data_5UJ5 # _entry.id 5UJ5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5UJ5 pdb_00005uj5 10.2210/pdb5uj5/pdb WWPDB D_1000225926 ? ? BMRB 30231 ? 10.13018/BMR30231 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-02-01 2 'Structure model' 1 1 2017-09-27 3 'Structure model' 1 2 2019-12-11 4 'Structure model' 1 3 2020-02-26 5 'Structure model' 1 4 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Author supporting evidence' 4 3 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' entity 2 2 'Structure model' pdbx_audit_support 3 3 'Structure model' pdbx_audit_support 4 3 'Structure model' pdbx_nmr_software 5 4 'Structure model' citation 6 4 'Structure model' citation_author 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_entity.pdbx_number_of_molecules' 2 2 'Structure model' '_pdbx_audit_support.funding_organization' 3 3 'Structure model' '_pdbx_audit_support.funding_organization' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_citation.country' 6 4 'Structure model' '_citation.journal_abbrev' 7 4 'Structure model' '_citation.journal_id_ASTM' 8 4 'Structure model' '_citation.journal_id_CSD' 9 4 'Structure model' '_citation.journal_id_ISSN' 10 4 'Structure model' '_citation.journal_volume' 11 4 'Structure model' '_citation.page_first' 12 4 'Structure model' '_citation.page_last' 13 4 'Structure model' '_citation.pdbx_database_id_DOI' 14 4 'Structure model' '_citation.pdbx_database_id_PubMed' 15 4 'Structure model' '_citation.title' 16 4 'Structure model' '_citation.year' 17 5 'Structure model' '_database_2.pdbx_DOI' 18 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5UJ5 _pdbx_database_status.recvd_initial_deposition_date 2017-01-17 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB ;Solution structure of the oxidized iron-sulfur protein andrenodoxin from Encephalitozoon cuniculi. Seattle Structural Genomics Center for Infectious Disease target EncuA.00705.a ; 30231 unspecified TargetTrack . SSGCID-EncuA.00705.a unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Buchko, G.W.' 1 0000-0002-3639-1061 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Protein Sci.' _citation.journal_id_ASTM PRCIEI _citation.journal_id_CSD 0795 _citation.journal_id_ISSN 1469-896X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 29 _citation.language ? _citation.page_first 809 _citation.page_last 817 _citation.title 'Solution structure for an Encephalitozoon cuniculi adrenodoxin-like protein in the oxidized state.' _citation.year 2020 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/pro.3818 _citation.pdbx_database_id_PubMed 31912584 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shaheen, S.' 1 ? primary 'Barrett, K.F.' 2 ? primary 'Subramanian, S.' 3 ? primary 'Arnold, S.L.M.' 4 ? primary 'Laureanti, J.A.' 5 ? primary 'Myler, P.J.' 6 ? primary 'Van Voorhis, W.C.' 7 ? primary 'Buchko, G.W.' 8 0000-0002-3639-1061 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Adrenodoxin 14377.485 1 ? ? ? 'The first four residues are part of the N-terminal tag used for NTA purification that remain after cleavage with HRV 3C protease.' 2 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER' 175.820 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPGSMDMFSAPDRIPEQIRIFFKTMKQVVPAKAVCGSTVLDVAHKNGVDLEGACEGNLACSTCHVILEEPLYRKLGEPSD KEYDLIDQAFGATGTSRLGCQLRVDKSFENAVFTVPRATKNMAVDGFKPKPH ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGSMDMFSAPDRIPEQIRIFFKTMKQVVPAKAVCGSTVLDVAHKNGVDLEGACEGNLACSTCHVILEEPLYRKLGEPSD KEYDLIDQAFGATGTSRLGCQLRVDKSFENAVFTVPRATKNMAVDGFKPKPH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SSGCID-EncuA.00705.a # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'FE2/S2 (INORGANIC) CLUSTER' _pdbx_entity_nonpoly.comp_id FES # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 SER n 1 5 MET n 1 6 ASP n 1 7 MET n 1 8 PHE n 1 9 SER n 1 10 ALA n 1 11 PRO n 1 12 ASP n 1 13 ARG n 1 14 ILE n 1 15 PRO n 1 16 GLU n 1 17 GLN n 1 18 ILE n 1 19 ARG n 1 20 ILE n 1 21 PHE n 1 22 PHE n 1 23 LYS n 1 24 THR n 1 25 MET n 1 26 LYS n 1 27 GLN n 1 28 VAL n 1 29 VAL n 1 30 PRO n 1 31 ALA n 1 32 LYS n 1 33 ALA n 1 34 VAL n 1 35 CYS n 1 36 GLY n 1 37 SER n 1 38 THR n 1 39 VAL n 1 40 LEU n 1 41 ASP n 1 42 VAL n 1 43 ALA n 1 44 HIS n 1 45 LYS n 1 46 ASN n 1 47 GLY n 1 48 VAL n 1 49 ASP n 1 50 LEU n 1 51 GLU n 1 52 GLY n 1 53 ALA n 1 54 CYS n 1 55 GLU n 1 56 GLY n 1 57 ASN n 1 58 LEU n 1 59 ALA n 1 60 CYS n 1 61 SER n 1 62 THR n 1 63 CYS n 1 64 HIS n 1 65 VAL n 1 66 ILE n 1 67 LEU n 1 68 GLU n 1 69 GLU n 1 70 PRO n 1 71 LEU n 1 72 TYR n 1 73 ARG n 1 74 LYS n 1 75 LEU n 1 76 GLY n 1 77 GLU n 1 78 PRO n 1 79 SER n 1 80 ASP n 1 81 LYS n 1 82 GLU n 1 83 TYR n 1 84 ASP n 1 85 LEU n 1 86 ILE n 1 87 ASP n 1 88 GLN n 1 89 ALA n 1 90 PHE n 1 91 GLY n 1 92 ALA n 1 93 THR n 1 94 GLY n 1 95 THR n 1 96 SER n 1 97 ARG n 1 98 LEU n 1 99 GLY n 1 100 CYS n 1 101 GLN n 1 102 LEU n 1 103 ARG n 1 104 VAL n 1 105 ASP n 1 106 LYS n 1 107 SER n 1 108 PHE n 1 109 GLU n 1 110 ASN n 1 111 ALA n 1 112 VAL n 1 113 PHE n 1 114 THR n 1 115 VAL n 1 116 PRO n 1 117 ARG n 1 118 ALA n 1 119 THR n 1 120 LYS n 1 121 ASN n 1 122 MET n 1 123 ALA n 1 124 VAL n 1 125 ASP n 1 126 GLY n 1 127 PHE n 1 128 LYS n 1 129 PRO n 1 130 LYS n 1 131 PRO n 1 132 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 132 _entity_src_gen.gene_src_common_name 'Microsporidian parasite' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ECU07_0600 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Encephalitozoon cuniculi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6035 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name AVA0421 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FES non-polymer . 'FE2/S2 (INORGANIC) CLUSTER' ? 'Fe2 S2' 175.820 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 CYS 100 100 100 CYS CYS A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 MET 122 122 122 MET MET A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 PRO 131 131 131 PRO PRO A . n A 1 132 HIS 132 132 132 HIS HIS A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id FES _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 200 _pdbx_nonpoly_scheme.auth_seq_num 200 _pdbx_nonpoly_scheme.pdb_mon_id FES _pdbx_nonpoly_scheme.auth_mon_id FES _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5UJ5 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5UJ5 _struct.title ;Solution structure of the oxidized iron-sulfur protein adrenodoxin from Encephalitozoon cuniculi. Seattle Structural Genomics Center for Infectious Disease target EncuA.00705.a ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5UJ5 _struct_keywords.text ;infectious diseases, microsporidosis, SSGCID, iron-sulfur protein, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, ELECTRON TRANSPORT ; _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code M1JK92_ENCCN _struct_ref.pdbx_db_accession M1JK92 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDMFSAPDRIPEQIRIFFKTMKQVVPAKAVCGSTVLDVAHKNGVDLEGACEGNLACSTCHVILEEPLYRKLGEPSDKEYD LIDQAFGATGTSRLGCQLRVDKSFENAVFTVPRATKNMAVDGFKPKPH ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5UJ5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 132 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession M1JK92 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 128 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 132 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5UJ5 GLY A 1 ? UNP M1JK92 ? ? 'expression tag' 1 1 1 5UJ5 PRO A 2 ? UNP M1JK92 ? ? 'expression tag' 2 2 1 5UJ5 GLY A 3 ? UNP M1JK92 ? ? 'expression tag' 3 3 1 5UJ5 SER A 4 ? UNP M1JK92 ? ? 'expression tag' 4 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 38 ? GLY A 47 ? THR A 38 GLY A 47 1 ? 10 HELX_P HELX_P2 AA2 GLU A 68 ? GLY A 76 ? GLU A 68 GLY A 76 1 ? 9 HELX_P HELX_P3 AA3 SER A 79 ? GLN A 88 ? SER A 79 GLN A 88 1 ? 10 HELX_P HELX_P4 AA4 THR A 93 ? ARG A 97 ? THR A 93 ARG A 97 5 ? 5 HELX_P HELX_P5 AA5 ASP A 105 ? GLU A 109 ? ASP A 105 GLU A 109 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 54 SG ? ? ? 1_555 B FES . FE1 ? ? A CYS 54 A FES 200 1_555 ? ? ? ? ? ? ? 2.219 ? ? metalc2 metalc ? ? A CYS 60 SG ? ? ? 1_555 B FES . FE1 ? ? A CYS 60 A FES 200 1_555 ? ? ? ? ? ? ? 2.226 ? ? metalc3 metalc ? ? A CYS 63 SG ? ? ? 1_555 B FES . FE2 ? ? A CYS 63 A FES 200 1_555 ? ? ? ? ? ? ? 2.221 ? ? metalc4 metalc ? ? A CYS 100 SG ? ? ? 1_555 B FES . FE2 ? ? A CYS 100 A FES 200 1_555 ? ? ? ? ? ? ? 2.222 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 54 ? A CYS 54 ? 1_555 FE1 ? B FES . ? A FES 200 ? 1_555 S1 ? B FES . ? A FES 200 ? 1_555 76.2 ? 2 SG ? A CYS 54 ? A CYS 54 ? 1_555 FE1 ? B FES . ? A FES 200 ? 1_555 S2 ? B FES . ? A FES 200 ? 1_555 168.5 ? 3 S1 ? B FES . ? A FES 200 ? 1_555 FE1 ? B FES . ? A FES 200 ? 1_555 S2 ? B FES . ? A FES 200 ? 1_555 103.5 ? 4 SG ? A CYS 54 ? A CYS 54 ? 1_555 FE1 ? B FES . ? A FES 200 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 107.9 ? 5 S1 ? B FES . ? A FES 200 ? 1_555 FE1 ? B FES . ? A FES 200 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 163.0 ? 6 S2 ? B FES . ? A FES 200 ? 1_555 FE1 ? B FES . ? A FES 200 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 75.8 ? 7 SG ? A CYS 63 ? A CYS 63 ? 1_555 FE2 ? B FES . ? A FES 200 ? 1_555 S1 ? B FES . ? A FES 200 ? 1_555 176.0 ? 8 SG ? A CYS 63 ? A CYS 63 ? 1_555 FE2 ? B FES . ? A FES 200 ? 1_555 S2 ? B FES . ? A FES 200 ? 1_555 75.3 ? 9 S1 ? B FES . ? A FES 200 ? 1_555 FE2 ? B FES . ? A FES 200 ? 1_555 S2 ? B FES . ? A FES 200 ? 1_555 101.5 ? 10 SG ? A CYS 63 ? A CYS 63 ? 1_555 FE2 ? B FES . ? A FES 200 ? 1_555 SG ? A CYS 100 ? A CYS 100 ? 1_555 108.0 ? 11 S1 ? B FES . ? A FES 200 ? 1_555 FE2 ? B FES . ? A FES 200 ? 1_555 SG ? A CYS 100 ? A CYS 100 ? 1_555 75.5 ? 12 S2 ? B FES . ? A FES 200 ? 1_555 FE2 ? B FES . ? A FES 200 ? 1_555 SG ? A CYS 100 ? A CYS 100 ? 1_555 172.5 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 28 ? ALA A 33 ? VAL A 28 ALA A 33 AA1 2 ILE A 18 ? THR A 24 ? ILE A 18 THR A 24 AA1 3 VAL A 112 ? VAL A 115 ? VAL A 112 VAL A 115 AA1 4 ILE A 66 ? LEU A 67 ? ILE A 66 LEU A 67 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 29 ? O VAL A 29 N PHE A 22 ? N PHE A 22 AA1 2 3 N LYS A 23 ? N LYS A 23 O VAL A 115 ? O VAL A 115 AA1 3 4 O THR A 114 ? O THR A 114 N ILE A 66 ? N ILE A 66 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id FES _struct_site.pdbx_auth_seq_id 200 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'binding site for residue FES A 200' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 54 ? CYS A 54 . ? 1_555 ? 2 AC1 4 CYS A 60 ? CYS A 60 . ? 1_555 ? 3 AC1 4 CYS A 63 ? CYS A 63 . ? 1_555 ? 4 AC1 4 CYS A 100 ? CYS A 100 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 4 ? ? -100.45 -62.45 2 1 ALA A 10 ? ? -119.30 68.27 3 1 ARG A 13 ? ? -67.79 93.06 4 1 PRO A 15 ? ? -69.74 -169.84 5 1 GLN A 27 ? ? 179.71 176.27 6 1 SER A 61 ? ? -95.15 -67.70 7 1 CYS A 100 ? ? -140.44 53.02 8 1 GLN A 101 ? ? -179.07 98.14 9 2 SER A 9 ? ? -52.16 103.37 10 2 ALA A 10 ? ? -152.13 73.90 11 2 PRO A 15 ? ? -69.72 -170.58 12 2 GLN A 27 ? ? 179.21 176.25 13 2 ALA A 53 ? ? -51.89 103.11 14 2 ASN A 57 ? ? -90.80 -73.25 15 2 THR A 62 ? ? -56.83 100.13 16 2 PRO A 78 ? ? -69.78 -175.30 17 2 GLN A 101 ? ? -170.05 -179.53 18 2 LEU A 102 ? ? -139.50 -61.22 19 2 ALA A 118 ? ? -58.61 -176.34 20 2 ASP A 125 ? ? -175.25 149.54 21 2 LYS A 128 ? ? 57.35 73.63 22 2 LYS A 130 ? ? -172.09 69.19 23 2 PRO A 131 ? ? -69.76 -173.16 24 3 PRO A 2 ? ? -69.70 -174.73 25 3 SER A 9 ? ? -175.83 147.33 26 3 PRO A 11 ? ? -69.76 79.96 27 3 GLN A 27 ? ? 179.86 176.22 28 3 SER A 61 ? ? -63.49 -170.77 29 3 THR A 62 ? ? -57.61 99.17 30 3 HIS A 64 ? ? -164.53 109.43 31 3 SER A 79 ? ? -58.09 171.34 32 3 LEU A 98 ? ? -179.06 -178.92 33 3 CYS A 100 ? ? -144.78 -42.54 34 3 LYS A 120 ? ? -54.05 173.13 35 3 ALA A 123 ? ? -176.81 139.76 36 3 ASP A 125 ? ? -172.95 130.55 37 3 PRO A 129 ? ? -69.86 94.18 38 4 MET A 5 ? ? -120.85 -64.59 39 4 ASP A 6 ? ? -171.38 -179.93 40 4 ALA A 10 ? ? -178.32 74.58 41 4 PRO A 11 ? ? -69.87 78.05 42 4 ILE A 14 ? ? 64.72 148.58 43 4 PRO A 15 ? ? -69.76 -170.27 44 4 GLN A 27 ? ? 179.39 176.43 45 4 SER A 37 ? ? -77.83 -169.91 46 4 CYS A 63 ? ? -96.21 30.84 47 4 HIS A 64 ? ? -62.43 94.59 48 4 PRO A 78 ? ? -69.80 -177.98 49 4 ALA A 118 ? ? -174.68 -177.97 50 4 ALA A 123 ? ? -58.65 176.63 51 4 ASP A 125 ? ? -175.37 -179.16 52 4 PHE A 127 ? ? -173.33 143.26 53 4 PRO A 129 ? ? -69.77 -170.97 54 4 LYS A 130 ? ? 63.42 68.39 55 4 PRO A 131 ? ? -69.79 -170.95 56 5 PRO A 15 ? ? -69.72 -170.74 57 5 GLN A 27 ? ? 179.36 176.33 58 5 SER A 79 ? ? -102.49 -169.84 59 5 ASN A 121 ? ? -54.49 172.30 60 6 PRO A 11 ? ? -69.79 -171.04 61 6 PRO A 15 ? ? -69.77 -174.40 62 6 GLN A 27 ? ? 179.82 175.92 63 6 SER A 37 ? ? -100.95 -169.97 64 6 CYS A 54 ? ? -95.93 30.61 65 6 ALA A 59 ? ? -103.67 57.10 66 6 SER A 79 ? ? -58.19 170.54 67 6 CYS A 100 ? ? -133.96 -74.85 68 6 GLN A 101 ? ? -63.27 93.56 69 6 LYS A 128 ? ? 54.68 73.00 70 7 PRO A 2 ? ? -69.80 -170.95 71 7 SER A 9 ? ? -179.24 -179.17 72 7 ALA A 10 ? ? 63.43 73.98 73 7 PRO A 11 ? ? -69.72 -171.43 74 7 THR A 24 ? ? -114.40 -157.22 75 7 LYS A 26 ? ? -138.09 -33.81 76 7 ASN A 57 ? ? -101.51 -61.41 77 7 CYS A 60 ? ? -103.84 66.37 78 7 PRO A 78 ? ? -69.75 -170.67 79 7 PRO A 116 ? ? -69.75 -165.63 80 7 MET A 122 ? ? 61.58 61.83 81 8 ALA A 10 ? ? -162.30 73.07 82 8 PRO A 11 ? ? -69.82 -173.46 83 8 PRO A 15 ? ? -69.68 -169.64 84 8 GLN A 27 ? ? 179.79 176.18 85 8 ALA A 53 ? ? -62.68 94.00 86 8 CYS A 54 ? ? -94.29 41.25 87 8 SER A 61 ? ? -131.38 -66.83 88 8 HIS A 64 ? ? -69.36 90.60 89 8 LEU A 98 ? ? -134.36 -61.25 90 8 ALA A 118 ? ? -176.94 -179.46 91 8 ASN A 121 ? ? -108.05 54.07 92 8 MET A 122 ? ? 39.62 41.56 93 8 ALA A 123 ? ? -114.64 79.84 94 8 ASP A 125 ? ? -172.50 115.14 95 8 PHE A 127 ? ? -160.14 117.52 96 8 LYS A 130 ? ? -113.58 73.74 97 8 PRO A 131 ? ? -69.77 -172.71 98 9 PRO A 2 ? ? -69.67 -179.29 99 9 SER A 9 ? ? -170.56 -179.56 100 9 PRO A 11 ? ? -69.77 -171.24 101 9 PRO A 15 ? ? -69.78 -170.34 102 9 GLN A 27 ? ? 179.45 176.25 103 9 CYS A 35 ? ? -52.93 109.93 104 9 VAL A 48 ? ? -52.66 105.56 105 9 CYS A 54 ? ? -94.38 56.40 106 9 GLU A 55 ? ? -175.45 142.47 107 9 ASN A 57 ? ? -60.41 -179.47 108 9 CYS A 60 ? ? -64.70 96.63 109 9 PRO A 78 ? ? -69.81 -172.07 110 9 LEU A 98 ? ? -176.60 125.62 111 9 CYS A 100 ? ? -89.07 49.46 112 9 PRO A 116 ? ? -69.82 -165.45 113 9 ALA A 118 ? ? -91.56 -75.41 114 9 LYS A 120 ? ? -62.99 -171.83 115 9 LYS A 128 ? ? -174.15 71.56 116 9 LYS A 130 ? ? -175.66 73.60 117 10 MET A 7 ? ? -55.34 171.63 118 10 PRO A 15 ? ? -69.74 -171.44 119 10 GLN A 27 ? ? 179.26 176.22 120 10 ASN A 57 ? ? -61.82 -176.13 121 10 SER A 61 ? ? -104.27 53.96 122 10 LEU A 98 ? ? -135.07 -64.25 123 10 ALA A 123 ? ? -178.12 114.46 124 10 LYS A 130 ? ? -173.93 70.68 125 11 SER A 9 ? ? -100.28 -65.56 126 11 ALA A 10 ? ? 59.31 73.78 127 11 PRO A 15 ? ? -69.69 -170.57 128 11 GLN A 27 ? ? 178.81 176.31 129 11 CYS A 35 ? ? -53.51 109.50 130 11 PRO A 78 ? ? -69.73 -174.92 131 11 LEU A 98 ? ? -130.17 -69.58 132 11 MET A 122 ? ? -59.47 -178.56 133 11 PRO A 129 ? ? -69.83 -170.95 134 12 PRO A 2 ? ? -69.83 -174.71 135 12 PRO A 15 ? ? -69.77 -170.32 136 12 GLN A 27 ? ? 178.67 176.49 137 12 HIS A 64 ? ? -161.95 112.09 138 12 PRO A 78 ? ? -69.75 -178.10 139 12 GLN A 101 ? ? -111.21 59.62 140 12 LYS A 120 ? ? -173.96 139.16 141 12 LYS A 128 ? ? -115.40 73.76 142 12 PRO A 129 ? ? -69.76 82.93 143 13 PRO A 15 ? ? -69.71 -168.09 144 13 GLN A 27 ? ? 179.13 176.49 145 13 CYS A 35 ? ? -55.55 99.94 146 13 LEU A 58 ? ? -125.16 -71.17 147 13 LEU A 98 ? ? 63.65 65.88 148 13 PRO A 131 ? ? -69.78 -172.09 149 14 PRO A 2 ? ? -69.78 -171.01 150 14 SER A 4 ? ? -102.55 66.15 151 14 MET A 5 ? ? -66.85 -175.36 152 14 PRO A 15 ? ? -69.78 -170.63 153 14 GLN A 27 ? ? 176.31 176.45 154 14 PRO A 78 ? ? -69.79 -172.94 155 14 LEU A 98 ? ? 62.06 97.64 156 14 CYS A 100 ? ? -97.24 -69.91 157 14 ASP A 125 ? ? -55.15 172.97 158 14 LYS A 128 ? ? 37.55 67.89 159 15 PRO A 2 ? ? -69.78 -175.95 160 15 ALA A 10 ? ? 63.94 73.76 161 15 PRO A 11 ? ? -69.74 81.90 162 15 ARG A 13 ? ? -124.15 -166.93 163 15 PRO A 15 ? ? -69.77 -169.97 164 15 CYS A 35 ? ? -56.21 109.80 165 15 PRO A 78 ? ? -69.69 -178.62 166 15 CYS A 100 ? ? 61.50 167.85 167 15 LYS A 130 ? ? 55.48 73.47 168 16 ARG A 13 ? ? -105.40 42.73 169 16 PRO A 15 ? ? -69.74 -171.44 170 16 THR A 24 ? ? -114.36 -167.45 171 16 LYS A 26 ? ? -141.03 27.68 172 16 ALA A 53 ? ? -94.78 -75.43 173 16 GLU A 55 ? ? -100.37 -66.96 174 16 HIS A 64 ? ? -177.00 114.78 175 16 LEU A 98 ? ? 64.90 110.60 176 16 GLN A 101 ? ? 63.09 61.51 177 16 LEU A 102 ? ? -65.87 89.75 178 17 PRO A 11 ? ? -69.73 80.75 179 17 PRO A 15 ? ? -69.81 -169.99 180 17 GLN A 27 ? ? 178.44 176.40 181 17 SER A 61 ? ? -65.86 -172.91 182 17 GLU A 68 ? ? -39.12 137.32 183 17 LEU A 102 ? ? -177.13 129.97 184 17 LYS A 120 ? ? -57.58 175.27 185 17 ALA A 123 ? ? -52.20 103.42 186 17 VAL A 124 ? ? -65.99 -176.92 187 17 PRO A 129 ? ? -69.76 92.24 188 18 ALA A 10 ? ? -159.05 71.57 189 18 PRO A 15 ? ? -69.79 -170.05 190 18 SER A 37 ? ? -101.63 -169.78 191 18 CYS A 63 ? ? -131.15 -46.60 192 18 CYS A 100 ? ? -104.16 64.49 193 18 ASP A 125 ? ? -117.58 61.64 194 18 LYS A 130 ? ? 37.51 67.86 195 18 PRO A 131 ? ? -69.76 -171.71 196 19 PRO A 2 ? ? -69.79 79.58 197 19 ALA A 10 ? ? -167.78 69.93 198 19 PRO A 11 ? ? -69.74 -171.12 199 19 ILE A 14 ? ? 63.50 136.80 200 19 PRO A 15 ? ? -69.81 -178.78 201 19 GLN A 27 ? ? 178.28 176.53 202 19 SER A 61 ? ? -96.01 34.43 203 19 GLU A 68 ? ? -39.62 139.55 204 19 SER A 79 ? ? -58.17 171.56 205 19 CYS A 100 ? ? -122.62 -54.50 206 19 LEU A 102 ? ? -176.64 140.54 207 19 ASN A 121 ? ? -60.29 -173.00 208 19 VAL A 124 ? ? -172.10 134.47 209 19 PHE A 127 ? ? -53.94 105.00 210 19 LYS A 128 ? ? -115.21 72.97 211 19 PRO A 129 ? ? -69.84 -177.09 212 19 LYS A 130 ? ? -119.52 71.28 213 19 PRO A 131 ? ? -69.74 -170.74 214 20 MET A 5 ? ? -175.07 134.00 215 20 PRO A 11 ? ? -69.80 -170.76 216 20 PRO A 15 ? ? -69.73 -170.34 217 20 GLN A 27 ? ? 178.34 176.32 218 20 ASN A 57 ? ? -97.79 31.76 219 20 ALA A 59 ? ? -172.98 128.41 220 20 GLU A 68 ? ? -36.80 135.87 221 20 SER A 79 ? ? -57.95 171.38 222 20 LEU A 98 ? ? -170.23 142.38 223 20 PRO A 116 ? ? -69.80 -165.58 224 20 ASN A 121 ? ? -61.17 -170.50 225 20 MET A 122 ? ? -59.87 -174.58 226 20 ASP A 125 ? ? -55.45 171.00 227 20 PHE A 127 ? ? -163.36 103.22 228 20 LYS A 128 ? ? -174.75 73.63 229 20 LYS A 130 ? ? -167.94 73.08 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.initial_of_center SSGCID # _pdbx_nmr_ensemble.entry_id 5UJ5 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 5UJ5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '100 mM sodium chloride, 20 mM TRIS, 1 mM DTT, 1 mM [U-99% 13C; U-99% 15N] E5, 93% H2O/7% D2O' _pdbx_nmr_sample_details.solvent_system '93% H2O/7% D2O' _pdbx_nmr_sample_details.label sample_1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details 'A sample that was only 15N labelled was prepared and used for the deuterium exchange experiment.' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'sodium chloride' 100 ? mM 'natural abundance' 1 TRIS 20 ? mM 'natural abundance' 1 DTT 1 ? mM 'natural abundance' 1 E5 1 ? mM '[U-99% 13C; U-99% 15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.12 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units M _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.1 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err 0.5 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-13C NOESY aliphatic' 3 anisotropic 2 1 1 '3D 1H-13C NOESY aromatic' 3 anisotropic 3 1 1 '3D HNCACB' 3 anisotropic 4 1 1 '3D 1H-15N NOESY' 3 anisotropic 5 1 1 '3D CBCA(CO)NH' 3 anisotropic 7 1 1 '3D HNCO' 3 anisotropic 6 1 1 '2D 1H-15N HSQC' 3 anisotropic 8 1 1 '2D 1H-13C HSQC aliphatic' 3 anisotropic 9 1 1 '2D 1H-13C HSQC aromatic' 3 anisotropic 10 1 1 'deuterium exchange' 1 anisotropic 11 1 1 '3D C(CO)NH' 3 anisotropic 12 1 1 '3D H(CCO)NH' 1 anisotropic 13 1 1 '2D HBCBCGCDHD' 3 anisotropic # _pdbx_nmr_refine.entry_id 5UJ5 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;Due to the paramagnetic effects of the iron in the [2Fe-2S] cluster, amides in the close neighbourhood were not observable. These included C54, C60, C63, and C100. Restraints to fix the ligand and the sulfur atoms of these cysteine residues were added based on XRD structures and are contained in ssbond.upl and ssbond.lol. ; _pdbx_nmr_refine.software_ordinal 3 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing Felix 2007 'Accelrys Software Inc.' 2 'data analysis' Sparky 3.115 Goddard 3 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 4 'peak picking' Sparky 3.115 Goddard 5 'data analysis' PSVS 1.5 'Bhattacharya and Montelione' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FES FE1 FE N N 88 FES FE2 FE N N 89 FES S1 S N N 90 FES S2 S N N 91 GLN N N N N 92 GLN CA C N S 93 GLN C C N N 94 GLN O O N N 95 GLN CB C N N 96 GLN CG C N N 97 GLN CD C N N 98 GLN OE1 O N N 99 GLN NE2 N N N 100 GLN OXT O N N 101 GLN H H N N 102 GLN H2 H N N 103 GLN HA H N N 104 GLN HB2 H N N 105 GLN HB3 H N N 106 GLN HG2 H N N 107 GLN HG3 H N N 108 GLN HE21 H N N 109 GLN HE22 H N N 110 GLN HXT H N N 111 GLU N N N N 112 GLU CA C N S 113 GLU C C N N 114 GLU O O N N 115 GLU CB C N N 116 GLU CG C N N 117 GLU CD C N N 118 GLU OE1 O N N 119 GLU OE2 O N N 120 GLU OXT O N N 121 GLU H H N N 122 GLU H2 H N N 123 GLU HA H N N 124 GLU HB2 H N N 125 GLU HB3 H N N 126 GLU HG2 H N N 127 GLU HG3 H N N 128 GLU HE2 H N N 129 GLU HXT H N N 130 GLY N N N N 131 GLY CA C N N 132 GLY C C N N 133 GLY O O N N 134 GLY OXT O N N 135 GLY H H N N 136 GLY H2 H N N 137 GLY HA2 H N N 138 GLY HA3 H N N 139 GLY HXT H N N 140 HIS N N N N 141 HIS CA C N S 142 HIS C C N N 143 HIS O O N N 144 HIS CB C N N 145 HIS CG C Y N 146 HIS ND1 N Y N 147 HIS CD2 C Y N 148 HIS CE1 C Y N 149 HIS NE2 N Y N 150 HIS OXT O N N 151 HIS H H N N 152 HIS H2 H N N 153 HIS HA H N N 154 HIS HB2 H N N 155 HIS HB3 H N N 156 HIS HD1 H N N 157 HIS HD2 H N N 158 HIS HE1 H N N 159 HIS HE2 H N N 160 HIS HXT H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TYR N N N N 322 TYR CA C N S 323 TYR C C N N 324 TYR O O N N 325 TYR CB C N N 326 TYR CG C Y N 327 TYR CD1 C Y N 328 TYR CD2 C Y N 329 TYR CE1 C Y N 330 TYR CE2 C Y N 331 TYR CZ C Y N 332 TYR OH O N N 333 TYR OXT O N N 334 TYR H H N N 335 TYR H2 H N N 336 TYR HA H N N 337 TYR HB2 H N N 338 TYR HB3 H N N 339 TYR HD1 H N N 340 TYR HD2 H N N 341 TYR HE1 H N N 342 TYR HE2 H N N 343 TYR HH H N N 344 TYR HXT H N N 345 VAL N N N N 346 VAL CA C N S 347 VAL C C N N 348 VAL O O N N 349 VAL CB C N N 350 VAL CG1 C N N 351 VAL CG2 C N N 352 VAL OXT O N N 353 VAL H H N N 354 VAL H2 H N N 355 VAL HA H N N 356 VAL HB H N N 357 VAL HG11 H N N 358 VAL HG12 H N N 359 VAL HG13 H N N 360 VAL HG21 H N N 361 VAL HG22 H N N 362 VAL HG23 H N N 363 VAL HXT H N N 364 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FES FE1 S1 sing N N 83 FES FE1 S2 sing N N 84 FES FE2 S1 sing N N 85 FES FE2 S2 sing N N 86 GLN N CA sing N N 87 GLN N H sing N N 88 GLN N H2 sing N N 89 GLN CA C sing N N 90 GLN CA CB sing N N 91 GLN CA HA sing N N 92 GLN C O doub N N 93 GLN C OXT sing N N 94 GLN CB CG sing N N 95 GLN CB HB2 sing N N 96 GLN CB HB3 sing N N 97 GLN CG CD sing N N 98 GLN CG HG2 sing N N 99 GLN CG HG3 sing N N 100 GLN CD OE1 doub N N 101 GLN CD NE2 sing N N 102 GLN NE2 HE21 sing N N 103 GLN NE2 HE22 sing N N 104 GLN OXT HXT sing N N 105 GLU N CA sing N N 106 GLU N H sing N N 107 GLU N H2 sing N N 108 GLU CA C sing N N 109 GLU CA CB sing N N 110 GLU CA HA sing N N 111 GLU C O doub N N 112 GLU C OXT sing N N 113 GLU CB CG sing N N 114 GLU CB HB2 sing N N 115 GLU CB HB3 sing N N 116 GLU CG CD sing N N 117 GLU CG HG2 sing N N 118 GLU CG HG3 sing N N 119 GLU CD OE1 doub N N 120 GLU CD OE2 sing N N 121 GLU OE2 HE2 sing N N 122 GLU OXT HXT sing N N 123 GLY N CA sing N N 124 GLY N H sing N N 125 GLY N H2 sing N N 126 GLY CA C sing N N 127 GLY CA HA2 sing N N 128 GLY CA HA3 sing N N 129 GLY C O doub N N 130 GLY C OXT sing N N 131 GLY OXT HXT sing N N 132 HIS N CA sing N N 133 HIS N H sing N N 134 HIS N H2 sing N N 135 HIS CA C sing N N 136 HIS CA CB sing N N 137 HIS CA HA sing N N 138 HIS C O doub N N 139 HIS C OXT sing N N 140 HIS CB CG sing N N 141 HIS CB HB2 sing N N 142 HIS CB HB3 sing N N 143 HIS CG ND1 sing Y N 144 HIS CG CD2 doub Y N 145 HIS ND1 CE1 doub Y N 146 HIS ND1 HD1 sing N N 147 HIS CD2 NE2 sing Y N 148 HIS CD2 HD2 sing N N 149 HIS CE1 NE2 sing Y N 150 HIS CE1 HE1 sing N N 151 HIS NE2 HE2 sing N N 152 HIS OXT HXT sing N N 153 ILE N CA sing N N 154 ILE N H sing N N 155 ILE N H2 sing N N 156 ILE CA C sing N N 157 ILE CA CB sing N N 158 ILE CA HA sing N N 159 ILE C O doub N N 160 ILE C OXT sing N N 161 ILE CB CG1 sing N N 162 ILE CB CG2 sing N N 163 ILE CB HB sing N N 164 ILE CG1 CD1 sing N N 165 ILE CG1 HG12 sing N N 166 ILE CG1 HG13 sing N N 167 ILE CG2 HG21 sing N N 168 ILE CG2 HG22 sing N N 169 ILE CG2 HG23 sing N N 170 ILE CD1 HD11 sing N N 171 ILE CD1 HD12 sing N N 172 ILE CD1 HD13 sing N N 173 ILE OXT HXT sing N N 174 LEU N CA sing N N 175 LEU N H sing N N 176 LEU N H2 sing N N 177 LEU CA C sing N N 178 LEU CA CB sing N N 179 LEU CA HA sing N N 180 LEU C O doub N N 181 LEU C OXT sing N N 182 LEU CB CG sing N N 183 LEU CB HB2 sing N N 184 LEU CB HB3 sing N N 185 LEU CG CD1 sing N N 186 LEU CG CD2 sing N N 187 LEU CG HG sing N N 188 LEU CD1 HD11 sing N N 189 LEU CD1 HD12 sing N N 190 LEU CD1 HD13 sing N N 191 LEU CD2 HD21 sing N N 192 LEU CD2 HD22 sing N N 193 LEU CD2 HD23 sing N N 194 LEU OXT HXT sing N N 195 LYS N CA sing N N 196 LYS N H sing N N 197 LYS N H2 sing N N 198 LYS CA C sing N N 199 LYS CA CB sing N N 200 LYS CA HA sing N N 201 LYS C O doub N N 202 LYS C OXT sing N N 203 LYS CB CG sing N N 204 LYS CB HB2 sing N N 205 LYS CB HB3 sing N N 206 LYS CG CD sing N N 207 LYS CG HG2 sing N N 208 LYS CG HG3 sing N N 209 LYS CD CE sing N N 210 LYS CD HD2 sing N N 211 LYS CD HD3 sing N N 212 LYS CE NZ sing N N 213 LYS CE HE2 sing N N 214 LYS CE HE3 sing N N 215 LYS NZ HZ1 sing N N 216 LYS NZ HZ2 sing N N 217 LYS NZ HZ3 sing N N 218 LYS OXT HXT sing N N 219 MET N CA sing N N 220 MET N H sing N N 221 MET N H2 sing N N 222 MET CA C sing N N 223 MET CA CB sing N N 224 MET CA HA sing N N 225 MET C O doub N N 226 MET C OXT sing N N 227 MET CB CG sing N N 228 MET CB HB2 sing N N 229 MET CB HB3 sing N N 230 MET CG SD sing N N 231 MET CG HG2 sing N N 232 MET CG HG3 sing N N 233 MET SD CE sing N N 234 MET CE HE1 sing N N 235 MET CE HE2 sing N N 236 MET CE HE3 sing N N 237 MET OXT HXT sing N N 238 PHE N CA sing N N 239 PHE N H sing N N 240 PHE N H2 sing N N 241 PHE CA C sing N N 242 PHE CA CB sing N N 243 PHE CA HA sing N N 244 PHE C O doub N N 245 PHE C OXT sing N N 246 PHE CB CG sing N N 247 PHE CB HB2 sing N N 248 PHE CB HB3 sing N N 249 PHE CG CD1 doub Y N 250 PHE CG CD2 sing Y N 251 PHE CD1 CE1 sing Y N 252 PHE CD1 HD1 sing N N 253 PHE CD2 CE2 doub Y N 254 PHE CD2 HD2 sing N N 255 PHE CE1 CZ doub Y N 256 PHE CE1 HE1 sing N N 257 PHE CE2 CZ sing Y N 258 PHE CE2 HE2 sing N N 259 PHE CZ HZ sing N N 260 PHE OXT HXT sing N N 261 PRO N CA sing N N 262 PRO N CD sing N N 263 PRO N H sing N N 264 PRO CA C sing N N 265 PRO CA CB sing N N 266 PRO CA HA sing N N 267 PRO C O doub N N 268 PRO C OXT sing N N 269 PRO CB CG sing N N 270 PRO CB HB2 sing N N 271 PRO CB HB3 sing N N 272 PRO CG CD sing N N 273 PRO CG HG2 sing N N 274 PRO CG HG3 sing N N 275 PRO CD HD2 sing N N 276 PRO CD HD3 sing N N 277 PRO OXT HXT sing N N 278 SER N CA sing N N 279 SER N H sing N N 280 SER N H2 sing N N 281 SER CA C sing N N 282 SER CA CB sing N N 283 SER CA HA sing N N 284 SER C O doub N N 285 SER C OXT sing N N 286 SER CB OG sing N N 287 SER CB HB2 sing N N 288 SER CB HB3 sing N N 289 SER OG HG sing N N 290 SER OXT HXT sing N N 291 THR N CA sing N N 292 THR N H sing N N 293 THR N H2 sing N N 294 THR CA C sing N N 295 THR CA CB sing N N 296 THR CA HA sing N N 297 THR C O doub N N 298 THR C OXT sing N N 299 THR CB OG1 sing N N 300 THR CB CG2 sing N N 301 THR CB HB sing N N 302 THR OG1 HG1 sing N N 303 THR CG2 HG21 sing N N 304 THR CG2 HG22 sing N N 305 THR CG2 HG23 sing N N 306 THR OXT HXT sing N N 307 TYR N CA sing N N 308 TYR N H sing N N 309 TYR N H2 sing N N 310 TYR CA C sing N N 311 TYR CA CB sing N N 312 TYR CA HA sing N N 313 TYR C O doub N N 314 TYR C OXT sing N N 315 TYR CB CG sing N N 316 TYR CB HB2 sing N N 317 TYR CB HB3 sing N N 318 TYR CG CD1 doub Y N 319 TYR CG CD2 sing Y N 320 TYR CD1 CE1 sing Y N 321 TYR CD1 HD1 sing N N 322 TYR CD2 CE2 doub Y N 323 TYR CD2 HD2 sing N N 324 TYR CE1 CZ doub Y N 325 TYR CE1 HE1 sing N N 326 TYR CE2 CZ sing Y N 327 TYR CE2 HE2 sing N N 328 TYR CZ OH sing N N 329 TYR OH HH sing N N 330 TYR OXT HXT sing N N 331 VAL N CA sing N N 332 VAL N H sing N N 333 VAL N H2 sing N N 334 VAL CA C sing N N 335 VAL CA CB sing N N 336 VAL CA HA sing N N 337 VAL C O doub N N 338 VAL C OXT sing N N 339 VAL CB CG1 sing N N 340 VAL CB CG2 sing N N 341 VAL CB HB sing N N 342 VAL CG1 HG11 sing N N 343 VAL CG1 HG12 sing N N 344 VAL CG1 HG13 sing N N 345 VAL CG2 HG21 sing N N 346 VAL CG2 HG22 sing N N 347 VAL CG2 HG23 sing N N 348 VAL OXT HXT sing N N 349 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number HHSN2722001200025C _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 INOVA ? Varian 600 ? 3 VXRS ? Varian 750 ? # _atom_sites.entry_id 5UJ5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O S # loop_