data_5TUJ # _entry.id 5TUJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5TUJ pdb_00005tuj 10.2210/pdb5tuj/pdb WWPDB D_1000224550 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-12-06 2 'Structure model' 1 1 2019-01-16 3 'Structure model' 1 2 2024-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5TUJ _pdbx_database_status.recvd_initial_deposition_date 2016-11-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kaczmarski, J.A.' 1 ? 'Clifton, B.E.' 2 ? 'Carr, P.D.' 3 ? 'Jackson, C.J.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat. Chem. Biol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1552-4469 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 542 _citation.page_last 547 _citation.title 'Evolution of cyclohexadienyl dehydratase from an ancestral solute-binding protein.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41589-018-0043-2 _citation.pdbx_database_id_PubMed 29686357 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Clifton, B.E.' 1 ? primary 'Kaczmarski, J.A.' 2 ? primary 'Carr, P.D.' 3 ? primary 'Gerth, M.L.' 4 0000-0002-7959-7852 primary 'Tokuriki, N.' 5 ? primary 'Jackson, C.J.' 6 0000-0001-6150-3822 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ancestral protein CDT-Anc1' _entity.formula_weight 26292.078 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AASTLDEIMKRGTLRVGTDADYKPFSFKDKNGQYTGFDIDLAKALAKELGVKVEFVPTTWDGIIPALQTGKFDIVMSGMT ITPERKKKVDFSDPYMTAGQTILVKKDNADKIKSFEDLNKPDVKVAVQLGTTSEQAAKEFLPKAKIRTFENNAEAFQEVV SGRADAMVTDSPVAAYYAKKNPGLAVVVVDEPFTHEPLGFAIRKGDPELLNWVNNWLKQMKKDGTYDKLYEKWFK ; _entity_poly.pdbx_seq_one_letter_code_can ;AASTLDEIMKRGTLRVGTDADYKPFSFKDKNGQYTGFDIDLAKALAKELGVKVEFVPTTWDGIIPALQTGKFDIVMSGMT ITPERKKKVDFSDPYMTAGQTILVKKDNADKIKSFEDLNKPDVKVAVQLGTTSEQAAKEFLPKAKIRTFENNAEAFQEVV SGRADAMVTDSPVAAYYAKKNPGLAVVVVDEPFTHEPLGFAIRKGDPELLNWVNNWLKQMKKDGTYDKLYEKWFK ; _entity_poly.pdbx_strand_id C _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ALA n 1 3 SER n 1 4 THR n 1 5 LEU n 1 6 ASP n 1 7 GLU n 1 8 ILE n 1 9 MET n 1 10 LYS n 1 11 ARG n 1 12 GLY n 1 13 THR n 1 14 LEU n 1 15 ARG n 1 16 VAL n 1 17 GLY n 1 18 THR n 1 19 ASP n 1 20 ALA n 1 21 ASP n 1 22 TYR n 1 23 LYS n 1 24 PRO n 1 25 PHE n 1 26 SER n 1 27 PHE n 1 28 LYS n 1 29 ASP n 1 30 LYS n 1 31 ASN n 1 32 GLY n 1 33 GLN n 1 34 TYR n 1 35 THR n 1 36 GLY n 1 37 PHE n 1 38 ASP n 1 39 ILE n 1 40 ASP n 1 41 LEU n 1 42 ALA n 1 43 LYS n 1 44 ALA n 1 45 LEU n 1 46 ALA n 1 47 LYS n 1 48 GLU n 1 49 LEU n 1 50 GLY n 1 51 VAL n 1 52 LYS n 1 53 VAL n 1 54 GLU n 1 55 PHE n 1 56 VAL n 1 57 PRO n 1 58 THR n 1 59 THR n 1 60 TRP n 1 61 ASP n 1 62 GLY n 1 63 ILE n 1 64 ILE n 1 65 PRO n 1 66 ALA n 1 67 LEU n 1 68 GLN n 1 69 THR n 1 70 GLY n 1 71 LYS n 1 72 PHE n 1 73 ASP n 1 74 ILE n 1 75 VAL n 1 76 MET n 1 77 SER n 1 78 GLY n 1 79 MET n 1 80 THR n 1 81 ILE n 1 82 THR n 1 83 PRO n 1 84 GLU n 1 85 ARG n 1 86 LYS n 1 87 LYS n 1 88 LYS n 1 89 VAL n 1 90 ASP n 1 91 PHE n 1 92 SER n 1 93 ASP n 1 94 PRO n 1 95 TYR n 1 96 MET n 1 97 THR n 1 98 ALA n 1 99 GLY n 1 100 GLN n 1 101 THR n 1 102 ILE n 1 103 LEU n 1 104 VAL n 1 105 LYS n 1 106 LYS n 1 107 ASP n 1 108 ASN n 1 109 ALA n 1 110 ASP n 1 111 LYS n 1 112 ILE n 1 113 LYS n 1 114 SER n 1 115 PHE n 1 116 GLU n 1 117 ASP n 1 118 LEU n 1 119 ASN n 1 120 LYS n 1 121 PRO n 1 122 ASP n 1 123 VAL n 1 124 LYS n 1 125 VAL n 1 126 ALA n 1 127 VAL n 1 128 GLN n 1 129 LEU n 1 130 GLY n 1 131 THR n 1 132 THR n 1 133 SER n 1 134 GLU n 1 135 GLN n 1 136 ALA n 1 137 ALA n 1 138 LYS n 1 139 GLU n 1 140 PHE n 1 141 LEU n 1 142 PRO n 1 143 LYS n 1 144 ALA n 1 145 LYS n 1 146 ILE n 1 147 ARG n 1 148 THR n 1 149 PHE n 1 150 GLU n 1 151 ASN n 1 152 ASN n 1 153 ALA n 1 154 GLU n 1 155 ALA n 1 156 PHE n 1 157 GLN n 1 158 GLU n 1 159 VAL n 1 160 VAL n 1 161 SER n 1 162 GLY n 1 163 ARG n 1 164 ALA n 1 165 ASP n 1 166 ALA n 1 167 MET n 1 168 VAL n 1 169 THR n 1 170 ASP n 1 171 SER n 1 172 PRO n 1 173 VAL n 1 174 ALA n 1 175 ALA n 1 176 TYR n 1 177 TYR n 1 178 ALA n 1 179 LYS n 1 180 LYS n 1 181 ASN n 1 182 PRO n 1 183 GLY n 1 184 LEU n 1 185 ALA n 1 186 VAL n 1 187 VAL n 1 188 VAL n 1 189 VAL n 1 190 ASP n 1 191 GLU n 1 192 PRO n 1 193 PHE n 1 194 THR n 1 195 HIS n 1 196 GLU n 1 197 PRO n 1 198 LEU n 1 199 GLY n 1 200 PHE n 1 201 ALA n 1 202 ILE n 1 203 ARG n 1 204 LYS n 1 205 GLY n 1 206 ASP n 1 207 PRO n 1 208 GLU n 1 209 LEU n 1 210 LEU n 1 211 ASN n 1 212 TRP n 1 213 VAL n 1 214 ASN n 1 215 ASN n 1 216 TRP n 1 217 LEU n 1 218 LYS n 1 219 GLN n 1 220 MET n 1 221 LYS n 1 222 LYS n 1 223 ASP n 1 224 GLY n 1 225 THR n 1 226 TYR n 1 227 ASP n 1 228 LYS n 1 229 LEU n 1 230 TYR n 1 231 GLU n 1 232 LYS n 1 233 TRP n 1 234 PHE n 1 235 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 235 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name unidentified _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32644 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 12 ? ? ? C . n A 1 2 ALA 2 13 ? ? ? C . n A 1 3 SER 3 14 14 SER SER C . n A 1 4 THR 4 15 15 THR THR C . n A 1 5 LEU 5 16 16 LEU LEU C . n A 1 6 ASP 6 17 17 ASP ASP C . n A 1 7 GLU 7 18 18 GLU GLU C . n A 1 8 ILE 8 19 19 ILE ILE C . n A 1 9 MET 9 20 20 MET MET C . n A 1 10 LYS 10 21 21 LYS LYS C . n A 1 11 ARG 11 22 22 ARG ARG C . n A 1 12 GLY 12 23 23 GLY GLY C . n A 1 13 THR 13 24 24 THR THR C . n A 1 14 LEU 14 25 25 LEU LEU C . n A 1 15 ARG 15 26 26 ARG ARG C . n A 1 16 VAL 16 27 27 VAL VAL C . n A 1 17 GLY 17 28 28 GLY GLY C . n A 1 18 THR 18 29 29 THR THR C . n A 1 19 ASP 19 30 30 ASP ASP C . n A 1 20 ALA 20 31 31 ALA ALA C . n A 1 21 ASP 21 32 32 ASP ASP C . n A 1 22 TYR 22 33 33 TYR TYR C . n A 1 23 LYS 23 34 34 LYS LYS C . n A 1 24 PRO 24 35 35 PRO PRO C . n A 1 25 PHE 25 36 36 PHE PHE C . n A 1 26 SER 26 37 37 SER SER C . n A 1 27 PHE 27 38 38 PHE PHE C . n A 1 28 LYS 28 39 39 LYS LYS C . n A 1 29 ASP 29 40 40 ASP ASP C . n A 1 30 LYS 30 41 41 LYS LYS C . n A 1 31 ASN 31 42 42 ASN ASN C . n A 1 32 GLY 32 43 43 GLY GLY C . n A 1 33 GLN 33 44 44 GLN GLN C . n A 1 34 TYR 34 45 45 TYR TYR C . n A 1 35 THR 35 46 46 THR THR C . n A 1 36 GLY 36 47 47 GLY GLY C . n A 1 37 PHE 37 48 48 PHE PHE C . n A 1 38 ASP 38 49 49 ASP ASP C . n A 1 39 ILE 39 50 50 ILE ILE C . n A 1 40 ASP 40 51 51 ASP ASP C . n A 1 41 LEU 41 52 52 LEU LEU C . n A 1 42 ALA 42 53 53 ALA ALA C . n A 1 43 LYS 43 54 54 LYS LYS C . n A 1 44 ALA 44 55 55 ALA ALA C . n A 1 45 LEU 45 56 56 LEU LEU C . n A 1 46 ALA 46 57 57 ALA ALA C . n A 1 47 LYS 47 58 58 LYS LYS C . n A 1 48 GLU 48 59 59 GLU GLU C . n A 1 49 LEU 49 60 60 LEU LEU C . n A 1 50 GLY 50 61 61 GLY GLY C . n A 1 51 VAL 51 62 62 VAL VAL C . n A 1 52 LYS 52 63 63 LYS LYS C . n A 1 53 VAL 53 64 64 VAL VAL C . n A 1 54 GLU 54 65 65 GLU GLU C . n A 1 55 PHE 55 66 66 PHE PHE C . n A 1 56 VAL 56 67 67 VAL VAL C . n A 1 57 PRO 57 68 68 PRO PRO C . n A 1 58 THR 58 69 69 THR THR C . n A 1 59 THR 59 70 70 THR THR C . n A 1 60 TRP 60 71 71 TRP TRP C . n A 1 61 ASP 61 72 72 ASP ASP C . n A 1 62 GLY 62 73 73 GLY GLY C . n A 1 63 ILE 63 74 74 ILE ILE C . n A 1 64 ILE 64 75 75 ILE ILE C . n A 1 65 PRO 65 76 76 PRO PRO C . n A 1 66 ALA 66 77 77 ALA ALA C . n A 1 67 LEU 67 78 78 LEU LEU C . n A 1 68 GLN 68 79 79 GLN GLN C . n A 1 69 THR 69 80 80 THR THR C . n A 1 70 GLY 70 81 81 GLY GLY C . n A 1 71 LYS 71 82 82 LYS LYS C . n A 1 72 PHE 72 83 83 PHE PHE C . n A 1 73 ASP 73 84 84 ASP ASP C . n A 1 74 ILE 74 85 85 ILE ILE C . n A 1 75 VAL 75 86 86 VAL VAL C . n A 1 76 MET 76 87 87 MET MET C . n A 1 77 SER 77 88 88 SER SER C . n A 1 78 GLY 78 89 89 GLY GLY C . n A 1 79 MET 79 90 90 MET MET C . n A 1 80 THR 80 91 91 THR THR C . n A 1 81 ILE 81 92 92 ILE ILE C . n A 1 82 THR 82 93 93 THR THR C . n A 1 83 PRO 83 94 94 PRO PRO C . n A 1 84 GLU 84 95 95 GLU GLU C . n A 1 85 ARG 85 96 96 ARG ARG C . n A 1 86 LYS 86 97 97 LYS LYS C . n A 1 87 LYS 87 98 98 LYS LYS C . n A 1 88 LYS 88 99 99 LYS LYS C . n A 1 89 VAL 89 100 100 VAL VAL C . n A 1 90 ASP 90 101 101 ASP ASP C . n A 1 91 PHE 91 102 102 PHE PHE C . n A 1 92 SER 92 103 103 SER SER C . n A 1 93 ASP 93 104 104 ASP ASP C . n A 1 94 PRO 94 105 105 PRO PRO C . n A 1 95 TYR 95 106 106 TYR TYR C . n A 1 96 MET 96 107 107 MET MET C . n A 1 97 THR 97 108 108 THR THR C . n A 1 98 ALA 98 109 109 ALA ALA C . n A 1 99 GLY 99 110 110 GLY GLY C . n A 1 100 GLN 100 111 111 GLN GLN C . n A 1 101 THR 101 112 112 THR THR C . n A 1 102 ILE 102 113 113 ILE ILE C . n A 1 103 LEU 103 114 114 LEU LEU C . n A 1 104 VAL 104 115 115 VAL VAL C . n A 1 105 LYS 105 116 116 LYS LYS C . n A 1 106 LYS 106 117 117 LYS LYS C . n A 1 107 ASP 107 118 118 ASP ASP C . n A 1 108 ASN 108 119 119 ASN ASN C . n A 1 109 ALA 109 120 120 ALA ALA C . n A 1 110 ASP 110 121 121 ASP ASP C . n A 1 111 LYS 111 122 122 LYS LYS C . n A 1 112 ILE 112 123 123 ILE ILE C . n A 1 113 LYS 113 124 124 LYS LYS C . n A 1 114 SER 114 125 125 SER SER C . n A 1 115 PHE 115 126 126 PHE PHE C . n A 1 116 GLU 116 127 127 GLU GLU C . n A 1 117 ASP 117 128 128 ASP ASP C . n A 1 118 LEU 118 129 129 LEU LEU C . n A 1 119 ASN 119 130 130 ASN ASN C . n A 1 120 LYS 120 131 131 LYS LYS C . n A 1 121 PRO 121 132 132 PRO PRO C . n A 1 122 ASP 122 133 133 ASP ASP C . n A 1 123 VAL 123 134 134 VAL VAL C . n A 1 124 LYS 124 135 135 LYS LYS C . n A 1 125 VAL 125 136 136 VAL VAL C . n A 1 126 ALA 126 137 137 ALA ALA C . n A 1 127 VAL 127 138 138 VAL VAL C . n A 1 128 GLN 128 139 139 GLN GLN C . n A 1 129 LEU 129 140 140 LEU LEU C . n A 1 130 GLY 130 141 141 GLY GLY C . n A 1 131 THR 131 142 142 THR THR C . n A 1 132 THR 132 143 143 THR THR C . n A 1 133 SER 133 144 144 SER SER C . n A 1 134 GLU 134 145 145 GLU GLU C . n A 1 135 GLN 135 146 146 GLN GLN C . n A 1 136 ALA 136 147 147 ALA ALA C . n A 1 137 ALA 137 148 148 ALA ALA C . n A 1 138 LYS 138 149 149 LYS LYS C . n A 1 139 GLU 139 150 150 GLU GLU C . n A 1 140 PHE 140 151 151 PHE PHE C . n A 1 141 LEU 141 152 152 LEU LEU C . n A 1 142 PRO 142 153 153 PRO PRO C . n A 1 143 LYS 143 154 154 LYS LYS C . n A 1 144 ALA 144 155 155 ALA ALA C . n A 1 145 LYS 145 156 156 LYS LYS C . n A 1 146 ILE 146 157 157 ILE ILE C . n A 1 147 ARG 147 158 158 ARG ARG C . n A 1 148 THR 148 159 159 THR THR C . n A 1 149 PHE 149 160 160 PHE PHE C . n A 1 150 GLU 150 161 161 GLU GLU C . n A 1 151 ASN 151 162 162 ASN ASN C . n A 1 152 ASN 152 163 163 ASN ASN C . n A 1 153 ALA 153 164 164 ALA ALA C . n A 1 154 GLU 154 165 165 GLU GLU C . n A 1 155 ALA 155 166 166 ALA ALA C . n A 1 156 PHE 156 167 167 PHE PHE C . n A 1 157 GLN 157 168 168 GLN GLN C . n A 1 158 GLU 158 169 169 GLU GLU C . n A 1 159 VAL 159 170 170 VAL VAL C . n A 1 160 VAL 160 171 171 VAL VAL C . n A 1 161 SER 161 172 172 SER SER C . n A 1 162 GLY 162 173 173 GLY GLY C . n A 1 163 ARG 163 174 174 ARG ARG C . n A 1 164 ALA 164 175 175 ALA ALA C . n A 1 165 ASP 165 176 176 ASP ASP C . n A 1 166 ALA 166 177 177 ALA ALA C . n A 1 167 MET 167 178 178 MET MET C . n A 1 168 VAL 168 179 179 VAL VAL C . n A 1 169 THR 169 180 180 THR THR C . n A 1 170 ASP 170 181 181 ASP ASP C . n A 1 171 SER 171 182 182 SER SER C . n A 1 172 PRO 172 183 183 PRO PRO C . n A 1 173 VAL 173 184 184 VAL VAL C . n A 1 174 ALA 174 185 185 ALA ALA C . n A 1 175 ALA 175 186 186 ALA ALA C . n A 1 176 TYR 176 187 187 TYR TYR C . n A 1 177 TYR 177 188 188 TYR TYR C . n A 1 178 ALA 178 189 189 ALA ALA C . n A 1 179 LYS 179 190 190 LYS LYS C . n A 1 180 LYS 180 191 ? ? ? C . n A 1 181 ASN 181 192 ? ? ? C . n A 1 182 PRO 182 193 ? ? ? C . n A 1 183 GLY 183 194 ? ? ? C . n A 1 184 LEU 184 195 195 LEU LEU C . n A 1 185 ALA 185 196 196 ALA ALA C . n A 1 186 VAL 186 197 197 VAL VAL C . n A 1 187 VAL 187 198 198 VAL VAL C . n A 1 188 VAL 188 199 199 VAL VAL C . n A 1 189 VAL 189 200 200 VAL VAL C . n A 1 190 ASP 190 201 201 ASP ASP C . n A 1 191 GLU 191 202 202 GLU GLU C . n A 1 192 PRO 192 203 203 PRO PRO C . n A 1 193 PHE 193 204 204 PHE PHE C . n A 1 194 THR 194 205 205 THR THR C . n A 1 195 HIS 195 206 206 HIS HIS C . n A 1 196 GLU 196 207 207 GLU GLU C . n A 1 197 PRO 197 208 208 PRO PRO C . n A 1 198 LEU 198 209 209 LEU LEU C . n A 1 199 GLY 199 210 210 GLY GLY C . n A 1 200 PHE 200 211 211 PHE PHE C . n A 1 201 ALA 201 212 212 ALA ALA C . n A 1 202 ILE 202 213 213 ILE ILE C . n A 1 203 ARG 203 214 214 ARG ARG C . n A 1 204 LYS 204 215 215 LYS LYS C . n A 1 205 GLY 205 216 216 GLY GLY C . n A 1 206 ASP 206 217 217 ASP ASP C . n A 1 207 PRO 207 218 218 PRO PRO C . n A 1 208 GLU 208 219 219 GLU GLU C . n A 1 209 LEU 209 220 220 LEU LEU C . n A 1 210 LEU 210 221 221 LEU LEU C . n A 1 211 ASN 211 222 222 ASN ASN C . n A 1 212 TRP 212 223 223 TRP TRP C . n A 1 213 VAL 213 224 224 VAL VAL C . n A 1 214 ASN 214 225 225 ASN ASN C . n A 1 215 ASN 215 226 226 ASN ASN C . n A 1 216 TRP 216 227 227 TRP TRP C . n A 1 217 LEU 217 228 228 LEU LEU C . n A 1 218 LYS 218 229 229 LYS LYS C . n A 1 219 GLN 219 230 230 GLN GLN C . n A 1 220 MET 220 231 231 MET MET C . n A 1 221 LYS 221 232 232 LYS LYS C . n A 1 222 LYS 222 233 233 LYS LYS C . n A 1 223 ASP 223 234 234 ASP ASP C . n A 1 224 GLY 224 235 235 GLY GLY C . n A 1 225 THR 225 236 236 THR THR C . n A 1 226 TYR 226 237 237 TYR TYR C . n A 1 227 ASP 227 238 238 ASP ASP C . n A 1 228 LYS 228 239 239 LYS LYS C . n A 1 229 LEU 229 240 240 LEU LEU C . n A 1 230 TYR 230 241 241 TYR TYR C . n A 1 231 GLU 231 242 242 GLU GLU C . n A 1 232 LYS 232 243 243 LYS LYS C . n A 1 233 TRP 233 244 244 TRP TRP C . n A 1 234 PHE 234 245 245 PHE PHE C . n A 1 235 LYS 235 246 246 LYS LYS C . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 C GLU 18 ? CG ? A GLU 7 CG 2 1 Y 1 C GLU 18 ? CD ? A GLU 7 CD 3 1 Y 1 C GLU 18 ? OE1 ? A GLU 7 OE1 4 1 Y 1 C GLU 18 ? OE2 ? A GLU 7 OE2 5 1 Y 1 C LYS 21 ? CG ? A LYS 10 CG 6 1 Y 1 C LYS 21 ? CD ? A LYS 10 CD 7 1 Y 1 C LYS 21 ? CE ? A LYS 10 CE 8 1 Y 1 C LYS 21 ? NZ ? A LYS 10 NZ 9 1 Y 1 C LYS 39 ? CG ? A LYS 28 CG 10 1 Y 1 C LYS 39 ? CD ? A LYS 28 CD 11 1 Y 1 C LYS 39 ? CE ? A LYS 28 CE 12 1 Y 1 C LYS 39 ? NZ ? A LYS 28 NZ 13 1 Y 1 C LYS 41 ? CG ? A LYS 30 CG 14 1 Y 1 C LYS 41 ? CD ? A LYS 30 CD 15 1 Y 1 C LYS 41 ? CE ? A LYS 30 CE 16 1 Y 1 C LYS 41 ? NZ ? A LYS 30 NZ 17 1 Y 1 C LYS 58 ? CG ? A LYS 47 CG 18 1 Y 1 C LYS 58 ? CD ? A LYS 47 CD 19 1 Y 1 C LYS 58 ? CE ? A LYS 47 CE 20 1 Y 1 C LYS 58 ? NZ ? A LYS 47 NZ 21 1 Y 1 C LYS 82 ? CG ? A LYS 71 CG 22 1 Y 1 C LYS 82 ? CD ? A LYS 71 CD 23 1 Y 1 C LYS 82 ? CE ? A LYS 71 CE 24 1 Y 1 C LYS 82 ? NZ ? A LYS 71 NZ 25 1 Y 1 C LYS 99 ? CG ? A LYS 88 CG 26 1 Y 1 C LYS 99 ? CD ? A LYS 88 CD 27 1 Y 1 C LYS 99 ? CE ? A LYS 88 CE 28 1 Y 1 C LYS 99 ? NZ ? A LYS 88 NZ 29 1 Y 1 C LYS 117 ? CG ? A LYS 106 CG 30 1 Y 1 C LYS 117 ? CD ? A LYS 106 CD 31 1 Y 1 C LYS 117 ? CE ? A LYS 106 CE 32 1 Y 1 C LYS 117 ? NZ ? A LYS 106 NZ 33 1 Y 1 C ASN 119 ? CG ? A ASN 108 CG 34 1 Y 1 C ASN 119 ? OD1 ? A ASN 108 OD1 35 1 Y 1 C ASN 119 ? ND2 ? A ASN 108 ND2 36 1 Y 1 C ASP 121 ? CG ? A ASP 110 CG 37 1 Y 1 C ASP 121 ? OD1 ? A ASP 110 OD1 38 1 Y 1 C ASP 121 ? OD2 ? A ASP 110 OD2 39 1 Y 1 C LYS 122 ? CG ? A LYS 111 CG 40 1 Y 1 C LYS 122 ? CD ? A LYS 111 CD 41 1 Y 1 C LYS 122 ? CE ? A LYS 111 CE 42 1 Y 1 C LYS 122 ? NZ ? A LYS 111 NZ 43 1 Y 1 C LYS 124 ? CG ? A LYS 113 CG 44 1 Y 1 C LYS 124 ? CD ? A LYS 113 CD 45 1 Y 1 C LYS 124 ? CE ? A LYS 113 CE 46 1 Y 1 C LYS 124 ? NZ ? A LYS 113 NZ 47 1 Y 1 C LYS 154 ? CG ? A LYS 143 CG 48 1 Y 1 C LYS 154 ? CD ? A LYS 143 CD 49 1 Y 1 C LYS 154 ? CE ? A LYS 143 CE 50 1 Y 1 C LYS 154 ? NZ ? A LYS 143 NZ 51 1 Y 1 C ARG 158 ? CG ? A ARG 147 CG 52 1 Y 1 C ARG 158 ? CD ? A ARG 147 CD 53 1 Y 1 C ARG 158 ? NE ? A ARG 147 NE 54 1 Y 1 C ARG 158 ? CZ ? A ARG 147 CZ 55 1 Y 1 C ARG 158 ? NH1 ? A ARG 147 NH1 56 1 Y 1 C ARG 158 ? NH2 ? A ARG 147 NH2 57 1 Y 1 C GLU 161 ? CG ? A GLU 150 CG 58 1 Y 1 C GLU 161 ? CD ? A GLU 150 CD 59 1 Y 1 C GLU 161 ? OE1 ? A GLU 150 OE1 60 1 Y 1 C GLU 161 ? OE2 ? A GLU 150 OE2 61 1 Y 1 C LYS 190 ? CG ? A LYS 179 CG 62 1 Y 1 C LYS 190 ? CD ? A LYS 179 CD 63 1 Y 1 C LYS 190 ? CE ? A LYS 179 CE 64 1 Y 1 C LYS 190 ? NZ ? A LYS 179 NZ 65 1 Y 1 C ASP 201 ? CG ? A ASP 190 CG 66 1 Y 1 C ASP 201 ? OD1 ? A ASP 190 OD1 67 1 Y 1 C ASP 201 ? OD2 ? A ASP 190 OD2 68 1 Y 1 C GLU 202 ? CG ? A GLU 191 CG 69 1 Y 1 C GLU 202 ? CD ? A GLU 191 CD 70 1 Y 1 C GLU 202 ? OE1 ? A GLU 191 OE1 71 1 Y 1 C GLU 202 ? OE2 ? A GLU 191 OE2 72 1 Y 1 C LYS 246 ? CG ? A LYS 235 CG 73 1 Y 1 C LYS 246 ? CD ? A LYS 235 CD 74 1 Y 1 C LYS 246 ? CE ? A LYS 235 CE 75 1 Y 1 C LYS 246 ? NZ ? A LYS 235 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5TUJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 71.641 _cell.length_a_esd ? _cell.length_b 71.641 _cell.length_b_esd ? _cell.length_c 124.001 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5TUJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5TUJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.49 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 64.71 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2 M Lithium sulfate 0.1 M Tris 22.5 % PEG3350 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-03-11 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9537 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9537 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5TUJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.35 _reflns.d_resolution_low 35.82 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5646 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.5 _reflns.pdbx_Rmerge_I_obs 0.215 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.994 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.35 _reflns_shell.d_res_low 3.62 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.9 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.001 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.744 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5TUJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.352 _refine.ls_d_res_low 27.743 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5601 _refine.ls_number_reflns_R_free 294 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.64 _refine.ls_percent_reflns_R_free 5.25 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.3066 _refine.ls_R_factor_R_free 0.3375 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.3049 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 36.53 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.48 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1738 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1738 _refine_hist.d_res_high 3.352 _refine_hist.d_res_low 27.743 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1776 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.584 ? 2417 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 11.675 ? 624 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.020 ? 277 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 311 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.3516 4.2203 . . 132 2613 100.00 . . . 0.4165 . 0.3543 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.2203 27.7437 . . 162 2694 100.00 . . . 0.3106 . 0.2816 . . . . . . . . . . # _struct.entry_id 5TUJ _struct.title 'Ancestral Cationic Amino Acid Solute Binding Protein (AncCDT-1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5TUJ _struct_keywords.text 'periplasmic solute binding protein, Solute Binding Protein' _struct_keywords.pdbx_keywords 'Solute Binding Protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5TUJ _struct_ref.pdbx_db_accession 5TUJ _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5TUJ _struct_ref_seq.pdbx_strand_id C _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 235 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5TUJ _struct_ref_seq.db_align_beg 12 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 246 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 12 _struct_ref_seq.pdbx_auth_seq_align_end 246 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 11310 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 3 ? GLY A 12 ? SER C 14 GLY C 23 1 ? 10 HELX_P HELX_P2 AA2 GLY A 36 ? GLY A 50 ? GLY C 47 GLY C 61 1 ? 15 HELX_P HELX_P3 AA3 ILE A 63 ? THR A 69 ? ILE C 74 THR C 80 1 ? 7 HELX_P HELX_P4 AA4 THR A 82 ? LYS A 87 ? THR C 93 LYS C 98 1 ? 6 HELX_P HELX_P5 AA5 ASP A 107 ? ALA A 109 ? ASP C 118 ALA C 120 5 ? 3 HELX_P HELX_P6 AA6 SER A 114 ? ASN A 119 ? SER C 125 ASN C 130 5 ? 6 HELX_P HELX_P7 AA7 THR A 131 ? LEU A 141 ? THR C 142 LEU C 152 1 ? 11 HELX_P HELX_P8 AA8 ASN A 151 ? GLY A 162 ? ASN C 162 GLY C 173 1 ? 12 HELX_P HELX_P9 AA9 SER A 171 ? ALA A 178 ? SER C 182 ALA C 189 1 ? 8 HELX_P HELX_P10 AB1 ASP A 206 ? GLY A 224 ? ASP C 217 GLY C 235 1 ? 19 HELX_P HELX_P11 AB2 GLY A 224 ? LYS A 235 ? GLY C 235 LYS C 246 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 23 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 34 _struct_mon_prot_cis.auth_asym_id C _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 24 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 35 _struct_mon_prot_cis.pdbx_auth_asym_id_2 C _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.21 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? AA3 ? 2 ? AA4 ? 2 ? AA5 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? parallel AA5 2 3 ? parallel AA5 3 4 ? anti-parallel AA5 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 52 ? PRO A 57 ? LYS C 63 PRO C 68 AA1 2 THR A 13 ? THR A 18 ? THR C 24 THR C 29 AA1 3 ILE A 74 ? VAL A 75 ? ILE C 85 VAL C 86 AA2 1 ASP A 21 ? TYR A 22 ? ASP C 32 TYR C 33 AA2 2 SER A 26 ? LYS A 28 ? SER C 37 LYS C 39 AA2 3 TYR A 34 ? THR A 35 ? TYR C 45 THR C 46 AA3 1 ASP A 90 ? PHE A 91 ? ASP C 101 PHE C 102 AA3 2 ALA A 201 ? ILE A 202 ? ALA C 212 ILE C 213 AA4 1 MET A 96 ? ALA A 98 ? MET C 107 ALA C 109 AA4 2 GLU A 196 ? LEU A 198 ? GLU C 207 LEU C 209 AA5 1 LYS A 145 ? PHE A 149 ? LYS C 156 PHE C 160 AA5 2 LYS A 124 ? GLN A 128 ? LYS C 135 GLN C 139 AA5 3 ALA A 166 ? ASP A 170 ? ALA C 177 ASP C 181 AA5 4 GLN A 100 ? LYS A 105 ? GLN C 111 LYS C 116 AA5 5 VAL A 186 ? ASP A 190 ? VAL C 197 ASP C 201 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 56 ? O VAL C 67 N VAL A 16 ? N VAL C 27 AA1 2 3 N GLY A 17 ? N GLY C 28 O ILE A 74 ? O ILE C 85 AA2 1 2 N TYR A 22 ? N TYR C 33 O SER A 26 ? O SER C 37 AA2 2 3 N PHE A 27 ? N PHE C 38 O THR A 35 ? O THR C 46 AA3 1 2 N ASP A 90 ? N ASP C 101 O ILE A 202 ? O ILE C 213 AA4 1 2 N ALA A 98 ? N ALA C 109 O GLU A 196 ? O GLU C 207 AA5 1 2 O ARG A 147 ? O ARG C 158 N VAL A 127 ? N VAL C 138 AA5 2 3 N ALA A 126 ? N ALA C 137 O VAL A 168 ? O VAL C 179 AA5 3 4 O THR A 169 ? O THR C 180 N THR A 101 ? N THR C 112 AA5 4 5 N ILE A 102 ? N ILE C 113 O VAL A 189 ? O VAL C 200 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA C 31 ? ? -69.51 45.32 2 1 ASP C 32 ? ? -163.08 58.61 3 1 ASP C 40 ? ? -104.82 -147.30 4 1 SER C 88 ? ? -153.99 48.08 5 1 LYS C 122 ? ? 59.58 18.32 6 1 LYS C 124 ? ? -96.94 -65.85 7 1 SER C 125 ? ? -142.71 -147.36 8 1 ALA C 196 ? ? -145.88 -51.05 9 1 PHE C 204 ? ? -162.40 -72.17 10 1 ASP C 217 ? ? -151.83 75.62 # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -40.1150 21.3844 36.3684 0.6771 0.9770 0.9173 0.0348 -0.0343 0.0166 3.4250 5.3524 4.5488 -2.6021 -0.5268 -2.3364 0.0162 1.2117 0.3401 -0.7525 0.3472 0.4291 0.0777 -1.3437 0.7011 'X-RAY DIFFRACTION' 2 ? refined -33.8962 24.2176 41.0400 0.4995 0.6494 0.8817 -0.0707 0.0652 0.0424 8.0827 3.3691 6.1705 -0.4715 1.1124 -2.9580 -0.5393 0.2479 1.1515 0.0270 0.4499 0.6998 -0.9788 -0.5347 0.1608 'X-RAY DIFFRACTION' 3 ? refined -12.5659 24.9829 21.7071 0.5497 1.1299 0.9425 -0.2023 0.0725 0.1450 6.4268 3.6722 4.2988 2.4360 1.9791 -2.4357 -0.2994 0.6188 0.5369 0.0640 -0.7543 -0.6967 -1.1053 1.2599 -0.2251 'X-RAY DIFFRACTION' 4 ? refined -19.8850 23.6969 18.0082 0.4332 1.0107 0.6986 -0.2661 -0.0089 -0.0471 7.5730 3.3483 3.8341 -3.4495 1.8328 -0.2511 0.8646 -0.2593 0.2693 -0.1881 -0.9884 -0.1174 -0.3449 0.5580 -0.1760 'X-RAY DIFFRACTION' 5 ? refined -27.8730 14.8394 41.7760 0.6892 0.3848 0.8551 -0.0455 0.0456 0.0035 5.5246 5.4465 3.5747 1.6785 -1.0292 -3.8159 -0.1633 0.1578 -0.0030 -0.5073 0.1043 -0.3825 0.1798 -0.5010 -0.1767 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 14 through 47 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 48 through 106 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 107 through 151 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 152 through 201 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 202 through 246 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 C ALA 12 ? A ALA 1 2 1 Y 1 C ALA 13 ? A ALA 2 3 1 Y 1 C LYS 191 ? A LYS 180 4 1 Y 1 C ASN 192 ? A ASN 181 5 1 Y 1 C PRO 193 ? A PRO 182 6 1 Y 1 C GLY 194 ? A GLY 183 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _atom_sites.entry_id 5TUJ _atom_sites.fract_transf_matrix[1][1] 0.013958 _atom_sites.fract_transf_matrix[1][2] 0.008059 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016118 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008064 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_