOH HOH A . B 2 HOH 14 214 12 HOH HOH A . B 2 HOH 15 215 19 HOH HOH A . B 2 HOH 16 216 113 HOH HOH A . B 2 HOH 17 217 1 HOH HOH A . B 2 HOH 18 218 95 HOH HOH A . B 2 HOH 19 219 79 HOH HOH A . B 2 HOH 20 220 18 HOH HOH A . B 2 HOH 21 221 121 HOH HOH A . B 2 HOH 22 222 42 HOH HOH A . B 2 HOH 23 223 39 HOH HOH A . B 2 HOH 24 224 115 HOH HOH A . B 2 HOH 25 225 89 HOH HOH A . B 2 HOH 26 226 96 HOH HOH A . B 2 HOH 27 227 114 HOH HOH A . B 2 HOH 28 228 97 HOH HOH A . B 2 HOH 29 229 27 HOH HOH A . B 2 HOH 30 230 32 HOH HOH A . B 2 HOH 31 231 69 HOH HOH A . B 2 HOH 32 232 74 HOH HOH A . B 2 HOH 33 233 116 HOH HOH A . B 2 HOH 34 234 98 HOH HOH A . B 2 HOH 35 235 73 HOH HOH A . B 2 HOH 36 236 36 HOH HOH A . B 2 HOH 37 237 38 HOH HOH A . B 2 HOH 38 238 122 HOH HOH A . B 2 HOH 39 239 76 HOH HOH A . B 2 HOH 40 240 49 HOH HOH A . B 2 HOH 41 241 47 HOH HOH A . B 2 HOH 42 242 90 HOH HOH A . B 2 HOH 43 243 85 HOH HOH A . B 2 HOH 44 244 77 HOH HOH A . B 2 HOH 45 245 107 HOH HOH A . B 2 HOH 46 246 82 HOH HOH A . B 2 HOH 47 247 80 HOH HOH A . B 2 HOH 48 248 33 HOH HOH A . B 2 HOH 49 249 111 HOH HOH A . B 2 HOH 50 250 34 HOH HOH A . B 2 HOH 51 251 117 HOH HOH A . B 2 HOH 52 252 106 HOH HOH A . B 2 HOH 53 253 30 HOH HOH A . B 2 HOH 54 254 7 HOH HOH A . B 2 HOH 55 255 13 HOH HOH A . B 2 HOH 56 256 110 HOH HOH A . B 2 HOH 57 257 11 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 11 ? CG ? A ARG 16 CG 2 1 Y 1 A ARG 11 ? CD ? A ARG 16 CD 3 1 Y 1 A ARG 11 ? NE ? A ARG 16 NE 4 1 Y 1 A ARG 11 ? CZ ? A ARG 16 CZ 5 1 Y 1 A ARG 11 ? NH1 ? A ARG 16 NH1 6 1 Y 1 A ARG 11 ? NH2 ? A ARG 16 NH2 7 1 Y 1 A GLN 16 ? CG ? A GLN 21 CG 8 1 Y 1 A GLN 16 ? CD ? A GLN 21 CD 9 1 Y 1 A GLN 16 ? OE1 ? A GLN 21 OE1 10 1 Y 1 A GLN 16 ? NE2 ? A GLN 21 NE2 11 1 Y 1 A VAL 17 ? CG1 ? A VAL 22 CG1 12 1 Y 1 A VAL 17 ? CG2 ? A VAL 22 CG2 13 1 Y 1 A LYS 41 ? CG ? A LYS 46 CG 14 1 Y 1 A LYS 41 ? CD ? A LYS 46 CD 15 1 Y 1 A LYS 41 ? CE ? A LYS 46 CE 16 1 Y 1 A LYS 41 ? NZ ? A LYS 46 NZ 17 1 Y 1 A VAL 53 ? CG1 ? A VAL 58 CG1 18 1 Y 1 A VAL 53 ? CG2 ? A VAL 58 CG2 19 1 Y 1 A ARG 64 ? CG ? A ARG 69 CG 20 1 Y 1 A ARG 64 ? CD ? A ARG 69 CD 21 1 Y 1 A ARG 64 ? NE ? A ARG 69 NE 22 1 Y 1 A ARG 64 ? CZ ? A ARG 69 CZ 23 1 Y 1 A ARG 64 ? NH1 ? A ARG 69 NH1 24 1 Y 1 A ARG 64 ? NH2 ? A ARG 69 NH2 25 1 Y 1 A SER 71 ? OG ? A SER 76 OG 26 1 Y 1 A LYS 75 ? CG ? A LYS 80 CG 27 1 Y 1 A LYS 75 ? CD ? A LYS 80 CD 28 1 Y 1 A LYS 75 ? CE ? A LYS 80 CE 29 1 Y 1 A LYS 75 ? NZ ? A LYS 80 NZ 30 1 Y 1 A LYS 76 ? CG ? A LYS 81 CG 31 1 Y 1 A LYS 76 ? CD ? A LYS 81 CD 32 1 Y 1 A LYS 76 ? CE ? A LYS 81 CE 33 1 Y 1 A LYS 76 ? NZ ? A LYS 81 NZ 34 1 Y 1 A LYS 97 ? CG ? A LYS 102 CG 35 1 Y 1 A LYS 97 ? CD ? A LYS 102 CD 36 1 Y 1 A LYS 97 ? CE ? A LYS 102 CE 37 1 Y 1 A LYS 97 ? NZ ? A LYS 102 NZ 38 1 Y 1 A GLN 105 ? CG ? A GLN 110 CG 39 1 Y 1 A GLN 105 ? CD ? A GLN 110 CD 40 1 Y 1 A GLN 105 ? OE1 ? A GLN 110 OE1 41 1 Y 1 A GLN 105 ? NE2 ? A GLN 110 NE2 42 1 Y 1 A GLU 113 ? CG ? A GLU 118 CG 43 1 Y 1 A GLU 113 ? CD ? A GLU 118 CD 44 1 Y 1 A GLU 113 ? OE1 ? A GLU 118 OE1 45 1 Y 1 A GLU 113 ? OE2 ? A GLU 118 OE2 46 1 Y 1 A LYS 114 ? CG ? A LYS 119 CG 47 1 Y 1 A LYS 114 ? CD ? A LYS 119 CD 48 1 Y 1 A LYS 114 ? CE ? A LYS 119 CE 49 1 Y 1 A LYS 114 ? NZ ? A LYS 119 NZ 50 1 Y 1 A VAL 115 ? CG1 ? A VAL 120 CG1 51 1 Y 1 A VAL 115 ? CG2 ? A VAL 120 CG2 52 1 Y 1 A THR 116 ? OG1 ? A THR 121 OG1 53 1 Y 1 A THR 116 ? CG2 ? A THR 121 CG2 54 1 Y 1 A VAL 119 ? CG1 ? A VAL 124 CG1 55 1 Y 1 A VAL 119 ? CG2 ? A VAL 124 CG2 56 1 Y 1 A GLU 123 ? CG ? A GLU 128 CG 57 1 Y 1 A GLU 123 ? CD ? A GLU 128 CD 58 1 Y 1 A GLU 123 ? OE1 ? A GLU 128 OE1 59 1 Y 1 A GLU 123 ? OE2 ? A GLU 128 OE2 60 1 Y 1 A LYS 130 ? CG ? A LYS 135 CG 61 1 Y 1 A LYS 130 ? CD ? A LYS 135 CD 62 1 Y 1 A LYS 130 ? CE ? A LYS 135 CE 63 1 Y 1 A LYS 130 ? NZ ? A LYS 135 NZ 64 1 Y 1 A LYS 131 ? CG ? A LYS 136 CG 65 1 Y 1 A LYS 131 ? CD ? A LYS 136 CD 66 1 Y 1 A LYS 131 ? CE ? A LYS 136 CE 67 1 Y 1 A LYS 131 ? NZ ? A LYS 136 NZ 68 1 Y 1 A VAL 133 ? CG1 ? A VAL 138 CG1 69 1 Y 1 A VAL 133 ? CG2 ? A VAL 138 CG2 70 1 Y 1 A ASP 134 ? CG ? A ASP 139 CG 71 1 Y 1 A ASP 134 ? OD1 ? A ASP 139 OD1 72 1 Y 1 A ASP 134 ? OD2 ? A ASP 139 OD2 73 1 Y 1 A LYS 135 ? CG ? A LYS 140 CG 74 1 Y 1 A LYS 135 ? CD ? A LYS 140 CD 75 1 Y 1 A LYS 135 ? CE ? A LYS 140 CE 76 1 Y 1 A LYS 135 ? NZ ? A LYS 140 NZ 77 1 Y 1 A ASN 146 ? CG ? A ASN 151 CG 78 1 Y 1 A ASN 146 ? OD1 ? A ASN 151 OD1 79 1 Y 1 A ASN 146 ? ND2 ? A ASN 151 ND2 80 1 Y 1 A LYS 148 ? CG ? A LYS 153 CG 81 1 Y 1 A LYS 148 ? CD ? A LYS 153 CD 82 1 Y 1 A LYS 148 ? CE ? A LYS 153 CE 83 1 Y 1 A LYS 148 ? NZ ? A LYS 153 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5T5D _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.503 _cell.length_a_esd ? _cell.length_b 42.503 _cell.length_b_esd ? _cell.length_c 292.922 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5T5D _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5T5D _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.06 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.37 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PEG400, 0.2 M Magnesium chloride' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2008-04-18 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9761 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL7-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9761 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL7-1 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5T5D _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.5 _reflns.d_resolution_low 37 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 67795 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.94 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5T5D _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.500 _refine.ls_d_res_low 36.809 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6143 _refine.ls_number_reflns_R_free 283 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.76 _refine.ls_percent_reflns_R_free 4.61 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2277 _refine.ls_R_factor_R_free 0.2971 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2236 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.39 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 16.98 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.31 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1135 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 57 _refine_hist.number_atoms_total 1192 _refine_hist.d_res_high 2.500 _refine_hist.d_res_low 36.809 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 1152 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.958 ? 1564 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 15.877 ? 692 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.056 ? 190 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 197 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5001 3.1496 . . 138 2794 100.00 . . . 0.3437 . 0.2065 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1496 36.8127 . . 145 3066 100.00 . . . 0.2846 . 0.2283 . . . . . . . . . . # _struct.entry_id 5T5D _struct.title 'Crystal Structure of the PTS IIB protein associated with the fucose utilization operon from Streptococcus pneumoniae' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5T5D _struct_keywords.text 'transport, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0H2USH8_STRPN _struct_ref.pdbx_db_accession A0A0H2USH8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SIEFVRIDDRLVHGQVVTTWLKKYDIEQVIIVNDRISEDKTRQSILKISAPVGLKIVFFSVKRFVEVLNSVPIKKRTMLI YTNPKDVYDSIEGNLKLEYLNVGQMSKTEENEKVTGGVALGEEDKYYFKKIVDKGTRVEIQMVPNDKVTMLEKFL ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5T5D _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 161 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0H2USH8 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 156 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 156 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5T5D GLY A 1 ? UNP A0A0H2USH8 ? ? 'expression tag' -4 1 1 5T5D SER A 2 ? UNP A0A0H2USH8 ? ? 'expression tag' -3 2 1 5T5D HIS A 3 ? UNP A0A0H2USH8 ? ? 'expression tag' -2 3 1 5T5D MET A 4 ? UNP A0A0H2USH8 ? ? 'expression tag' -1 4 1 5T5D ALA A 5 ? UNP A0A0H2USH8 ? ? 'expression tag' 0 5 1 5T5D SER A 6 ? UNP A0A0H2USH8 ? ? 'expression tag' 1 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 7470 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 21 ? TYR A 30 ? GLN A 16 TYR A 25 1 ? 10 HELX_P HELX_P2 AA2 ASN A 39 ? ASP A 45 ? ASN A 34 ASP A 40 1 ? 7 HELX_P HELX_P3 AA3 ASP A 45 ? ALA A 56 ? ASP A 40 ALA A 51 1 ? 12 HELX_P HELX_P4 AA4 SER A 66 ? VAL A 77 ? SER A 61 VAL A 72 1 ? 12 HELX_P HELX_P5 AA5 ASN A 89 ? GLY A 99 ? ASN A 84 GLY A 94 1 ? 11 HELX_P HELX_P6 AA6 GLY A 127 ? LYS A 140 ? GLY A 122 LYS A 135 1 ? 14 HELX_P HELX_P7 AA7 GLU A 158 ? LEU A 161 ? GLU A 153 LEU A 156 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 61 ? PHE A 65 ? LYS A 56 PHE A 60 AA1 2 GLN A 34 ? VAL A 38 ? GLN A 29 VAL A 33 AA1 3 THR A 83 ? TYR A 87 ? THR A 78 TYR A 82 AA1 4 ILE A 8 ? ILE A 13 ? ILE A 3 ILE A 8 AA1 5 TYR A 105 ? VAL A 108 ? TYR A 100 VAL A 103 AA1 6 ARG A 143 ? ILE A 146 ? ARG A 138 ILE A 141 AA1 7 THR A 155 ? MET A 156 ? THR A 150 MET A 151 AA2 1 LYS A 119 ? THR A 121 ? LYS A 114 THR A 116 AA2 2 VAL A 124 ? ALA A 125 ? VAL A 119 ALA A 120 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 61 ? O LYS A 56 N VAL A 35 ? N VAL A 30 AA1 2 3 N ILE A 36 ? N ILE A 31 O MET A 84 ? O MET A 79 AA1 3 4 O THR A 83 ? O THR A 78 N GLU A 9 ? N GLU A 4 AA1 4 5 N ILE A 13 ? N ILE A 8 O ASN A 107 ? O ASN A 102 AA1 5 6 N VAL A 108 ? N VAL A 103 O GLU A 145 ? O GLU A 140 AA1 6 7 N ILE A 146 ? N ILE A 141 O THR A 155 ? O THR A 150 AA2 1 2 N VAL A 120 ? N VAL A 115 O VAL A 124 ? O VAL A 119 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 12 ? ? 64.42 -117.84 2 1 PRO A 52 ? ? -60.00 175.25 3 1 VAL A 115 ? ? -121.44 -53.69 4 1 GLN A 142 ? ? -166.62 115.85 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 231 ? B HOH . 2 1 A HOH 256 ? B HOH . # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 6.0524 16.6645 13.3653 0.6376 0.4523 0.5629 -0.0431 -0.0049 -0.0063 0.6261 0.4233 1.0242 -0.0295 -0.6146 0.4960 0.3658 0.1331 1.1074 -0.0127 -0.1907 -0.5282 -0.4632 -0.4092 0.0004 'X-RAY DIFFRACTION' 2 ? refined 11.4180 17.8192 3.5068 0.6553 0.4586 0.5043 -0.0093 -0.0008 0.0344 1.2844 1.1441 1.3555 -0.2716 -0.6197 -0.9806 0.1990 0.0572 0.0681 -0.1328 -0.4467 -0.3013 -0.4508 -0.1240 0.0006 'X-RAY DIFFRACTION' 3 ? refined 15.8161 7.0774 11.0054 0.5842 0.3273 0.4662 -0.0131 0.0043 0.0568 2.1399 2.1473 1.7943 -0.8411 -0.5419 0.4732 0.1343 -0.3331 -0.0673 -0.0593 -0.1806 -0.2712 0.2322 0.2311 -0.0000 'X-RAY DIFFRACTION' 4 ? refined -4.4530 4.0135 9.8407 0.7288 0.5711 0.7921 -0.1526 -0.0521 0.2076 1.2299 3.7357 2.9351 -2.1371 -0.2554 0.1870 0.6359 0.1075 -1.7364 0.0714 0.2742 0.6989 -1.0769 -1.2820 0.1422 'X-RAY DIFFRACTION' 5 ? refined 2.2485 1.8422 16.8608 0.6060 0.3734 0.5088 -0.0385 -0.0168 0.0390 0.6473 1.1853 1.2904 0.7811 -0.0505 -0.4874 -0.0199 0.0262 0.1814 -0.2956 -0.2626 0.6130 0.3401 -0.3543 -0.0012 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 2 through 24 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 25 through 61 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 62 through 103 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 104 through 122 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 123 through 156 ) ; # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 256 ? 7.06 . 2 1 O ? A HOH 257 ? 7.12 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -4 ? A GLY 1 2 1 Y 1 A SER -3 ? A SER 2 3 1 Y 1 A HIS -2 ? A HIS 3 4 1 Y 1 A MET -1 ? A MET 4 5 1 Y 1 A ALA 0 ? A ALA 5 6 1 Y 1 A SER 1 ? A SER 6 7 1 Y 1 A LYS 108 ? A LYS 113 8 1 Y 1 A THR 109 ? A THR 114 9 1 Y 1 A GLU 110 ? A GLU 115 10 1 Y 1 A GLU 111 ? A GLU 116 11 1 Y 1 A ASN 112 ? A ASN 117 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TRP N N N N 307 TRP CA C N S 308 TRP C C N N 309 TRP O O N N 310 TRP CB C N N 311 TRP CG C Y N 312 TRP CD1 C Y N 313 TRP CD2 C Y N 314 TRP NE1 N Y N 315 TRP CE2 C Y N 316 TRP CE3 C Y N 317 TRP CZ2 C Y N 318 TRP CZ3 C Y N 319 TRP CH2 C Y N 320 TRP OXT O N N 321 TRP H H N N 322 TRP H2 H N N 323 TRP HA H N N 324 TRP HB2 H N N 325 TRP HB3 H N N 326 TRP HD1 H N N 327 TRP HE1 H N N 328 TRP HE3 H N N 329 TRP HZ2 H N N 330 TRP HZ3 H N N 331 TRP HH2 H N N 332 TRP HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 VAL N N N N 358 VAL CA C N S 359 VAL C C N N 360 VAL O O N N 361 VAL CB C N N 362 VAL CG1 C N N 363 VAL CG2 C N N 364 VAL OXT O N N 365 VAL H H N N 366 VAL H2 H N N 367 VAL HA H N N 368 VAL HB H N N 369 VAL HG11 H N N 370 VAL HG12 H N N 371 VAL HG13 H N N 372 VAL HG21 H N N 373 VAL HG22 H N N 374 VAL HG23 H N N 375 VAL HXT H N N 376 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _atom_sites.entry_id 5T5D _atom_sites.fract_transf_matrix[1][1] 0.023528 _atom_sites.fract_transf_matrix[1][2] 0.013584 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027167 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003414 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_