data_5TMX # _entry.id 5TMX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5TMX pdb_00005tmx 10.2210/pdb5tmx/pdb WWPDB D_1000224514 ? ? BMRB 30192 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB 'Solution Structure of SinI, antagonist to the master biofilm-regulator SinR in Bacillus subtilis' 30192 unspecified PDB . 5TN0 unspecified PDB . 5TN2 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5TMX _pdbx_database_status.recvd_initial_deposition_date 2016-10-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Draughn, G.L.' 1 'Bobay, B.G.' 2 'Stowe, S.D.' 3 'Thompson, R.J.' 4 'Cavanagh, J.' 5 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;The Solution Structures and Interaction of SinR and SinI: Elucidating the Mechanism of Action of the Master Regulator Switch for Biofilm Formation in Bacillus subtilis. ; _citation.year 2019 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2019.08.019 _citation.pdbx_database_id_PubMed 31493408 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Milton, M.E.' 1 ? primary 'Draughn, G.L.' 2 ? primary 'Bobay, B.G.' 3 ? primary 'Stowe, S.D.' 4 ? primary 'Olson, A.L.' 5 ? primary 'Feldmann, E.A.' 6 ? primary 'Thompson, R.J.' 7 ? primary 'Myers, K.H.' 8 ? primary 'Santoro, M.T.' 9 ? primary 'Kearns, D.B.' 10 ? primary 'Cavanagh, J.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Protein SinI' _entity.formula_weight 7184.149 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 1-57' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSHMASMKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF _entity_poly.pdbx_seq_one_letter_code_can GSHMASMKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 SER n 1 7 MET n 1 8 LYS n 1 9 ASN n 1 10 ALA n 1 11 LYS n 1 12 GLN n 1 13 GLU n 1 14 HIS n 1 15 PHE n 1 16 GLU n 1 17 LEU n 1 18 ASP n 1 19 GLN n 1 20 GLU n 1 21 TRP n 1 22 VAL n 1 23 GLU n 1 24 LEU n 1 25 MET n 1 26 VAL n 1 27 GLU n 1 28 ALA n 1 29 LYS n 1 30 GLU n 1 31 ALA n 1 32 ASN n 1 33 ILE n 1 34 SER n 1 35 PRO n 1 36 GLU n 1 37 GLU n 1 38 ILE n 1 39 ARG n 1 40 LYS n 1 41 TYR n 1 42 LEU n 1 43 LEU n 1 44 LEU n 1 45 ASN n 1 46 LYS n 1 47 LYS n 1 48 SER n 1 49 ALA n 1 50 HIS n 1 51 PRO n 1 52 GLY n 1 53 PRO n 1 54 ALA n 1 55 ALA n 1 56 ARG n 1 57 SER n 1 58 HIS n 1 59 THR n 1 60 VAL n 1 61 ASN n 1 62 PRO n 1 63 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 63 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'sinI, BSU24600' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 168 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis (strain 168)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224308 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SINI_BACSU _struct_ref.pdbx_db_accession P23308 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5TMX A 7 ? 63 ? P23308 1 ? 57 ? 7 63 2 1 5TMX B 7 ? 63 ? P23308 1 ? 57 ? 7 63 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5TMX GLY A 1 ? UNP P23308 ? ? 'expression tag' 1 1 1 5TMX SER A 2 ? UNP P23308 ? ? 'expression tag' 2 2 1 5TMX HIS A 3 ? UNP P23308 ? ? 'expression tag' 3 3 1 5TMX MET A 4 ? UNP P23308 ? ? 'expression tag' 4 4 1 5TMX ALA A 5 ? UNP P23308 ? ? 'expression tag' 5 5 1 5TMX SER A 6 ? UNP P23308 ? ? 'expression tag' 6 6 2 5TMX GLY B 1 ? UNP P23308 ? ? 'expression tag' 1 7 2 5TMX SER B 2 ? UNP P23308 ? ? 'expression tag' 2 8 2 5TMX HIS B 3 ? UNP P23308 ? ? 'expression tag' 3 9 2 5TMX MET B 4 ? UNP P23308 ? ? 'expression tag' 4 10 2 5TMX ALA B 5 ? UNP P23308 ? ? 'expression tag' 5 11 2 5TMX SER B 6 ? UNP P23308 ? ? 'expression tag' 6 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 2 '2D 1H-13C HSQC' 1 isotropic 3 1 2 '3D HNCA' 1 isotropic 6 1 2 '3D HN(CO)CA' 1 isotropic 4 1 2 '3D HNCACB' 1 isotropic 12 1 2 '3D CBCA(CO)NH' 1 isotropic 5 1 2 '3D HNCO' 1 isotropic 7 1 2 '3D HNCACO' 1 isotropic 8 1 2 '3D 1H-15N TOCSY' 1 isotropic 9 1 2 '3D C(CO)NH' 1 isotropic 10 1 1 '3D 1H-15N NOESY' 1 isotropic 11 1 3 '3D 1H-13C NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 200 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '1 mM [U-15N] SinI, 20 mM MES, 200 mM sodium chloride, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample solution ? 2 '1 mM [U-13C; U-15N] SinI, 20 mM MES, 200 mM NaCl, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_13C_sample solution ? 3 '1 mM [U-13C; U-15N] SinI, 20 mM MES, 200 mM NaCl, 100% D2O' '100% D2O' 15N_13C_D2O_sample solution ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 5TMX _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # _pdbx_nmr_ensemble.entry_id 5TMX _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5TMX _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' NMRView ? 'Johnson, One Moon Scientific' 2 'structure calculation' CYANA 3.0 'Guntert, Mumenthaler and Wuthrich' 3 refinement Amber 14 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, and Kollman' 4 'peak picking' NMRView ? 'Johnson, One Moon Scientific' 5 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TMX _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5TMX _struct.title 'Solution Structure of SinI, antagonist to the master biofilm-regulator SinR in Bacillus subtilis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TMX _struct_keywords.text 'sporulation, repressor, biofilm, TRANSCRIPTION REGULATOR' _struct_keywords.pdbx_keywords 'TRANSCRIPTION REGULATOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 _struct_biol.details 'Dimer as determined by gel filtration' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 18 ? ASN A 32 ? ASP A 18 ASN A 32 1 ? 15 HELX_P HELX_P2 AA2 PRO A 35 ? ASN A 45 ? PRO A 35 ASN A 45 1 ? 11 HELX_P HELX_P3 AA3 LEU B 17 ? ASN B 32 ? LEU B 17 ASN B 32 1 ? 16 HELX_P HELX_P4 AA4 PRO B 35 ? ASN B 45 ? PRO B 35 ASN B 45 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 MET 7 B . ? MET 7 B LYS 8 B ? LYS 8 B 1 -8.50 2 LEU 17 A . ? LEU 17 A ASP 18 A ? ASP 18 A 5 2.36 # _atom_sites.entry_id 5TMX _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 PHE 63 63 63 PHE PHE A . n B 1 1 GLY 1 1 1 GLY GLY B . n B 1 2 SER 2 2 2 SER SER B . n B 1 3 HIS 3 3 3 HIS HIS B . n B 1 4 MET 4 4 4 MET MET B . n B 1 5 ALA 5 5 5 ALA ALA B . n B 1 6 SER 6 6 6 SER SER B . n B 1 7 MET 7 7 7 MET MET B . n B 1 8 LYS 8 8 8 LYS LYS B . n B 1 9 ASN 9 9 9 ASN ASN B . n B 1 10 ALA 10 10 10 ALA ALA B . n B 1 11 LYS 11 11 11 LYS LYS B . n B 1 12 GLN 12 12 12 GLN GLN B . n B 1 13 GLU 13 13 13 GLU GLU B . n B 1 14 HIS 14 14 14 HIS HIS B . n B 1 15 PHE 15 15 15 PHE PHE B . n B 1 16 GLU 16 16 16 GLU GLU B . n B 1 17 LEU 17 17 17 LEU LEU B . n B 1 18 ASP 18 18 18 ASP ASP B . n B 1 19 GLN 19 19 19 GLN GLN B . n B 1 20 GLU 20 20 20 GLU GLU B . n B 1 21 TRP 21 21 21 TRP TRP B . n B 1 22 VAL 22 22 22 VAL VAL B . n B 1 23 GLU 23 23 23 GLU GLU B . n B 1 24 LEU 24 24 24 LEU LEU B . n B 1 25 MET 25 25 25 MET MET B . n B 1 26 VAL 26 26 26 VAL VAL B . n B 1 27 GLU 27 27 27 GLU GLU B . n B 1 28 ALA 28 28 28 ALA ALA B . n B 1 29 LYS 29 29 29 LYS LYS B . n B 1 30 GLU 30 30 30 GLU GLU B . n B 1 31 ALA 31 31 31 ALA ALA B . n B 1 32 ASN 32 32 32 ASN ASN B . n B 1 33 ILE 33 33 33 ILE ILE B . n B 1 34 SER 34 34 34 SER SER B . n B 1 35 PRO 35 35 35 PRO PRO B . n B 1 36 GLU 36 36 36 GLU GLU B . n B 1 37 GLU 37 37 37 GLU GLU B . n B 1 38 ILE 38 38 38 ILE ILE B . n B 1 39 ARG 39 39 39 ARG ARG B . n B 1 40 LYS 40 40 40 LYS LYS B . n B 1 41 TYR 41 41 41 TYR TYR B . n B 1 42 LEU 42 42 42 LEU LEU B . n B 1 43 LEU 43 43 43 LEU LEU B . n B 1 44 LEU 44 44 44 LEU LEU B . n B 1 45 ASN 45 45 45 ASN ASN B . n B 1 46 LYS 46 46 46 LYS LYS B . n B 1 47 LYS 47 47 47 LYS LYS B . n B 1 48 SER 48 48 48 SER SER B . n B 1 49 ALA 49 49 49 ALA ALA B . n B 1 50 HIS 50 50 50 HIS HIS B . n B 1 51 PRO 51 51 51 PRO PRO B . n B 1 52 GLY 52 52 52 GLY GLY B . n B 1 53 PRO 53 53 53 PRO PRO B . n B 1 54 ALA 54 54 54 ALA ALA B . n B 1 55 ALA 55 55 55 ALA ALA B . n B 1 56 ARG 56 56 56 ARG ARG B . n B 1 57 SER 57 57 57 SER SER B . n B 1 58 HIS 58 58 58 HIS HIS B . n B 1 59 THR 59 59 59 THR THR B . n B 1 60 VAL 60 60 60 VAL VAL B . n B 1 61 ASN 61 61 61 ASN ASN B . n B 1 62 PRO 62 62 62 PRO PRO B . n B 1 63 PHE 63 63 63 PHE PHE B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2670 ? 1 MORE -20 ? 1 'SSA (A^2)' 12270 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-10-25 2 'Structure model' 1 1 2019-10-09 3 'Structure model' 1 2 2019-12-25 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' pdbx_audit_support 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_pdbx_nmr_software.name' 11 2 'Structure model' '_pdbx_nmr_spectrometer.model' 12 3 'Structure model' '_pdbx_audit_support.funding_organization' 13 4 'Structure model' '_database_2.pdbx_DOI' 14 4 'Structure model' '_database_2.pdbx_database_accession' 15 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 SinI 1 ? mM '[U-15N]' 1 MES 20 ? mM 'natural abundance' 1 'sodium chloride' 200 ? mM 'natural abundance' 2 SinI 1 ? mM '[U-13C; U-15N]' 2 MES 20 ? mM 'natural abundance' 2 NaCl 200 ? mM 'natural abundance' 3 SinI 1 ? mM '[U-13C; U-15N]' 3 MES 20 ? mM 'natural abundance' 3 NaCl 200 ? mM 'natural abundance' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 39 ? ? CZ A ARG 39 ? ? NH2 A ARG 39 ? ? 124.23 120.30 3.93 0.50 N 2 1 NE B ARG 39 ? ? CZ B ARG 39 ? ? NH2 B ARG 39 ? ? 123.33 120.30 3.03 0.50 N 3 3 NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 123.34 120.30 3.04 0.50 N 4 4 NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 123.58 120.30 3.28 0.50 N 5 4 CB A TYR 41 ? ? CG A TYR 41 ? ? CD1 A TYR 41 ? ? 117.39 121.00 -3.61 0.60 N 6 4 NE B ARG 39 ? ? CZ B ARG 39 ? ? NH2 B ARG 39 ? ? 124.39 120.30 4.09 0.50 N 7 4 CB B TYR 41 ? ? CG B TYR 41 ? ? CD1 B TYR 41 ? ? 117.06 121.00 -3.94 0.60 N 8 5 NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 124.45 120.30 4.15 0.50 N 9 5 NE B ARG 39 ? ? CZ B ARG 39 ? ? NH2 B ARG 39 ? ? 123.55 120.30 3.25 0.50 N 10 6 NE A ARG 39 ? ? CZ A ARG 39 ? ? NH2 A ARG 39 ? ? 123.43 120.30 3.13 0.50 N 11 6 CB A TYR 41 ? ? CG A TYR 41 ? ? CD1 A TYR 41 ? ? 117.12 121.00 -3.88 0.60 N 12 6 NE B ARG 39 ? ? CZ B ARG 39 ? ? NH2 B ARG 39 ? ? 123.38 120.30 3.08 0.50 N 13 7 NE B ARG 39 ? ? CZ B ARG 39 ? ? NH1 B ARG 39 ? ? 124.64 120.30 4.34 0.50 N 14 8 NE A ARG 56 ? ? CZ A ARG 56 ? ? NH1 A ARG 56 ? ? 123.54 120.30 3.24 0.50 N 15 8 NE B ARG 39 ? ? CZ B ARG 39 ? ? NH1 B ARG 39 ? ? 123.59 120.30 3.29 0.50 N 16 9 NE A ARG 39 ? ? CZ A ARG 39 ? ? NH2 A ARG 39 ? ? 124.14 120.30 3.84 0.50 N 17 9 NE B ARG 39 ? ? CZ B ARG 39 ? ? NH1 B ARG 39 ? ? 123.41 120.30 3.11 0.50 N 18 10 NE B ARG 39 ? ? CZ B ARG 39 ? ? NH1 B ARG 39 ? ? 123.41 120.30 3.11 0.50 N 19 10 CB B TYR 41 ? ? CG B TYR 41 ? ? CD2 B TYR 41 ? ? 117.34 121.00 -3.66 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 18 ? ? -154.15 -73.02 2 1 ASN A 45 ? ? -84.85 41.45 3 1 LYS B 46 ? ? -77.18 45.11 4 2 MET A 4 ? ? 55.80 18.91 5 2 GLN A 12 ? ? -140.58 39.56 6 2 GLN A 19 ? ? 58.58 -5.19 7 2 LYS A 46 ? ? -77.86 38.95 8 2 HIS A 58 ? ? 66.22 -20.12 9 2 ASP B 18 ? ? -76.89 35.13 10 2 GLN B 19 ? ? 57.60 8.36 11 3 LYS A 47 ? ? 56.66 -38.79 12 3 GLN B 19 ? ? 60.85 -39.60 13 3 LYS B 46 ? ? -77.84 40.71 14 4 HIS A 3 ? ? 58.39 18.99 15 4 GLN A 19 ? ? 62.45 -17.40 16 4 ASN A 32 ? ? 57.34 71.24 17 4 ILE A 33 ? ? -105.25 69.75 18 4 ASN B 9 ? ? -145.96 -14.25 19 4 ASN B 45 ? ? -143.80 31.97 20 4 LYS B 47 ? ? 45.96 -146.63 21 5 GLN A 12 ? ? -146.76 36.22 22 5 GLN A 19 ? ? 61.93 -1.22 23 5 ALA A 54 ? ? 59.22 166.74 24 5 SER A 57 ? ? -74.59 48.52 25 5 LEU B 17 ? ? 58.97 -50.99 26 5 GLN B 19 ? ? 59.05 -27.39 27 6 ASP A 18 ? ? -162.61 -58.63 28 6 SER B 48 ? ? 59.99 -179.42 29 7 ALA A 10 ? ? 59.21 173.59 30 7 ASP A 18 ? ? -146.22 -76.09 31 7 MET B 4 ? ? 54.03 19.20 32 7 SER B 48 ? ? -55.06 173.13 33 7 SER B 57 ? ? 62.03 169.52 34 8 ALA A 5 ? ? 56.59 -177.21 35 8 GLU A 13 ? ? -84.54 31.86 36 8 ASP A 18 ? ? -85.94 47.42 37 8 GLN A 19 ? ? 59.15 18.02 38 8 LYS A 46 ? ? 52.83 19.85 39 8 SER B 2 ? ? 65.24 144.36 40 8 HIS B 3 ? ? 59.69 166.01 41 8 HIS B 14 ? ? -152.33 18.08 42 8 ASP B 18 ? ? -150.77 -51.34 43 8 ARG B 56 ? ? -79.11 49.69 44 9 GLU A 16 ? ? -80.14 40.88 45 9 ASP A 18 ? ? -126.02 -58.13 46 9 SER A 48 ? ? 59.98 7.55 47 9 ASN A 61 ? ? -152.06 -42.22 48 9 HIS B 14 ? ? -74.49 48.57 49 9 ASP B 18 ? ? -69.32 88.36 50 9 LYS B 47 ? ? 60.84 -172.42 51 9 SER B 57 ? ? 53.71 -141.19 52 10 ASP A 18 ? ? -146.47 -52.18 53 10 GLN A 19 ? ? -141.20 -8.73 54 10 LYS A 47 ? ? 64.65 -35.78 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number RO1-GM055769 _pdbx_audit_support.ordinal 1 #