data_5TDA # _entry.id 5TDA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5TDA pdb_00005tda 10.2210/pdb5tda/pdb WWPDB D_1000224050 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5TDB PDB . unspecified 5TDC PDB . unspecified 5TDD PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5TDA _pdbx_database_status.recvd_initial_deposition_date 2016-09-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Munoz-Escobar, J.' 1 'Kozlov, G.' 2 'Gehring, K.' 3 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? UK ? ? primary Structure STRUE6 2005 1878-4186 ? ? 25 ? 719 729.e3 'Bound Waters Mediate Binding of Diverse Substrates to a Ubiquitin Ligase.' 2017 ? 10.1016/j.str.2017.03.004 28392261 ? ? ? ? ? ? ? ? ? ? ? 1 'To Be Published' ? 0353 ? ? ? ? ? ? ? 'Crystal structure of the UBR-box domain of UBR2 in complex with RLWS N-degron' ? ? ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Munoz-Escobar, J.' 1 ? primary 'Matta-Camacho, E.' 2 ? primary 'Cho, C.' 3 ? primary 'Kozlov, G.' 4 ? primary 'Gehring, K.' 5 ? 1 'Munoz-Escobar, J.' 6 ? 1 'Kozlov, G.' 7 ? 1 'Matta-Camacho, E.P.' 8 ? 1 'Gehring, K.' 9 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5TDA _cell.details ? _cell.formula_units_Z ? _cell.length_a 28.702 _cell.length_a_esd ? _cell.length_b 37.158 _cell.length_b_esd ? _cell.length_c 57.474 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5TDA _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'E3 ubiquitin-protein ligase UBR2' 8350.516 1 6.3.2.- ? ? ? 2 polymer man 'ARG-LEU-TRP-SER peptide' 561.654 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 3 ? ? ? ? 4 water nat water 18.015 107 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'N-recognin-2,Ubiquitin-protein ligase E3-alpha-2,Ubiquitin-protein ligase E3-alpha-II' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GPLGSLCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHEL GPLGSLCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHEL A ? 2 'polypeptide(L)' no no RLWS RLWS B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 LEU n 1 7 CYS n 1 8 GLY n 1 9 ARG n 1 10 VAL n 1 11 PHE n 1 12 LYS n 1 13 VAL n 1 14 GLY n 1 15 GLU n 1 16 PRO n 1 17 THR n 1 18 TYR n 1 19 SER n 1 20 CYS n 1 21 ARG n 1 22 ASP n 1 23 CYS n 1 24 ALA n 1 25 VAL n 1 26 ASP n 1 27 PRO n 1 28 THR n 1 29 CYS n 1 30 VAL n 1 31 LEU n 1 32 CYS n 1 33 MET n 1 34 GLU n 1 35 CYS n 1 36 PHE n 1 37 LEU n 1 38 GLY n 1 39 SER n 1 40 ILE n 1 41 HIS n 1 42 ARG n 1 43 ASP n 1 44 HIS n 1 45 ARG n 1 46 TYR n 1 47 ARG n 1 48 MET n 1 49 THR n 1 50 THR n 1 51 SER n 1 52 GLY n 1 53 GLY n 1 54 GLY n 1 55 GLY n 1 56 PHE n 1 57 CYS n 1 58 ASP n 1 59 CYS n 1 60 GLY n 1 61 ASP n 1 62 THR n 1 63 GLU n 1 64 ALA n 1 65 TRP n 1 66 LYS n 1 67 GLU n 1 68 GLY n 1 69 PRO n 1 70 TYR n 1 71 CYS n 1 72 GLN n 1 73 LYS n 1 74 HIS n 1 75 GLU n 1 76 LEU n 2 1 ARG n 2 2 LEU n 2 3 TRP n 2 4 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 76 Human ? 'UBR2, C6orf133, KIAA0349' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? BL21 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 4 ? ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? BL21 ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP UBR2_HUMAN Q8IWV8 Q8IWV8-2 1 LCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHEL 98 2 PDB 5TDA 5TDA ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5TDA A 6 ? 76 ? Q8IWV8 98 ? 168 ? 98 168 2 2 5TDA B 1 ? 4 ? 5TDA 1 ? 4 ? 1 4 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5TDA GLY A 1 ? UNP Q8IWV8 ? ? 'expression tag' 93 1 1 5TDA PRO A 2 ? UNP Q8IWV8 ? ? 'expression tag' 94 2 1 5TDA LEU A 3 ? UNP Q8IWV8 ? ? 'expression tag' 95 3 1 5TDA GLY A 4 ? UNP Q8IWV8 ? ? 'expression tag' 96 4 1 5TDA SER A 5 ? UNP Q8IWV8 ? ? 'expression tag' 97 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TDA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.72 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 28.47 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M MES pH 6.5 and 20% PEG 10000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-03-16 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.6362 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CHESS BEAMLINE A1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.6362 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline A1 _diffrn_source.pdbx_synchrotron_site CHESS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5TDA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 0.790 _reflns.d_resolution_low 17.028 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 65534 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.27 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 50.69 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 0.7901 _reflns_shell.d_res_low 0.8099 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 70 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.674 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5TDA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 0.790 _refine.ls_d_res_low 17.028 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 65534 _refine.ls_number_reflns_R_free 2000 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.27 _refine.ls_percent_reflns_R_free 3.05 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1205 _refine.ls_R_factor_R_free 0.1281 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1202 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3NY3 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 11.10 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.06 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 585 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 107 _refine_hist.number_atoms_total 695 _refine_hist.d_res_high 0.790 _refine_hist.d_res_low 17.028 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 712 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.059 ? 960 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 28.533 ? 272 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.086 ? 94 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 128 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 0.7901 0.8099 . . 102 3250 70.00 . . . 0.2812 . 0.2615 . . . . . . . . . . 'X-RAY DIFFRACTION' 0.8099 0.8318 . . 129 4106 89.00 . . . 0.2253 . 0.2267 . . . . . . . . . . 'X-RAY DIFFRACTION' 0.8318 0.8562 . . 145 4588 98.00 . . . 0.1835 . 0.1856 . . . . . . . . . . 'X-RAY DIFFRACTION' 0.8562 0.8839 . . 146 4652 100.00 . . . 0.1680 . 0.1497 . . . . . . . . . . 'X-RAY DIFFRACTION' 0.8839 0.9155 . . 147 4652 100.00 . . . 0.1350 . 0.1340 . . . . . . . . . . 'X-RAY DIFFRACTION' 0.9155 0.9521 . . 147 4688 100.00 . . . 0.1342 . 0.1145 . . . . . . . . . . 'X-RAY DIFFRACTION' 0.9521 0.9954 . . 147 4661 100.00 . . . 0.0989 . 0.1019 . . . . . . . . . . 'X-RAY DIFFRACTION' 0.9954 1.0479 . . 147 4674 100.00 . . . 0.1079 . 0.0926 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.0479 1.1135 . . 148 4706 100.00 . . . 0.0973 . 0.0910 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1135 1.1995 . . 149 4737 100.00 . . . 0.0999 . 0.0903 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.1995 1.3202 . . 148 4698 100.00 . . . 0.0908 . 0.0963 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3202 1.5111 . . 150 4778 100.00 . . . 0.1023 . 0.1052 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5111 1.9034 . . 152 4795 100.00 . . . 0.1179 . 0.1141 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9034 17.0319 . . 143 4549 91.00 . . . 0.1594 . 0.1398 . . . . . . . . . . # _struct.entry_id 5TDA _struct.title 'Crystal structure of the UBR-box domain from UBR2 in complex with RLWS N-degron' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TDA _struct_keywords.text 'Zn-finger, N-end rule, UBR-box, N-degron, LIGASE' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 33 ? GLY A 38 ? MET A 125 GLY A 130 1 ? 6 HELX_P HELX_P2 AA2 SER A 39 ? HIS A 44 ? SER A 131 HIS A 136 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 7 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 99 A ZN 201 1_555 ? ? ? ? ? ? ? 2.325 ? ? metalc2 metalc ? ? A CYS 20 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 112 A ZN 203 1_555 ? ? ? ? ? ? ? 2.301 ? ? metalc3 metalc ? ? A CYS 23 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 115 A ZN 203 1_555 ? ? ? ? ? ? ? 2.319 ? ? metalc4 metalc ? ? A CYS 32 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 124 A ZN 201 1_555 ? ? ? ? ? ? ? 2.343 ? ? metalc5 metalc ? ? A CYS 35 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 127 A ZN 201 1_555 ? ? ? ? ? ? ? 2.386 ? ? metalc6 metalc ? ? A CYS 35 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 127 A ZN 202 1_555 ? ? ? ? ? ? ? 2.350 ? ? metalc7 metalc ? ? A HIS 41 ND1 ? ? ? 1_555 E ZN . ZN ? ? A HIS 133 A ZN 203 1_555 ? ? ? ? ? ? ? 2.068 ? ? metalc8 metalc ? ? A HIS 44 ND1 ? ? ? 1_555 E ZN . ZN ? ? A HIS 136 A ZN 203 1_555 ? ? ? ? ? ? ? 2.058 ? ? metalc9 metalc ? ? A CYS 57 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 149 A ZN 201 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc10 metalc ? ? A CYS 59 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 151 A ZN 202 1_555 ? ? ? ? ? ? ? 2.306 ? ? metalc11 metalc ? ? A CYS 71 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 163 A ZN 202 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc12 metalc ? ? A HIS 74 ND1 ? ? ? 1_555 D ZN . ZN ? ? A HIS 166 A ZN 202 1_555 ? ? ? ? ? ? ? 2.051 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 31 ? CYS A 32 ? LEU A 123 CYS A 124 AA1 2 PRO A 16 ? CYS A 20 ? PRO A 108 CYS A 112 AA1 3 TYR A 46 ? THR A 50 ? TYR A 138 THR A 142 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 31 ? O LEU A 123 N TYR A 18 ? N TYR A 110 AA1 2 3 N THR A 17 ? N THR A 109 O THR A 49 ? O THR A 141 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'binding site for residue ZN A 201' AC2 Software A ZN 202 ? 4 'binding site for residue ZN A 202' AC3 Software A ZN 203 ? 4 'binding site for residue ZN A 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 7 ? CYS A 99 . ? 1_555 ? 2 AC1 4 CYS A 32 ? CYS A 124 . ? 1_555 ? 3 AC1 4 CYS A 35 ? CYS A 127 . ? 1_555 ? 4 AC1 4 CYS A 57 ? CYS A 149 . ? 1_555 ? 5 AC2 4 CYS A 35 ? CYS A 127 . ? 1_555 ? 6 AC2 4 CYS A 59 ? CYS A 151 . ? 1_555 ? 7 AC2 4 CYS A 71 ? CYS A 163 . ? 1_555 ? 8 AC2 4 HIS A 74 ? HIS A 166 . ? 1_555 ? 9 AC3 4 CYS A 20 ? CYS A 112 . ? 1_555 ? 10 AC3 4 CYS A 23 ? CYS A 115 . ? 1_555 ? 11 AC3 4 HIS A 41 ? HIS A 133 . ? 1_555 ? 12 AC3 4 HIS A 44 ? HIS A 136 . ? 1_555 ? # _atom_sites.entry_id 5TDA _atom_sites.fract_transf_matrix[1][1] 0.034841 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026912 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017399 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 93 ? ? ? A . n A 1 2 PRO 2 94 ? ? ? A . n A 1 3 LEU 3 95 ? ? ? A . n A 1 4 GLY 4 96 ? ? ? A . n A 1 5 SER 5 97 97 SER ALA A . n A 1 6 LEU 6 98 98 LEU LEU A . n A 1 7 CYS 7 99 99 CYS CYS A . n A 1 8 GLY 8 100 100 GLY GLY A . n A 1 9 ARG 9 101 101 ARG ARG A . n A 1 10 VAL 10 102 102 VAL VAL A . n A 1 11 PHE 11 103 103 PHE PHE A . n A 1 12 LYS 12 104 104 LYS LYS A . n A 1 13 VAL 13 105 105 VAL VAL A . n A 1 14 GLY 14 106 106 GLY GLY A . n A 1 15 GLU 15 107 107 GLU GLU A . n A 1 16 PRO 16 108 108 PRO PRO A . n A 1 17 THR 17 109 109 THR THR A . n A 1 18 TYR 18 110 110 TYR TYR A . n A 1 19 SER 19 111 111 SER SER A . n A 1 20 CYS 20 112 112 CYS CYS A . n A 1 21 ARG 21 113 113 ARG ARG A . n A 1 22 ASP 22 114 114 ASP ASP A . n A 1 23 CYS 23 115 115 CYS CYS A . n A 1 24 ALA 24 116 116 ALA ALA A . n A 1 25 VAL 25 117 117 VAL VAL A . n A 1 26 ASP 26 118 118 ASP ASP A . n A 1 27 PRO 27 119 119 PRO PRO A . n A 1 28 THR 28 120 120 THR THR A . n A 1 29 CYS 29 121 121 CYS CYS A . n A 1 30 VAL 30 122 122 VAL VAL A . n A 1 31 LEU 31 123 123 LEU LEU A . n A 1 32 CYS 32 124 124 CYS CYS A . n A 1 33 MET 33 125 125 MET MET A . n A 1 34 GLU 34 126 126 GLU GLU A . n A 1 35 CYS 35 127 127 CYS CYS A . n A 1 36 PHE 36 128 128 PHE PHE A . n A 1 37 LEU 37 129 129 LEU LEU A . n A 1 38 GLY 38 130 130 GLY GLY A . n A 1 39 SER 39 131 131 SER SER A . n A 1 40 ILE 40 132 132 ILE ILE A . n A 1 41 HIS 41 133 133 HIS HIS A . n A 1 42 ARG 42 134 134 ARG ARG A . n A 1 43 ASP 43 135 135 ASP ASP A . n A 1 44 HIS 44 136 136 HIS HIS A . n A 1 45 ARG 45 137 137 ARG ARG A . n A 1 46 TYR 46 138 138 TYR TYR A . n A 1 47 ARG 47 139 139 ARG ARG A . n A 1 48 MET 48 140 140 MET MET A . n A 1 49 THR 49 141 141 THR THR A . n A 1 50 THR 50 142 142 THR THR A . n A 1 51 SER 51 143 143 SER SER A . n A 1 52 GLY 52 144 144 GLY GLY A . n A 1 53 GLY 53 145 145 GLY GLY A . n A 1 54 GLY 54 146 146 GLY GLY A . n A 1 55 GLY 55 147 147 GLY GLY A . n A 1 56 PHE 56 148 148 PHE PHE A . n A 1 57 CYS 57 149 149 CYS CYS A . n A 1 58 ASP 58 150 150 ASP ASP A . n A 1 59 CYS 59 151 151 CYS CYS A . n A 1 60 GLY 60 152 152 GLY GLY A . n A 1 61 ASP 61 153 153 ASP ASP A . n A 1 62 THR 62 154 154 THR THR A . n A 1 63 GLU 63 155 155 GLU GLU A . n A 1 64 ALA 64 156 156 ALA ALA A . n A 1 65 TRP 65 157 157 TRP TRP A . n A 1 66 LYS 66 158 158 LYS LYS A . n A 1 67 GLU 67 159 159 GLU GLU A . n A 1 68 GLY 68 160 160 GLY GLY A . n A 1 69 PRO 69 161 161 PRO PRO A . n A 1 70 TYR 70 162 162 TYR TYR A . n A 1 71 CYS 71 163 163 CYS CYS A . n A 1 72 GLN 72 164 164 GLN GLN A . n A 1 73 LYS 73 165 165 LYS LYS A . n A 1 74 HIS 74 166 166 HIS HIS A . n A 1 75 GLU 75 167 167 GLU GLU A . n A 1 76 LEU 76 168 ? ? ? A . n B 2 1 ARG 1 1 1 ARG ARG B . n B 2 2 LEU 2 2 2 LEU LEU B . n B 2 3 TRP 3 3 3 TRP TRP B . n B 2 4 SER 4 4 4 SER SER B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 ZN 1 201 1 ZN ZN A . D 3 ZN 1 202 2 ZN ZN A . E 3 ZN 1 203 3 ZN ZN A . F 4 HOH 1 301 99 HOH HOH A . F 4 HOH 2 302 88 HOH HOH A . F 4 HOH 3 303 35 HOH HOH A . F 4 HOH 4 304 91 HOH HOH A . F 4 HOH 5 305 31 HOH HOH A . F 4 HOH 6 306 61 HOH HOH A . F 4 HOH 7 307 62 HOH HOH A . F 4 HOH 8 308 38 HOH HOH A . F 4 HOH 9 309 18 HOH HOH A . F 4 HOH 10 310 33 HOH HOH A . F 4 HOH 11 311 9 HOH HOH A . F 4 HOH 12 312 34 HOH HOH A . F 4 HOH 13 313 72 HOH HOH A . F 4 HOH 14 314 46 HOH HOH A . F 4 HOH 15 315 43 HOH HOH A . F 4 HOH 16 316 95 HOH HOH A . F 4 HOH 17 317 94 HOH HOH A . F 4 HOH 18 318 52 HOH HOH A . F 4 HOH 19 319 60 HOH HOH A . F 4 HOH 20 320 37 HOH HOH A . F 4 HOH 21 321 32 HOH HOH A . F 4 HOH 22 322 3 HOH HOH A . F 4 HOH 23 323 84 HOH HOH A . F 4 HOH 24 324 12 HOH HOH A . F 4 HOH 25 325 26 HOH HOH A . F 4 HOH 26 326 82 HOH HOH A . F 4 HOH 27 327 71 HOH HOH A . F 4 HOH 28 328 13 HOH HOH A . F 4 HOH 29 329 30 HOH HOH A . F 4 HOH 30 330 81 HOH HOH A . F 4 HOH 31 331 64 HOH HOH A . F 4 HOH 32 332 4 HOH HOH A . F 4 HOH 33 333 79 HOH HOH A . F 4 HOH 34 334 1 HOH HOH A . F 4 HOH 35 335 22 HOH HOH A . F 4 HOH 36 336 129 HOH HOH A . F 4 HOH 37 337 2 HOH HOH A . F 4 HOH 38 338 19 HOH HOH A . F 4 HOH 39 339 5 HOH HOH A . F 4 HOH 40 340 15 HOH HOH A . F 4 HOH 41 341 47 HOH HOH A . F 4 HOH 42 342 65 HOH HOH A . F 4 HOH 43 343 7 HOH HOH A . F 4 HOH 44 344 6 HOH HOH A . F 4 HOH 45 345 89 HOH HOH A . F 4 HOH 46 346 63 HOH HOH A . F 4 HOH 47 347 77 HOH HOH A . F 4 HOH 48 348 85 HOH HOH A . F 4 HOH 49 349 39 HOH HOH A . F 4 HOH 50 350 102 HOH HOH A . F 4 HOH 51 351 40 HOH HOH A . F 4 HOH 52 352 28 HOH HOH A . F 4 HOH 53 353 10 HOH HOH A . F 4 HOH 54 354 14 HOH HOH A . F 4 HOH 55 355 36 HOH HOH A . F 4 HOH 56 356 68 HOH HOH A . F 4 HOH 57 357 27 HOH HOH A . F 4 HOH 58 358 24 HOH HOH A . F 4 HOH 59 359 44 HOH HOH A . F 4 HOH 60 360 11 HOH HOH A . F 4 HOH 61 361 20 HOH HOH A . F 4 HOH 62 362 29 HOH HOH A . F 4 HOH 63 363 17 HOH HOH A . F 4 HOH 64 364 121 HOH HOH A . F 4 HOH 65 365 83 HOH HOH A . F 4 HOH 66 366 25 HOH HOH A . F 4 HOH 67 367 21 HOH HOH A . F 4 HOH 68 368 80 HOH HOH A . F 4 HOH 69 369 87 HOH HOH A . F 4 HOH 70 370 45 HOH HOH A . F 4 HOH 71 371 41 HOH HOH A . F 4 HOH 72 372 53 HOH HOH A . F 4 HOH 73 373 74 HOH HOH A . F 4 HOH 74 374 90 HOH HOH A . F 4 HOH 75 375 48 HOH HOH A . F 4 HOH 76 376 59 HOH HOH A . F 4 HOH 77 377 101 HOH HOH A . F 4 HOH 78 378 66 HOH HOH A . F 4 HOH 79 379 126 HOH HOH A . F 4 HOH 80 380 50 HOH HOH A . F 4 HOH 81 381 54 HOH HOH A . F 4 HOH 82 382 130 HOH HOH A . F 4 HOH 83 383 42 HOH HOH A . F 4 HOH 84 384 73 HOH HOH A . F 4 HOH 85 385 69 HOH HOH A . F 4 HOH 86 386 97 HOH HOH A . F 4 HOH 87 387 103 HOH HOH A . F 4 HOH 88 388 78 HOH HOH A . F 4 HOH 89 389 49 HOH HOH A . F 4 HOH 90 390 67 HOH HOH A . F 4 HOH 91 391 51 HOH HOH A . F 4 HOH 92 392 16 HOH HOH A . F 4 HOH 93 393 56 HOH HOH A . F 4 HOH 94 394 57 HOH HOH A . F 4 HOH 95 395 70 HOH HOH A . F 4 HOH 96 396 120 HOH HOH A . F 4 HOH 97 397 93 HOH HOH A . F 4 HOH 98 398 86 HOH HOH A . F 4 HOH 99 399 128 HOH HOH A . F 4 HOH 100 400 55 HOH HOH A . F 4 HOH 101 401 75 HOH HOH A . F 4 HOH 102 402 106 HOH HOH A . G 4 HOH 1 101 23 HOH HOH B . G 4 HOH 2 102 8 HOH HOH B . G 4 HOH 3 103 105 HOH HOH B . G 4 HOH 4 104 76 HOH HOH B . G 4 HOH 5 105 92 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 590 ? 1 MORE -2 ? 1 'SSA (A^2)' 4640 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 7 ? A CYS 99 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 SG ? A CYS 32 ? A CYS 124 ? 1_555 115.4 ? 2 SG ? A CYS 7 ? A CYS 99 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 SG ? A CYS 35 ? A CYS 127 ? 1_555 105.9 ? 3 SG ? A CYS 32 ? A CYS 124 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 SG ? A CYS 35 ? A CYS 127 ? 1_555 95.0 ? 4 SG ? A CYS 7 ? A CYS 99 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 SG ? A CYS 57 ? A CYS 149 ? 1_555 112.9 ? 5 SG ? A CYS 32 ? A CYS 124 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 SG ? A CYS 57 ? A CYS 149 ? 1_555 114.4 ? 6 SG ? A CYS 35 ? A CYS 127 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 SG ? A CYS 57 ? A CYS 149 ? 1_555 111.4 ? 7 SG ? A CYS 20 ? A CYS 112 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 SG ? A CYS 23 ? A CYS 115 ? 1_555 115.1 ? 8 SG ? A CYS 20 ? A CYS 112 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 ND1 ? A HIS 41 ? A HIS 133 ? 1_555 108.5 ? 9 SG ? A CYS 23 ? A CYS 115 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 ND1 ? A HIS 41 ? A HIS 133 ? 1_555 104.4 ? 10 SG ? A CYS 20 ? A CYS 112 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 ND1 ? A HIS 44 ? A HIS 136 ? 1_555 112.3 ? 11 SG ? A CYS 23 ? A CYS 115 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 ND1 ? A HIS 44 ? A HIS 136 ? 1_555 105.3 ? 12 ND1 ? A HIS 41 ? A HIS 133 ? 1_555 ZN ? E ZN . ? A ZN 203 ? 1_555 ND1 ? A HIS 44 ? A HIS 136 ? 1_555 111.1 ? 13 SG ? A CYS 35 ? A CYS 127 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 SG ? A CYS 59 ? A CYS 151 ? 1_555 111.9 ? 14 SG ? A CYS 35 ? A CYS 127 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 SG ? A CYS 71 ? A CYS 163 ? 1_555 110.4 ? 15 SG ? A CYS 59 ? A CYS 151 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 SG ? A CYS 71 ? A CYS 163 ? 1_555 116.5 ? 16 SG ? A CYS 35 ? A CYS 127 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 ND1 ? A HIS 74 ? A HIS 166 ? 1_555 104.0 ? 17 SG ? A CYS 59 ? A CYS 151 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 ND1 ? A HIS 74 ? A HIS 166 ? 1_555 115.1 ? 18 SG ? A CYS 71 ? A CYS 163 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 ND1 ? A HIS 74 ? A HIS 166 ? 1_555 97.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-03-22 2 'Structure model' 1 1 2017-04-26 3 'Structure model' 1 2 2017-05-10 4 'Structure model' 1 3 2017-09-20 5 'Structure model' 1 4 2020-01-08 6 'Structure model' 1 5 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 5 'Structure model' 'Author supporting evidence' 5 6 'Structure model' 'Data collection' 6 6 'Structure model' 'Database references' 7 6 'Structure model' 'Derived calculations' 8 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_audit_support 2 5 'Structure model' pdbx_audit_support 3 6 'Structure model' chem_comp_atom 4 6 'Structure model' chem_comp_bond 5 6 'Structure model' database_2 6 6 'Structure model' pdbx_initial_refinement_model 7 6 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_audit_support.funding_organization' 2 5 'Structure model' '_pdbx_audit_support.funding_organization' 3 6 'Structure model' '_database_2.pdbx_DOI' 4 6 'Structure model' '_database_2.pdbx_database_accession' 5 6 'Structure model' '_struct_conn.pdbx_dist_value' 6 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 7 6 'Structure model' '_struct_conn.ptnr2_label_asym_id' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 135 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 301 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.12 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 NH1 A ARG 113 ? B 1_555 O A HOH 397 ? ? 4_555 2.15 2 1 O A HOH 379 ? ? 1_555 O A HOH 396 ? ? 4_555 2.16 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id CYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 99 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -77.49 _pdbx_validate_torsion.psi -76.60 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 402 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 7.01 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag Y _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id SER _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 97 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id OG _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id A _pdbx_unobs_or_zero_occ_atoms.label_comp_id SER _pdbx_unobs_or_zero_occ_atoms.label_seq_id 5 _pdbx_unobs_or_zero_occ_atoms.label_atom_id OG # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 93 ? A GLY 1 2 1 Y 1 A PRO 94 ? A PRO 2 3 1 Y 1 A LEU 95 ? A LEU 3 4 1 Y 1 A GLY 96 ? A GLY 4 5 1 Y 1 A LEU 168 ? A LEU 76 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 HOH O O N N 141 HOH H1 H N N 142 HOH H2 H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 ZN ZN ZN N N 374 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 HOH O H1 sing N N 134 HOH O H2 sing N N 135 ILE N CA sing N N 136 ILE N H sing N N 137 ILE N H2 sing N N 138 ILE CA C sing N N 139 ILE CA CB sing N N 140 ILE CA HA sing N N 141 ILE C O doub N N 142 ILE C OXT sing N N 143 ILE CB CG1 sing N N 144 ILE CB CG2 sing N N 145 ILE CB HB sing N N 146 ILE CG1 CD1 sing N N 147 ILE CG1 HG12 sing N N 148 ILE CG1 HG13 sing N N 149 ILE CG2 HG21 sing N N 150 ILE CG2 HG22 sing N N 151 ILE CG2 HG23 sing N N 152 ILE CD1 HD11 sing N N 153 ILE CD1 HD12 sing N N 154 ILE CD1 HD13 sing N N 155 ILE OXT HXT sing N N 156 LEU N CA sing N N 157 LEU N H sing N N 158 LEU N H2 sing N N 159 LEU CA C sing N N 160 LEU CA CB sing N N 161 LEU CA HA sing N N 162 LEU C O doub N N 163 LEU C OXT sing N N 164 LEU CB CG sing N N 165 LEU CB HB2 sing N N 166 LEU CB HB3 sing N N 167 LEU CG CD1 sing N N 168 LEU CG CD2 sing N N 169 LEU CG HG sing N N 170 LEU CD1 HD11 sing N N 171 LEU CD1 HD12 sing N N 172 LEU CD1 HD13 sing N N 173 LEU CD2 HD21 sing N N 174 LEU CD2 HD22 sing N N 175 LEU CD2 HD23 sing N N 176 LEU OXT HXT sing N N 177 LYS N CA sing N N 178 LYS N H sing N N 179 LYS N H2 sing N N 180 LYS CA C sing N N 181 LYS CA CB sing N N 182 LYS CA HA sing N N 183 LYS C O doub N N 184 LYS C OXT sing N N 185 LYS CB CG sing N N 186 LYS CB HB2 sing N N 187 LYS CB HB3 sing N N 188 LYS CG CD sing N N 189 LYS CG HG2 sing N N 190 LYS CG HG3 sing N N 191 LYS CD CE sing N N 192 LYS CD HD2 sing N N 193 LYS CD HD3 sing N N 194 LYS CE NZ sing N N 195 LYS CE HE2 sing N N 196 LYS CE HE3 sing N N 197 LYS NZ HZ1 sing N N 198 LYS NZ HZ2 sing N N 199 LYS NZ HZ3 sing N N 200 LYS OXT HXT sing N N 201 MET N CA sing N N 202 MET N H sing N N 203 MET N H2 sing N N 204 MET CA C sing N N 205 MET CA CB sing N N 206 MET CA HA sing N N 207 MET C O doub N N 208 MET C OXT sing N N 209 MET CB CG sing N N 210 MET CB HB2 sing N N 211 MET CB HB3 sing N N 212 MET CG SD sing N N 213 MET CG HG2 sing N N 214 MET CG HG3 sing N N 215 MET SD CE sing N N 216 MET CE HE1 sing N N 217 MET CE HE2 sing N N 218 MET CE HE3 sing N N 219 MET OXT HXT sing N N 220 PHE N CA sing N N 221 PHE N H sing N N 222 PHE N H2 sing N N 223 PHE CA C sing N N 224 PHE CA CB sing N N 225 PHE CA HA sing N N 226 PHE C O doub N N 227 PHE C OXT sing N N 228 PHE CB CG sing N N 229 PHE CB HB2 sing N N 230 PHE CB HB3 sing N N 231 PHE CG CD1 doub Y N 232 PHE CG CD2 sing Y N 233 PHE CD1 CE1 sing Y N 234 PHE CD1 HD1 sing N N 235 PHE CD2 CE2 doub Y N 236 PHE CD2 HD2 sing N N 237 PHE CE1 CZ doub Y N 238 PHE CE1 HE1 sing N N 239 PHE CE2 CZ sing Y N 240 PHE CE2 HE2 sing N N 241 PHE CZ HZ sing N N 242 PHE OXT HXT sing N N 243 PRO N CA sing N N 244 PRO N CD sing N N 245 PRO N H sing N N 246 PRO CA C sing N N 247 PRO CA CB sing N N 248 PRO CA HA sing N N 249 PRO C O doub N N 250 PRO C OXT sing N N 251 PRO CB CG sing N N 252 PRO CB HB2 sing N N 253 PRO CB HB3 sing N N 254 PRO CG CD sing N N 255 PRO CG HG2 sing N N 256 PRO CG HG3 sing N N 257 PRO CD HD2 sing N N 258 PRO CD HD3 sing N N 259 PRO OXT HXT sing N N 260 SER N CA sing N N 261 SER N H sing N N 262 SER N H2 sing N N 263 SER CA C sing N N 264 SER CA CB sing N N 265 SER CA HA sing N N 266 SER C O doub N N 267 SER C OXT sing N N 268 SER CB OG sing N N 269 SER CB HB2 sing N N 270 SER CB HB3 sing N N 271 SER OG HG sing N N 272 SER OXT HXT sing N N 273 THR N CA sing N N 274 THR N H sing N N 275 THR N H2 sing N N 276 THR CA C sing N N 277 THR CA CB sing N N 278 THR CA HA sing N N 279 THR C O doub N N 280 THR C OXT sing N N 281 THR CB OG1 sing N N 282 THR CB CG2 sing N N 283 THR CB HB sing N N 284 THR OG1 HG1 sing N N 285 THR CG2 HG21 sing N N 286 THR CG2 HG22 sing N N 287 THR CG2 HG23 sing N N 288 THR OXT HXT sing N N 289 TRP N CA sing N N 290 TRP N H sing N N 291 TRP N H2 sing N N 292 TRP CA C sing N N 293 TRP CA CB sing N N 294 TRP CA HA sing N N 295 TRP C O doub N N 296 TRP C OXT sing N N 297 TRP CB CG sing N N 298 TRP CB HB2 sing N N 299 TRP CB HB3 sing N N 300 TRP CG CD1 doub Y N 301 TRP CG CD2 sing Y N 302 TRP CD1 NE1 sing Y N 303 TRP CD1 HD1 sing N N 304 TRP CD2 CE2 doub Y N 305 TRP CD2 CE3 sing Y N 306 TRP NE1 CE2 sing Y N 307 TRP NE1 HE1 sing N N 308 TRP CE2 CZ2 sing Y N 309 TRP CE3 CZ3 doub Y N 310 TRP CE3 HE3 sing N N 311 TRP CZ2 CH2 doub Y N 312 TRP CZ2 HZ2 sing N N 313 TRP CZ3 CH2 sing Y N 314 TRP CZ3 HZ3 sing N N 315 TRP CH2 HH2 sing N N 316 TRP OXT HXT sing N N 317 TYR N CA sing N N 318 TYR N H sing N N 319 TYR N H2 sing N N 320 TYR CA C sing N N 321 TYR CA CB sing N N 322 TYR CA HA sing N N 323 TYR C O doub N N 324 TYR C OXT sing N N 325 TYR CB CG sing N N 326 TYR CB HB2 sing N N 327 TYR CB HB3 sing N N 328 TYR CG CD1 doub Y N 329 TYR CG CD2 sing Y N 330 TYR CD1 CE1 sing Y N 331 TYR CD1 HD1 sing N N 332 TYR CD2 CE2 doub Y N 333 TYR CD2 HD2 sing N N 334 TYR CE1 CZ doub Y N 335 TYR CE1 HE1 sing N N 336 TYR CE2 CZ sing Y N 337 TYR CE2 HE2 sing N N 338 TYR CZ OH sing N N 339 TYR OH HH sing N N 340 TYR OXT HXT sing N N 341 VAL N CA sing N N 342 VAL N H sing N N 343 VAL N H2 sing N N 344 VAL CA C sing N N 345 VAL CA CB sing N N 346 VAL CA HA sing N N 347 VAL C O doub N N 348 VAL C OXT sing N N 349 VAL CB CG1 sing N N 350 VAL CB CG2 sing N N 351 VAL CB HB sing N N 352 VAL CG1 HG11 sing N N 353 VAL CG1 HG12 sing N N 354 VAL CG1 HG13 sing N N 355 VAL CG2 HG21 sing N N 356 VAL CG2 HG22 sing N N 357 VAL CG2 HG23 sing N N 358 VAL OXT HXT sing N N 359 # _pdbx_audit_support.funding_organization 'Canadian Institutes of Health Research (CIHR)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'ZINC ION' ZN 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3NY3 _pdbx_initial_refinement_model.details ? #