data_5TCE # _entry.id 5TCE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5TCE pdb_00005tce 10.2210/pdb5tce/pdb WWPDB D_1000223735 ? ? BMRB 30180 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'N-terminal microdomain of 34-mers from HsDHODH - N-t(DH)' _pdbx_database_related.db_id 30180 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5TCE _pdbx_database_status.recvd_initial_deposition_date 2016-09-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Crusca, E.' 1 'Munte, C.E.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J Phys Chem B' _citation.journal_id_ASTM JPCBFK _citation.journal_id_CSD 1278 _citation.journal_id_ISSN 1520-5207 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 119 _citation.language ? _citation.page_first 8693 _citation.page_last 8697 _citation.title 'Conformational changes of the HsDHODH N-terminal Microdomain via DEER Spectroscopy.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jpcb.5b01706 _citation.pdbx_database_id_PubMed 26086954 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Vicente, E.F.' 1 ? primary 'Sahu, I.D.' 2 ? primary 'Costa-Filho, A.J.' 3 ? primary 'Cilli, E.M.' 4 ? primary 'Lorigan, G.A.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Dihydroorotate dehydrogenase (quinone), mitochondrial' _entity.formula_weight 3831.320 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 1.3.5.2 _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 32-65' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DHOdehase,Dihydroorotate oxidase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLG(NH2)' _entity_poly.pdbx_seq_one_letter_code_can GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASP n 1 3 GLU n 1 4 ARG n 1 5 PHE n 1 6 TYR n 1 7 ALA n 1 8 GLU n 1 9 HIS n 1 10 LEU n 1 11 MET n 1 12 PRO n 1 13 THR n 1 14 LEU n 1 15 GLN n 1 16 GLY n 1 17 LEU n 1 18 LEU n 1 19 ASP n 1 20 PRO n 1 21 GLU n 1 22 SER n 1 23 ALA n 1 24 HIS n 1 25 ARG n 1 26 LEU n 1 27 ALA n 1 28 VAL n 1 29 ARG n 1 30 PHE n 1 31 THR n 1 32 SER n 1 33 LEU n 1 34 GLY n 1 35 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 35 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PYRD_HUMAN _struct_ref.pdbx_db_accession Q02127 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLG _struct_ref.pdbx_align_begin 32 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5TCE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 34 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q02127 _struct_ref_seq.db_align_beg 32 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 65 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 34 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5TCE _struct_ref_seq_dif.mon_id NH2 _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 35 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q02127 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details amidation _struct_ref_seq_dif.pdbx_auth_seq_num 35 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D DQF-COSY' 1 isotropic 3 1 1 '2D 1H-1H NOESY' 1 isotropic 4 1 1 '2D 1H-15N HSQC' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '700 uM peptide, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 'DH-34 - DPC micelle' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ;TRIS 10 mM DPC-d38 100 mM ; # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 800 ? # _pdbx_nmr_refine.details ? _pdbx_nmr_refine.entry_id 5TCE _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.software_ordinal 8 # _pdbx_nmr_ensemble.entry_id 5TCE _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 5TCE _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing TopSpin ? 'Bruker Biospin' 3 'data analysis' NMRView ? 'Johnson, One Moon Scientific' 4 'peak picking' NMRView ? 'Johnson, One Moon Scientific' 5 'chemical shift assignment' NMRView ? 'Johnson, One Moon Scientific' 6 'chemical shift calculation' NMRView ? 'Johnson, One Moon Scientific' 7 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 8 refinement CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TCE _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5TCE _struct.title 'N-terminal microdomain of 34-mers from HsDHODH - N-t(DH)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TCE _struct_keywords.text 'micelles, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 10 ? GLN A 15 ? LEU A 10 GLN A 15 1 ? 6 HELX_P HELX_P2 AA2 GLU A 21 ? SER A 32 ? GLU A 21 SER A 32 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id GLY _struct_conn.ptnr1_label_seq_id 34 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id NH2 _struct_conn.ptnr2_label_seq_id 35 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id GLY _struct_conn.ptnr1_auth_seq_id 34 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id NH2 _struct_conn.ptnr2_auth_seq_id 35 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.229 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 5TCE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 NH2 35 35 35 NH2 NH2 A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 120 ? 1 MORE 1 ? 1 'SSA (A^2)' 3160 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-09-20 2 'Structure model' 1 1 2019-04-17 3 'Structure model' 1 2 2020-01-01 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Data collection' 3 2 'Structure model' 'Refinement description' 4 3 'Structure model' 'Author supporting evidence' 5 3 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 2 'Structure model' pdbx_nmr_refine 3 2 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_audit_support 5 3 'Structure model' pdbx_nmr_spectrometer 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 2 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_audit_support.funding_organization' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component peptide _pdbx_nmr_exptl_sample.concentration 700 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units uM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -141.62 -70.72 2 1 LEU A 10 ? ? -130.22 -43.86 3 1 LEU A 18 ? ? -159.02 24.94 4 2 ASP A 2 ? ? -139.64 -70.18 5 2 LEU A 10 ? ? -130.95 -43.32 6 2 LEU A 18 ? ? -157.87 24.67 7 3 ASP A 2 ? ? -139.49 -70.19 8 3 LEU A 10 ? ? -131.04 -43.32 9 3 LEU A 18 ? ? -158.20 25.11 10 4 ASP A 2 ? ? -139.24 -69.54 11 4 LEU A 10 ? ? -130.97 -43.32 12 4 LEU A 18 ? ? -158.17 24.84 13 5 ASP A 2 ? ? -139.24 -70.14 14 5 LEU A 10 ? ? -130.91 -43.35 15 5 LEU A 18 ? ? -160.50 27.55 16 6 ASP A 2 ? ? -139.87 -70.21 17 6 LEU A 10 ? ? -131.78 -43.02 18 6 LEU A 18 ? ? -157.44 24.76 19 7 ASP A 2 ? ? -138.89 -70.00 20 7 LEU A 10 ? ? -130.38 -43.87 21 7 LEU A 18 ? ? -160.28 27.05 22 8 ASP A 2 ? ? -139.45 -70.19 23 8 LEU A 10 ? ? -131.38 -43.18 24 8 LEU A 18 ? ? -157.86 24.63 25 9 ASP A 2 ? ? -139.52 -69.54 26 9 LEU A 10 ? ? -131.00 -43.27 27 9 LEU A 18 ? ? -157.72 24.67 28 10 ASP A 2 ? ? -139.57 -70.16 29 10 LEU A 10 ? ? -131.05 -43.25 30 10 LEU A 18 ? ? -158.22 24.43 31 11 ASP A 2 ? ? -139.25 -70.03 32 11 LEU A 10 ? ? -130.98 -43.31 33 11 LEU A 18 ? ? -158.14 24.43 34 11 LEU A 33 ? ? 58.56 19.35 35 12 ASP A 2 ? ? -139.87 -70.24 36 12 LEU A 10 ? ? -131.03 -43.24 37 12 LEU A 18 ? ? -162.61 35.78 38 13 ASP A 2 ? ? -139.59 -70.14 39 13 LEU A 10 ? ? -134.82 -44.20 40 13 LEU A 18 ? ? -155.25 22.05 41 14 ASP A 2 ? ? -139.32 -70.09 42 14 LEU A 10 ? ? -131.32 -43.20 43 14 LEU A 18 ? ? -158.56 24.52 44 15 ASP A 2 ? ? -139.40 -69.58 45 15 LEU A 10 ? ? -130.86 -43.38 46 15 LEU A 18 ? ? -158.52 30.20 47 15 PRO A 20 ? ? -69.85 1.92 48 16 ASP A 2 ? ? -139.34 -70.12 49 16 LEU A 10 ? ? -130.99 -43.23 50 16 LEU A 18 ? ? -156.92 23.57 51 17 ASP A 2 ? ? -139.70 -70.35 52 17 LEU A 10 ? ? -133.75 -44.30 53 17 LEU A 18 ? ? -156.08 24.45 54 17 LEU A 33 ? ? 58.52 19.50 55 18 ASP A 2 ? ? -139.53 -70.21 56 18 LEU A 10 ? ? -131.15 -43.36 57 18 LEU A 18 ? ? -158.30 24.90 58 19 ASP A 2 ? ? -140.00 -70.27 59 19 LEU A 10 ? ? -131.58 -42.89 60 19 LEU A 18 ? ? -161.93 35.66 61 20 ASP A 2 ? ? -139.83 -70.25 62 20 LEU A 10 ? ? -134.85 -44.43 63 20 LEU A 18 ? ? -156.78 22.98 # _pdbx_audit_support.funding_organization 'Sao Paulo Research Foundation (FAPESP)' _pdbx_audit_support.country Brazil _pdbx_audit_support.grant_number 10/12953-4 _pdbx_audit_support.ordinal 1 #