data_5UM4 # _entry.id 5UM4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5UM4 pdb_00005um4 10.2210/pdb5um4/pdb WWPDB D_1000226110 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5UM4 _pdbx_database_status.recvd_initial_deposition_date 2017-01-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Meinke, G.' 1 ? 'Bohm, A.' 2 ? 'Noujaim, S.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of the F255A mutant Kir3.1 cytoplasmic pore domain' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Meinke, G.' 1 ? primary 'Bohm, A.' 2 ? primary 'Noujaim, S.' 3 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5UM4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 80.070 _cell.length_a_esd ? _cell.length_b 80.070 _cell.length_b_esd ? _cell.length_c 85.040 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5UM4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 90 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 4 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'G protein-activated inward rectifier potassium channel 1' 24046.418 1 ? F255A 'unp residues 41-63; unp residues 190-370' ? 2 water nat water 18.015 27 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'GIRK-1,Inward rectifier K(+) channel Kir3.1,Potassium channel,inwardly rectifying subfamily J member 3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GPDDHMKKRQRFVDKNGR(CME)NVQHGNLGSERAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSR QTPEGEFLPLDQLELDVGASTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILEGIVETTGMT(CME)QA RTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEMLLMSSP ; _entity_poly.pdbx_seq_one_letter_code_can ;GPDDHMKKRQRFVDKNGRCNVQHGNLGSERAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE GEFLPLDQLELDVGASTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILEGIVETTGMTCQARTSYTEDE VLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEMLLMSSP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 ASP n 1 4 ASP n 1 5 HIS n 1 6 MET n 1 7 LYS n 1 8 LYS n 1 9 ARG n 1 10 GLN n 1 11 ARG n 1 12 PHE n 1 13 VAL n 1 14 ASP n 1 15 LYS n 1 16 ASN n 1 17 GLY n 1 18 ARG n 1 19 CME n 1 20 ASN n 1 21 VAL n 1 22 GLN n 1 23 HIS n 1 24 GLY n 1 25 ASN n 1 26 LEU n 1 27 GLY n 1 28 SER n 1 29 GLU n 1 30 ARG n 1 31 ALA n 1 32 GLU n 1 33 THR n 1 34 LEU n 1 35 MET n 1 36 PHE n 1 37 SER n 1 38 GLU n 1 39 HIS n 1 40 ALA n 1 41 VAL n 1 42 ILE n 1 43 SER n 1 44 MET n 1 45 ARG n 1 46 ASP n 1 47 GLY n 1 48 LYS n 1 49 LEU n 1 50 THR n 1 51 LEU n 1 52 MET n 1 53 PHE n 1 54 ARG n 1 55 VAL n 1 56 GLY n 1 57 ASN n 1 58 LEU n 1 59 ARG n 1 60 ASN n 1 61 SER n 1 62 HIS n 1 63 MET n 1 64 VAL n 1 65 SER n 1 66 ALA n 1 67 GLN n 1 68 ILE n 1 69 ARG n 1 70 CYS n 1 71 LYS n 1 72 LEU n 1 73 LEU n 1 74 LYS n 1 75 SER n 1 76 ARG n 1 77 GLN n 1 78 THR n 1 79 PRO n 1 80 GLU n 1 81 GLY n 1 82 GLU n 1 83 PHE n 1 84 LEU n 1 85 PRO n 1 86 LEU n 1 87 ASP n 1 88 GLN n 1 89 LEU n 1 90 GLU n 1 91 LEU n 1 92 ASP n 1 93 VAL n 1 94 GLY n 1 95 ALA n 1 96 SER n 1 97 THR n 1 98 GLY n 1 99 ALA n 1 100 ASP n 1 101 GLN n 1 102 LEU n 1 103 PHE n 1 104 LEU n 1 105 VAL n 1 106 SER n 1 107 PRO n 1 108 LEU n 1 109 THR n 1 110 ILE n 1 111 CYS n 1 112 HIS n 1 113 VAL n 1 114 ILE n 1 115 ASP n 1 116 ALA n 1 117 LYS n 1 118 SER n 1 119 PRO n 1 120 PHE n 1 121 TYR n 1 122 ASP n 1 123 LEU n 1 124 SER n 1 125 GLN n 1 126 ARG n 1 127 SER n 1 128 MET n 1 129 GLN n 1 130 THR n 1 131 GLU n 1 132 GLN n 1 133 PHE n 1 134 GLU n 1 135 VAL n 1 136 VAL n 1 137 VAL n 1 138 ILE n 1 139 LEU n 1 140 GLU n 1 141 GLY n 1 142 ILE n 1 143 VAL n 1 144 GLU n 1 145 THR n 1 146 THR n 1 147 GLY n 1 148 MET n 1 149 THR n 1 150 CME n 1 151 GLN n 1 152 ALA n 1 153 ARG n 1 154 THR n 1 155 SER n 1 156 TYR n 1 157 THR n 1 158 GLU n 1 159 ASP n 1 160 GLU n 1 161 VAL n 1 162 LEU n 1 163 TRP n 1 164 GLY n 1 165 HIS n 1 166 ARG n 1 167 PHE n 1 168 PHE n 1 169 PRO n 1 170 VAL n 1 171 ILE n 1 172 SER n 1 173 LEU n 1 174 GLU n 1 175 GLU n 1 176 GLY n 1 177 PHE n 1 178 PHE n 1 179 LYS n 1 180 VAL n 1 181 ASP n 1 182 TYR n 1 183 SER n 1 184 GLN n 1 185 PHE n 1 186 HIS n 1 187 ALA n 1 188 THR n 1 189 PHE n 1 190 GLU n 1 191 VAL n 1 192 PRO n 1 193 THR n 1 194 PRO n 1 195 PRO n 1 196 TYR n 1 197 SER n 1 198 VAL n 1 199 LYS n 1 200 GLU n 1 201 GLN n 1 202 GLU n 1 203 GLU n 1 204 MET n 1 205 LEU n 1 206 LEU n 1 207 MET n 1 208 SER n 1 209 SER n 1 210 PRO n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 29 'Green anole' ? LOC100559481 ? ? ? ? ? ? 'Anolis carolinensis' 28377 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 30 210 Mouse ? 'Kcnj3, Girk1' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP H9GIV0_ANOCA H9GIV0 ? 1 KKRQRFVDKNGRCNVQHGNLGSE 34 2 UNP KCNJ3_MOUSE P63250 ? 1 ;RAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLELDVGFSTGADQLFLVSPLT ICHVIDAKSPFYDLSQRSMQTEQFEVVVILEGIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATF EVPTPPYSVKEQEEMLLMSSP ; 190 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5UM4 A 7 ? 29 ? H9GIV0 34 ? 56 ? 41 63 2 2 5UM4 A 30 ? 210 ? P63250 190 ? 370 ? 190 370 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5UM4 GLY A 1 ? UNP H9GIV0 ? ? 'expression tag' 35 1 1 5UM4 PRO A 2 ? UNP H9GIV0 ? ? 'expression tag' 36 2 1 5UM4 ASP A 3 ? UNP H9GIV0 ? ? 'expression tag' 37 3 1 5UM4 ASP A 4 ? UNP H9GIV0 ? ? 'expression tag' 38 4 1 5UM4 HIS A 5 ? UNP H9GIV0 ? ? 'expression tag' 39 5 1 5UM4 MET A 6 ? UNP H9GIV0 ? ? 'expression tag' 40 6 2 5UM4 ALA A 95 ? UNP P63250 PHE 255 'engineered mutation' 255 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CME 'L-peptide linking' n 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' ? 'C5 H11 N O3 S2' 197.276 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5UM4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.84 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.76 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;The protein was concentrated to 10 mg/mL. Crystals grown by mixing equal amounts of protein and reservoir solution (25 mM Na/K phosphate pH 5.0, 40 mM NaCl, 35 % Peg 400), and allowed to equilibrate over 1 ml of reservoir solution. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-10-26 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0003 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0003 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 61.610 _reflns.entry_id 5UM4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.987 _reflns.d_resolution_low 85.040 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 10030 _reflns.number_obs 10030 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.500 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.064 _reflns.pdbx_netI_over_av_sigmaI 7.500 _reflns.pdbx_netI_over_sigmaI 21.900 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.067 _reflns.pdbx_Rpim_I_all 0.019 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 125290 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.500 2.640 ? 1.300 ? ? ? ? ? 100.000 ? ? ? ? 0.591 ? ? ? ? ? ? ? ? 13.200 0.591 ? ? ? 0.615 0.169 ? 1 1 ? ? 2.640 2.800 ? 1.900 ? ? ? ? ? 100.000 ? ? ? ? 0.377 ? ? ? ? ? ? ? ? 13.200 0.377 ? ? ? 0.393 0.108 ? 2 1 ? ? 2.800 2.990 ? 3.700 ? ? ? ? ? 100.000 ? ? ? ? 0.197 ? ? ? ? ? ? ? ? 13.100 0.197 ? ? ? 0.205 0.056 ? 3 1 ? ? 2.990 3.230 ? 6.200 ? ? ? ? ? 100.000 ? ? ? ? 0.113 ? ? ? ? ? ? ? ? 12.900 0.113 ? ? ? 0.118 0.033 ? 4 1 ? ? 3.230 3.540 ? 9.000 ? ? ? ? ? 100.000 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 12.700 0.074 ? ? ? 0.077 0.022 ? 5 1 ? ? 3.540 3.950 ? 11.000 ? ? ? ? ? 99.600 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 12.300 0.055 ? ? ? 0.057 0.016 ? 6 1 ? ? 3.950 4.560 ? 10.300 ? ? ? ? ? 99.600 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 11.700 0.052 ? ? ? 0.054 0.016 ? 7 1 ? ? 4.560 5.590 ? 10.200 ? ? ? ? ? 99.900 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 11.000 0.056 ? ? ? 0.059 0.017 ? 8 1 ? ? 5.590 7.910 ? 15.400 ? ? ? ? ? 100.000 ? ? ? ? 0.040 ? ? ? ? ? ? ? ? 11.600 0.040 ? ? ? 0.042 0.012 ? 9 1 ? ? 2.5 2.64 ? 3.5 ? ? ? ? ? 89.900 ? ? ? ? 0.028 ? ? ? ? ? ? ? ? 10.100 0.028 ? ? ? 0.030 0.009 ? 10 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 115.350 _refine.B_iso_mean 67.2839 _refine.B_iso_min 39.220 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5UM4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5000 _refine.ls_d_res_low 85.0400 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17623 _refine.ls_number_reflns_R_free 888 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.2800 _refine.ls_percent_reflns_R_free 5.0400 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2263 _refine.ls_R_factor_R_free 0.2667 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2241 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.130 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1N9P _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 35.1300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4400 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.5000 _refine_hist.d_res_low 85.0400 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 27 _refine_hist.number_atoms_total 1571 _refine_hist.pdbx_number_residues_total 197 _refine_hist.pdbx_B_iso_mean_solvent 62.61 _refine_hist.pdbx_number_atoms_protein 1544 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 1581 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.137 ? 2138 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.060 ? 244 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 276 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 3.213 ? 1320 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5002 2.6568 2965 . 142 2823 97.0000 . . . 0.5106 0.0000 0.3724 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.6568 2.8620 2883 . 136 2747 95.0000 . . . 0.3422 0.0000 0.3306 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.8620 3.1500 2841 . 154 2687 93.0000 . . . 0.3180 0.0000 0.2785 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.1500 3.6058 2952 . 167 2785 98.0000 . . . 0.3030 0.0000 0.2385 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.6058 4.5429 3013 . 148 2865 98.0000 . . . 0.2161 0.0000 0.1798 . . . . . . 6 . . . 'X-RAY DIFFRACTION' 4.5429 85.0892 2969 . 141 2828 97.0000 . . . 0.2298 0.0000 0.2048 . . . . . . 6 . . . # _struct.entry_id 5UM4 _struct.title 'Crystal structure of the F255A mutant Kir3.1 cytoplasmic pore domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5UM4 _struct_keywords.text 'inward-rectifier K(+) channel, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 94 ? GLY A 98 ? GLY A 254 GLY A 258 5 ? 5 HELX_P HELX_P2 AA2 ARG A 126 ? GLU A 131 ? ARG A 286 GLU A 291 5 ? 6 HELX_P HELX_P3 AA3 ASP A 181 ? PHE A 185 ? ASP A 341 PHE A 345 5 ? 5 HELX_P HELX_P4 AA4 SER A 197 ? SER A 208 ? SER A 357 SER A 368 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ARG 18 C ? ? ? 1_555 A CME 19 N ? ? A ARG 52 A CME 53 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale2 covale both ? A CME 19 C ? ? ? 1_555 A ASN 20 N ? ? A CME 53 A ASN 54 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale3 covale both ? A THR 149 C ? ? ? 1_555 A CME 150 N ? ? A THR 309 A CME 310 1_555 ? ? ? ? ? ? ? 1.315 ? ? covale4 covale both ? A CME 150 C ? ? ? 1_555 A GLN 151 N ? ? A CME 310 A GLN 311 1_555 ? ? ? ? ? ? ? 1.310 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? AA3 ? 4 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 108 ? VAL A 113 ? LEU A 268 VAL A 273 AA1 2 LYS A 48 ? VAL A 55 ? LYS A 208 VAL A 215 AA1 3 ALA A 40 ? ARG A 45 ? ALA A 200 ARG A 205 AA1 4 VAL A 161 ? TRP A 163 ? VAL A 321 TRP A 323 AA2 1 PHE A 83 ? LEU A 91 ? PHE A 243 LEU A 251 AA2 2 MET A 63 ? GLN A 77 ? MET A 223 GLN A 237 AA2 3 GLN A 101 ? PHE A 103 ? GLN A 261 PHE A 263 AA3 1 PHE A 83 ? LEU A 91 ? PHE A 243 LEU A 251 AA3 2 MET A 63 ? GLN A 77 ? MET A 223 GLN A 237 AA3 3 GLU A 134 ? VAL A 143 ? GLU A 294 VAL A 303 AA3 4 THR A 149 ? THR A 157 ? THR A 309 THR A 317 AA4 1 HIS A 165 ? PHE A 167 ? HIS A 325 PHE A 327 AA4 2 THR A 188 ? GLU A 190 ? THR A 348 GLU A 350 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 108 ? O LEU A 268 N VAL A 55 ? N VAL A 215 AA1 2 3 O MET A 52 ? O MET A 212 N VAL A 41 ? N VAL A 201 AA1 3 4 N ALA A 40 ? N ALA A 200 O LEU A 162 ? O LEU A 322 AA2 1 2 O LEU A 84 ? O LEU A 244 N ARG A 76 ? N ARG A 236 AA2 2 3 N ALA A 66 ? N ALA A 226 O LEU A 102 ? O LEU A 262 AA3 1 2 O LEU A 84 ? O LEU A 244 N ARG A 76 ? N ARG A 236 AA3 2 3 N LEU A 73 ? N LEU A 233 O GLU A 134 ? O GLU A 294 AA3 3 4 N VAL A 135 ? N VAL A 295 O TYR A 156 ? O TYR A 316 AA4 1 2 N ARG A 166 ? N ARG A 326 O PHE A 189 ? O PHE A 349 # _atom_sites.entry_id 5UM4 _atom_sites.fract_transf_matrix[1][1] 0.012489 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012489 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011759 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 35 ? ? ? A . n A 1 2 PRO 2 36 ? ? ? A . n A 1 3 ASP 3 37 ? ? ? A . n A 1 4 ASP 4 38 ? ? ? A . n A 1 5 HIS 5 39 ? ? ? A . n A 1 6 MET 6 40 ? ? ? A . n A 1 7 LYS 7 41 ? ? ? A . n A 1 8 LYS 8 42 ? ? ? A . n A 1 9 ARG 9 43 43 ARG ARG A . n A 1 10 GLN 10 44 44 GLN GLN A . n A 1 11 ARG 11 45 45 ARG ARG A . n A 1 12 PHE 12 46 46 PHE PHE A . n A 1 13 VAL 13 47 47 VAL VAL A . n A 1 14 ASP 14 48 48 ASP ASP A . n A 1 15 LYS 15 49 49 LYS LYS A . n A 1 16 ASN 16 50 50 ASN ASN A . n A 1 17 GLY 17 51 51 GLY GLY A . n A 1 18 ARG 18 52 52 ARG ALA A . n A 1 19 CME 19 53 53 CME CME A . n A 1 20 ASN 20 54 54 ASN ASN A . n A 1 21 VAL 21 55 55 VAL VAL A . n A 1 22 GLN 22 56 56 GLN GLN A . n A 1 23 HIS 23 57 57 HIS HIS A . n A 1 24 GLY 24 58 58 GLY GLY A . n A 1 25 ASN 25 59 59 ASN ASN A . n A 1 26 LEU 26 60 60 LEU LEU A . n A 1 27 GLY 27 61 61 GLY GLY A . n A 1 28 SER 28 62 62 SER SER A . n A 1 29 GLU 29 63 63 GLU GLU A . n A 1 30 ARG 30 190 190 ARG ARG A . n A 1 31 ALA 31 191 191 ALA ALA A . n A 1 32 GLU 32 192 192 GLU GLU A . n A 1 33 THR 33 193 193 THR THR A . n A 1 34 LEU 34 194 194 LEU LEU A . n A 1 35 MET 35 195 195 MET MET A . n A 1 36 PHE 36 196 196 PHE PHE A . n A 1 37 SER 37 197 197 SER SER A . n A 1 38 GLU 38 198 198 GLU GLU A . n A 1 39 HIS 39 199 199 HIS HIS A . n A 1 40 ALA 40 200 200 ALA ALA A . n A 1 41 VAL 41 201 201 VAL VAL A . n A 1 42 ILE 42 202 202 ILE ILE A . n A 1 43 SER 43 203 203 SER SER A . n A 1 44 MET 44 204 204 MET MET A . n A 1 45 ARG 45 205 205 ARG ARG A . n A 1 46 ASP 46 206 206 ASP ASP A . n A 1 47 GLY 47 207 207 GLY GLY A . n A 1 48 LYS 48 208 208 LYS LYS A . n A 1 49 LEU 49 209 209 LEU LEU A . n A 1 50 THR 50 210 210 THR THR A . n A 1 51 LEU 51 211 211 LEU LEU A . n A 1 52 MET 52 212 212 MET MET A . n A 1 53 PHE 53 213 213 PHE PHE A . n A 1 54 ARG 54 214 214 ARG ARG A . n A 1 55 VAL 55 215 215 VAL VAL A . n A 1 56 GLY 56 216 216 GLY GLY A . n A 1 57 ASN 57 217 217 ASN ASN A . n A 1 58 LEU 58 218 218 LEU LEU A . n A 1 59 ARG 59 219 219 ARG ARG A . n A 1 60 ASN 60 220 220 ASN ASN A . n A 1 61 SER 61 221 221 SER SER A . n A 1 62 HIS 62 222 222 HIS HIS A . n A 1 63 MET 63 223 223 MET MET A . n A 1 64 VAL 64 224 224 VAL VAL A . n A 1 65 SER 65 225 225 SER SER A . n A 1 66 ALA 66 226 226 ALA ALA A . n A 1 67 GLN 67 227 227 GLN GLN A . n A 1 68 ILE 68 228 228 ILE ILE A . n A 1 69 ARG 69 229 229 ARG ARG A . n A 1 70 CYS 70 230 230 CYS CYS A . n A 1 71 LYS 71 231 231 LYS LYS A . n A 1 72 LEU 72 232 232 LEU LEU A . n A 1 73 LEU 73 233 233 LEU LEU A . n A 1 74 LYS 74 234 234 LYS LYS A . n A 1 75 SER 75 235 235 SER SER A . n A 1 76 ARG 76 236 236 ARG ARG A . n A 1 77 GLN 77 237 237 GLN GLN A . n A 1 78 THR 78 238 238 THR THR A . n A 1 79 PRO 79 239 239 PRO PRO A . n A 1 80 GLU 80 240 240 GLU GLU A . n A 1 81 GLY 81 241 241 GLY GLY A . n A 1 82 GLU 82 242 242 GLU GLU A . n A 1 83 PHE 83 243 243 PHE PHE A . n A 1 84 LEU 84 244 244 LEU LEU A . n A 1 85 PRO 85 245 245 PRO PRO A . n A 1 86 LEU 86 246 246 LEU LEU A . n A 1 87 ASP 87 247 247 ASP ASP A . n A 1 88 GLN 88 248 248 GLN GLN A . n A 1 89 LEU 89 249 249 LEU LEU A . n A 1 90 GLU 90 250 250 GLU GLU A . n A 1 91 LEU 91 251 251 LEU LEU A . n A 1 92 ASP 92 252 252 ASP ASP A . n A 1 93 VAL 93 253 253 VAL VAL A . n A 1 94 GLY 94 254 254 GLY GLY A . n A 1 95 ALA 95 255 255 ALA ALA A . n A 1 96 SER 96 256 256 SER SER A . n A 1 97 THR 97 257 257 THR THR A . n A 1 98 GLY 98 258 258 GLY GLY A . n A 1 99 ALA 99 259 259 ALA ALA A . n A 1 100 ASP 100 260 260 ASP ASP A . n A 1 101 GLN 101 261 261 GLN GLN A . n A 1 102 LEU 102 262 262 LEU LEU A . n A 1 103 PHE 103 263 263 PHE PHE A . n A 1 104 LEU 104 264 264 LEU LEU A . n A 1 105 VAL 105 265 265 VAL VAL A . n A 1 106 SER 106 266 266 SER SER A . n A 1 107 PRO 107 267 267 PRO PRO A . n A 1 108 LEU 108 268 268 LEU LEU A . n A 1 109 THR 109 269 269 THR THR A . n A 1 110 ILE 110 270 270 ILE ILE A . n A 1 111 CYS 111 271 271 CYS CYS A . n A 1 112 HIS 112 272 272 HIS HIS A . n A 1 113 VAL 113 273 273 VAL VAL A . n A 1 114 ILE 114 274 274 ILE ILE A . n A 1 115 ASP 115 275 275 ASP ASP A . n A 1 116 ALA 116 276 276 ALA ALA A . n A 1 117 LYS 117 277 277 LYS LYS A . n A 1 118 SER 118 278 278 SER SER A . n A 1 119 PRO 119 279 279 PRO PRO A . n A 1 120 PHE 120 280 280 PHE PHE A . n A 1 121 TYR 121 281 281 TYR TYR A . n A 1 122 ASP 122 282 282 ASP ASP A . n A 1 123 LEU 123 283 283 LEU LEU A . n A 1 124 SER 124 284 284 SER SER A . n A 1 125 GLN 125 285 285 GLN GLN A . n A 1 126 ARG 126 286 286 ARG ARG A . n A 1 127 SER 127 287 287 SER SER A . n A 1 128 MET 128 288 288 MET MET A . n A 1 129 GLN 129 289 289 GLN GLN A . n A 1 130 THR 130 290 290 THR THR A . n A 1 131 GLU 131 291 291 GLU GLU A . n A 1 132 GLN 132 292 292 GLN GLN A . n A 1 133 PHE 133 293 293 PHE PHE A . n A 1 134 GLU 134 294 294 GLU GLU A . n A 1 135 VAL 135 295 295 VAL VAL A . n A 1 136 VAL 136 296 296 VAL VAL A . n A 1 137 VAL 137 297 297 VAL VAL A . n A 1 138 ILE 138 298 298 ILE ILE A . n A 1 139 LEU 139 299 299 LEU LEU A . n A 1 140 GLU 140 300 300 GLU GLU A . n A 1 141 GLY 141 301 301 GLY GLY A . n A 1 142 ILE 142 302 302 ILE ILE A . n A 1 143 VAL 143 303 303 VAL VAL A . n A 1 144 GLU 144 304 304 GLU GLU A . n A 1 145 THR 145 305 305 THR THR A . n A 1 146 THR 146 306 306 THR THR A . n A 1 147 GLY 147 307 307 GLY GLY A . n A 1 148 MET 148 308 308 MET MET A . n A 1 149 THR 149 309 309 THR THR A . n A 1 150 CME 150 310 310 CME CME A . n A 1 151 GLN 151 311 311 GLN GLN A . n A 1 152 ALA 152 312 312 ALA ALA A . n A 1 153 ARG 153 313 313 ARG ARG A . n A 1 154 THR 154 314 314 THR THR A . n A 1 155 SER 155 315 315 SER SER A . n A 1 156 TYR 156 316 316 TYR TYR A . n A 1 157 THR 157 317 317 THR THR A . n A 1 158 GLU 158 318 318 GLU GLU A . n A 1 159 ASP 159 319 319 ASP ASP A . n A 1 160 GLU 160 320 320 GLU GLU A . n A 1 161 VAL 161 321 321 VAL VAL A . n A 1 162 LEU 162 322 322 LEU LEU A . n A 1 163 TRP 163 323 323 TRP TRP A . n A 1 164 GLY 164 324 324 GLY GLY A . n A 1 165 HIS 165 325 325 HIS HIS A . n A 1 166 ARG 166 326 326 ARG ARG A . n A 1 167 PHE 167 327 327 PHE PHE A . n A 1 168 PHE 168 328 328 PHE PHE A . n A 1 169 PRO 169 329 329 PRO PRO A . n A 1 170 VAL 170 330 330 VAL VAL A . n A 1 171 ILE 171 331 331 ILE ILE A . n A 1 172 SER 172 332 332 SER SER A . n A 1 173 LEU 173 333 333 LEU LEU A . n A 1 174 GLU 174 334 ? ? ? A . n A 1 175 GLU 175 335 ? ? ? A . n A 1 176 GLY 176 336 ? ? ? A . n A 1 177 PHE 177 337 ? ? ? A . n A 1 178 PHE 178 338 ? ? ? A . n A 1 179 LYS 179 339 339 LYS LYS A . n A 1 180 VAL 180 340 340 VAL VAL A . n A 1 181 ASP 181 341 341 ASP ASP A . n A 1 182 TYR 182 342 342 TYR TYR A . n A 1 183 SER 183 343 343 SER SER A . n A 1 184 GLN 184 344 344 GLN GLN A . n A 1 185 PHE 185 345 345 PHE PHE A . n A 1 186 HIS 186 346 346 HIS HIS A . n A 1 187 ALA 187 347 347 ALA ALA A . n A 1 188 THR 188 348 348 THR THR A . n A 1 189 PHE 189 349 349 PHE PHE A . n A 1 190 GLU 190 350 350 GLU GLU A . n A 1 191 VAL 191 351 351 VAL VAL A . n A 1 192 PRO 192 352 352 PRO PRO A . n A 1 193 THR 193 353 353 THR THR A . n A 1 194 PRO 194 354 354 PRO PRO A . n A 1 195 PRO 195 355 355 PRO PRO A . n A 1 196 TYR 196 356 356 TYR TYR A . n A 1 197 SER 197 357 357 SER SER A . n A 1 198 VAL 198 358 358 VAL VAL A . n A 1 199 LYS 199 359 359 LYS LYS A . n A 1 200 GLU 200 360 360 GLU GLU A . n A 1 201 GLN 201 361 361 GLN GLN A . n A 1 202 GLU 202 362 362 GLU GLU A . n A 1 203 GLU 203 363 363 GLU GLU A . n A 1 204 MET 204 364 364 MET MET A . n A 1 205 LEU 205 365 365 LEU LEU A . n A 1 206 LEU 206 366 366 LEU LEU A . n A 1 207 MET 207 367 367 MET MET A . n A 1 208 SER 208 368 368 SER SER A . n A 1 209 SER 209 369 369 SER SER A . n A 1 210 PRO 210 370 370 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 401 9 HOH HOH A . B 2 HOH 2 402 27 HOH HOH A . B 2 HOH 3 403 8 HOH HOH A . B 2 HOH 4 404 18 HOH HOH A . B 2 HOH 5 405 12 HOH HOH A . B 2 HOH 6 406 14 HOH HOH A . B 2 HOH 7 407 2 HOH HOH A . B 2 HOH 8 408 7 HOH HOH A . B 2 HOH 9 409 13 HOH HOH A . B 2 HOH 10 410 22 HOH HOH A . B 2 HOH 11 411 3 HOH HOH A . B 2 HOH 12 412 4 HOH HOH A . B 2 HOH 13 413 5 HOH HOH A . B 2 HOH 14 414 16 HOH HOH A . B 2 HOH 15 415 19 HOH HOH A . B 2 HOH 16 416 20 HOH HOH A . B 2 HOH 17 417 24 HOH HOH A . B 2 HOH 18 418 25 HOH HOH A . B 2 HOH 19 419 6 HOH HOH A . B 2 HOH 20 420 15 HOH HOH A . B 2 HOH 21 421 26 HOH HOH A . B 2 HOH 22 422 23 HOH HOH A . B 2 HOH 23 423 11 HOH HOH A . B 2 HOH 24 424 17 HOH HOH A . B 2 HOH 25 425 1 HOH HOH A . B 2 HOH 26 426 21 HOH HOH A . B 2 HOH 27 427 10 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CME 19 A CME 53 ? CYS 'modified residue' 2 A CME 150 A CME 310 ? CYS 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-01-31 2 'Structure model' 1 1 2022-03-23 3 'Structure model' 1 2 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_audit_support 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_audit_support.funding_organization' # _pdbx_phasing_MR.entry_id 5UM4 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 6.530 _pdbx_phasing_MR.d_res_low_rotation 85.040 _pdbx_phasing_MR.d_res_high_translation 6.530 _pdbx_phasing_MR.d_res_low_translation 85.040 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.22 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.6.1 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 362 ? ? O A HOH 401 ? ? 2.11 2 1 O A SER 332 ? ? N A LYS 339 ? ? 2.14 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 221 ? ? -140.47 56.68 2 1 LYS A 234 ? ? -174.57 148.89 3 1 THR A 306 ? ? -112.93 -130.90 4 1 TYR A 342 ? ? -59.03 -8.19 5 1 SER A 368 ? ? -89.97 35.13 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 43 ? CG ? A ARG 9 CG 2 1 Y 1 A ARG 43 ? CD ? A ARG 9 CD 3 1 Y 1 A ARG 43 ? NE ? A ARG 9 NE 4 1 Y 1 A ARG 43 ? CZ ? A ARG 9 CZ 5 1 Y 1 A ARG 43 ? NH1 ? A ARG 9 NH1 6 1 Y 1 A ARG 43 ? NH2 ? A ARG 9 NH2 7 1 Y 1 A GLN 44 ? CG ? A GLN 10 CG 8 1 Y 1 A GLN 44 ? CD ? A GLN 10 CD 9 1 Y 1 A GLN 44 ? OE1 ? A GLN 10 OE1 10 1 Y 1 A GLN 44 ? NE2 ? A GLN 10 NE2 11 1 Y 1 A ARG 52 ? CG ? A ARG 18 CG 12 1 Y 1 A ARG 52 ? CD ? A ARG 18 CD 13 1 Y 1 A ARG 52 ? NE ? A ARG 18 NE 14 1 Y 1 A ARG 52 ? CZ ? A ARG 18 CZ 15 1 Y 1 A ARG 52 ? NH1 ? A ARG 18 NH1 16 1 Y 1 A ARG 52 ? NH2 ? A ARG 18 NH2 17 1 Y 1 A GLN 56 ? CG ? A GLN 22 CG 18 1 Y 1 A GLN 56 ? CD ? A GLN 22 CD 19 1 Y 1 A GLN 56 ? OE1 ? A GLN 22 OE1 20 1 Y 1 A GLN 56 ? NE2 ? A GLN 22 NE2 21 1 Y 1 A ASN 59 ? CG ? A ASN 25 CG 22 1 Y 1 A ASN 59 ? OD1 ? A ASN 25 OD1 23 1 Y 1 A ASN 59 ? ND2 ? A ASN 25 ND2 24 1 Y 1 A ARG 190 ? CG ? A ARG 30 CG 25 1 Y 1 A ARG 190 ? CD ? A ARG 30 CD 26 1 Y 1 A ARG 190 ? NE ? A ARG 30 NE 27 1 Y 1 A ARG 190 ? CZ ? A ARG 30 CZ 28 1 Y 1 A ARG 190 ? NH1 ? A ARG 30 NH1 29 1 Y 1 A ARG 190 ? NH2 ? A ARG 30 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 35 ? A GLY 1 2 1 Y 1 A PRO 36 ? A PRO 2 3 1 Y 1 A ASP 37 ? A ASP 3 4 1 Y 1 A ASP 38 ? A ASP 4 5 1 Y 1 A HIS 39 ? A HIS 5 6 1 Y 1 A MET 40 ? A MET 6 7 1 Y 1 A LYS 41 ? A LYS 7 8 1 Y 1 A LYS 42 ? A LYS 8 9 1 Y 1 A GLU 334 ? A GLU 174 10 1 Y 1 A GLU 335 ? A GLU 175 11 1 Y 1 A GLY 336 ? A GLY 176 12 1 Y 1 A PHE 337 ? A PHE 177 13 1 Y 1 A PHE 338 ? A PHE 178 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CME N N N N 74 CME CA C N R 75 CME CB C N N 76 CME SG S N N 77 CME SD S N N 78 CME CE C N N 79 CME CZ C N N 80 CME OH O N N 81 CME C C N N 82 CME O O N N 83 CME OXT O N N 84 CME H H N N 85 CME H2 H N N 86 CME HA H N N 87 CME HB2 H N N 88 CME HB3 H N N 89 CME HE2 H N N 90 CME HE3 H N N 91 CME HZ2 H N N 92 CME HZ3 H N N 93 CME HH H N N 94 CME HXT H N N 95 CYS N N N N 96 CYS CA C N R 97 CYS C C N N 98 CYS O O N N 99 CYS CB C N N 100 CYS SG S N N 101 CYS OXT O N N 102 CYS H H N N 103 CYS H2 H N N 104 CYS HA H N N 105 CYS HB2 H N N 106 CYS HB3 H N N 107 CYS HG H N N 108 CYS HXT H N N 109 GLN N N N N 110 GLN CA C N S 111 GLN C C N N 112 GLN O O N N 113 GLN CB C N N 114 GLN CG C N N 115 GLN CD C N N 116 GLN OE1 O N N 117 GLN NE2 N N N 118 GLN OXT O N N 119 GLN H H N N 120 GLN H2 H N N 121 GLN HA H N N 122 GLN HB2 H N N 123 GLN HB3 H N N 124 GLN HG2 H N N 125 GLN HG3 H N N 126 GLN HE21 H N N 127 GLN HE22 H N N 128 GLN HXT H N N 129 GLU N N N N 130 GLU CA C N S 131 GLU C C N N 132 GLU O O N N 133 GLU CB C N N 134 GLU CG C N N 135 GLU CD C N N 136 GLU OE1 O N N 137 GLU OE2 O N N 138 GLU OXT O N N 139 GLU H H N N 140 GLU H2 H N N 141 GLU HA H N N 142 GLU HB2 H N N 143 GLU HB3 H N N 144 GLU HG2 H N N 145 GLU HG3 H N N 146 GLU HE2 H N N 147 GLU HXT H N N 148 GLY N N N N 149 GLY CA C N N 150 GLY C C N N 151 GLY O O N N 152 GLY OXT O N N 153 GLY H H N N 154 GLY H2 H N N 155 GLY HA2 H N N 156 GLY HA3 H N N 157 GLY HXT H N N 158 HIS N N N N 159 HIS CA C N S 160 HIS C C N N 161 HIS O O N N 162 HIS CB C N N 163 HIS CG C Y N 164 HIS ND1 N Y N 165 HIS CD2 C Y N 166 HIS CE1 C Y N 167 HIS NE2 N Y N 168 HIS OXT O N N 169 HIS H H N N 170 HIS H2 H N N 171 HIS HA H N N 172 HIS HB2 H N N 173 HIS HB3 H N N 174 HIS HD1 H N N 175 HIS HD2 H N N 176 HIS HE1 H N N 177 HIS HE2 H N N 178 HIS HXT H N N 179 HOH O O N N 180 HOH H1 H N N 181 HOH H2 H N N 182 ILE N N N N 183 ILE CA C N S 184 ILE C C N N 185 ILE O O N N 186 ILE CB C N S 187 ILE CG1 C N N 188 ILE CG2 C N N 189 ILE CD1 C N N 190 ILE OXT O N N 191 ILE H H N N 192 ILE H2 H N N 193 ILE HA H N N 194 ILE HB H N N 195 ILE HG12 H N N 196 ILE HG13 H N N 197 ILE HG21 H N N 198 ILE HG22 H N N 199 ILE HG23 H N N 200 ILE HD11 H N N 201 ILE HD12 H N N 202 ILE HD13 H N N 203 ILE HXT H N N 204 LEU N N N N 205 LEU CA C N S 206 LEU C C N N 207 LEU O O N N 208 LEU CB C N N 209 LEU CG C N N 210 LEU CD1 C N N 211 LEU CD2 C N N 212 LEU OXT O N N 213 LEU H H N N 214 LEU H2 H N N 215 LEU HA H N N 216 LEU HB2 H N N 217 LEU HB3 H N N 218 LEU HG H N N 219 LEU HD11 H N N 220 LEU HD12 H N N 221 LEU HD13 H N N 222 LEU HD21 H N N 223 LEU HD22 H N N 224 LEU HD23 H N N 225 LEU HXT H N N 226 LYS N N N N 227 LYS CA C N S 228 LYS C C N N 229 LYS O O N N 230 LYS CB C N N 231 LYS CG C N N 232 LYS CD C N N 233 LYS CE C N N 234 LYS NZ N N N 235 LYS OXT O N N 236 LYS H H N N 237 LYS H2 H N N 238 LYS HA H N N 239 LYS HB2 H N N 240 LYS HB3 H N N 241 LYS HG2 H N N 242 LYS HG3 H N N 243 LYS HD2 H N N 244 LYS HD3 H N N 245 LYS HE2 H N N 246 LYS HE3 H N N 247 LYS HZ1 H N N 248 LYS HZ2 H N N 249 LYS HZ3 H N N 250 LYS HXT H N N 251 MET N N N N 252 MET CA C N S 253 MET C C N N 254 MET O O N N 255 MET CB C N N 256 MET CG C N N 257 MET SD S N N 258 MET CE C N N 259 MET OXT O N N 260 MET H H N N 261 MET H2 H N N 262 MET HA H N N 263 MET HB2 H N N 264 MET HB3 H N N 265 MET HG2 H N N 266 MET HG3 H N N 267 MET HE1 H N N 268 MET HE2 H N N 269 MET HE3 H N N 270 MET HXT H N N 271 PHE N N N N 272 PHE CA C N S 273 PHE C C N N 274 PHE O O N N 275 PHE CB C N N 276 PHE CG C Y N 277 PHE CD1 C Y N 278 PHE CD2 C Y N 279 PHE CE1 C Y N 280 PHE CE2 C Y N 281 PHE CZ C Y N 282 PHE OXT O N N 283 PHE H H N N 284 PHE H2 H N N 285 PHE HA H N N 286 PHE HB2 H N N 287 PHE HB3 H N N 288 PHE HD1 H N N 289 PHE HD2 H N N 290 PHE HE1 H N N 291 PHE HE2 H N N 292 PHE HZ H N N 293 PHE HXT H N N 294 PRO N N N N 295 PRO CA C N S 296 PRO C C N N 297 PRO O O N N 298 PRO CB C N N 299 PRO CG C N N 300 PRO CD C N N 301 PRO OXT O N N 302 PRO H H N N 303 PRO HA H N N 304 PRO HB2 H N N 305 PRO HB3 H N N 306 PRO HG2 H N N 307 PRO HG3 H N N 308 PRO HD2 H N N 309 PRO HD3 H N N 310 PRO HXT H N N 311 SER N N N N 312 SER CA C N S 313 SER C C N N 314 SER O O N N 315 SER CB C N N 316 SER OG O N N 317 SER OXT O N N 318 SER H H N N 319 SER H2 H N N 320 SER HA H N N 321 SER HB2 H N N 322 SER HB3 H N N 323 SER HG H N N 324 SER HXT H N N 325 THR N N N N 326 THR CA C N S 327 THR C C N N 328 THR O O N N 329 THR CB C N R 330 THR OG1 O N N 331 THR CG2 C N N 332 THR OXT O N N 333 THR H H N N 334 THR H2 H N N 335 THR HA H N N 336 THR HB H N N 337 THR HG1 H N N 338 THR HG21 H N N 339 THR HG22 H N N 340 THR HG23 H N N 341 THR HXT H N N 342 TRP N N N N 343 TRP CA C N S 344 TRP C C N N 345 TRP O O N N 346 TRP CB C N N 347 TRP CG C Y N 348 TRP CD1 C Y N 349 TRP CD2 C Y N 350 TRP NE1 N Y N 351 TRP CE2 C Y N 352 TRP CE3 C Y N 353 TRP CZ2 C Y N 354 TRP CZ3 C Y N 355 TRP CH2 C Y N 356 TRP OXT O N N 357 TRP H H N N 358 TRP H2 H N N 359 TRP HA H N N 360 TRP HB2 H N N 361 TRP HB3 H N N 362 TRP HD1 H N N 363 TRP HE1 H N N 364 TRP HE3 H N N 365 TRP HZ2 H N N 366 TRP HZ3 H N N 367 TRP HH2 H N N 368 TRP HXT H N N 369 TYR N N N N 370 TYR CA C N S 371 TYR C C N N 372 TYR O O N N 373 TYR CB C N N 374 TYR CG C Y N 375 TYR CD1 C Y N 376 TYR CD2 C Y N 377 TYR CE1 C Y N 378 TYR CE2 C Y N 379 TYR CZ C Y N 380 TYR OH O N N 381 TYR OXT O N N 382 TYR H H N N 383 TYR H2 H N N 384 TYR HA H N N 385 TYR HB2 H N N 386 TYR HB3 H N N 387 TYR HD1 H N N 388 TYR HD2 H N N 389 TYR HE1 H N N 390 TYR HE2 H N N 391 TYR HH H N N 392 TYR HXT H N N 393 VAL N N N N 394 VAL CA C N S 395 VAL C C N N 396 VAL O O N N 397 VAL CB C N N 398 VAL CG1 C N N 399 VAL CG2 C N N 400 VAL OXT O N N 401 VAL H H N N 402 VAL H2 H N N 403 VAL HA H N N 404 VAL HB H N N 405 VAL HG11 H N N 406 VAL HG12 H N N 407 VAL HG13 H N N 408 VAL HG21 H N N 409 VAL HG22 H N N 410 VAL HG23 H N N 411 VAL HXT H N N 412 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CME N CA sing N N 70 CME N H sing N N 71 CME N H2 sing N N 72 CME CA CB sing N N 73 CME CA C sing N N 74 CME CA HA sing N N 75 CME CB SG sing N N 76 CME CB HB2 sing N N 77 CME CB HB3 sing N N 78 CME SG SD sing N N 79 CME SD CE sing N N 80 CME CE CZ sing N N 81 CME CE HE2 sing N N 82 CME CE HE3 sing N N 83 CME CZ OH sing N N 84 CME CZ HZ2 sing N N 85 CME CZ HZ3 sing N N 86 CME OH HH sing N N 87 CME C O doub N N 88 CME C OXT sing N N 89 CME OXT HXT sing N N 90 CYS N CA sing N N 91 CYS N H sing N N 92 CYS N H2 sing N N 93 CYS CA C sing N N 94 CYS CA CB sing N N 95 CYS CA HA sing N N 96 CYS C O doub N N 97 CYS C OXT sing N N 98 CYS CB SG sing N N 99 CYS CB HB2 sing N N 100 CYS CB HB3 sing N N 101 CYS SG HG sing N N 102 CYS OXT HXT sing N N 103 GLN N CA sing N N 104 GLN N H sing N N 105 GLN N H2 sing N N 106 GLN CA C sing N N 107 GLN CA CB sing N N 108 GLN CA HA sing N N 109 GLN C O doub N N 110 GLN C OXT sing N N 111 GLN CB CG sing N N 112 GLN CB HB2 sing N N 113 GLN CB HB3 sing N N 114 GLN CG CD sing N N 115 GLN CG HG2 sing N N 116 GLN CG HG3 sing N N 117 GLN CD OE1 doub N N 118 GLN CD NE2 sing N N 119 GLN NE2 HE21 sing N N 120 GLN NE2 HE22 sing N N 121 GLN OXT HXT sing N N 122 GLU N CA sing N N 123 GLU N H sing N N 124 GLU N H2 sing N N 125 GLU CA C sing N N 126 GLU CA CB sing N N 127 GLU CA HA sing N N 128 GLU C O doub N N 129 GLU C OXT sing N N 130 GLU CB CG sing N N 131 GLU CB HB2 sing N N 132 GLU CB HB3 sing N N 133 GLU CG CD sing N N 134 GLU CG HG2 sing N N 135 GLU CG HG3 sing N N 136 GLU CD OE1 doub N N 137 GLU CD OE2 sing N N 138 GLU OE2 HE2 sing N N 139 GLU OXT HXT sing N N 140 GLY N CA sing N N 141 GLY N H sing N N 142 GLY N H2 sing N N 143 GLY CA C sing N N 144 GLY CA HA2 sing N N 145 GLY CA HA3 sing N N 146 GLY C O doub N N 147 GLY C OXT sing N N 148 GLY OXT HXT sing N N 149 HIS N CA sing N N 150 HIS N H sing N N 151 HIS N H2 sing N N 152 HIS CA C sing N N 153 HIS CA CB sing N N 154 HIS CA HA sing N N 155 HIS C O doub N N 156 HIS C OXT sing N N 157 HIS CB CG sing N N 158 HIS CB HB2 sing N N 159 HIS CB HB3 sing N N 160 HIS CG ND1 sing Y N 161 HIS CG CD2 doub Y N 162 HIS ND1 CE1 doub Y N 163 HIS ND1 HD1 sing N N 164 HIS CD2 NE2 sing Y N 165 HIS CD2 HD2 sing N N 166 HIS CE1 NE2 sing Y N 167 HIS CE1 HE1 sing N N 168 HIS NE2 HE2 sing N N 169 HIS OXT HXT sing N N 170 HOH O H1 sing N N 171 HOH O H2 sing N N 172 ILE N CA sing N N 173 ILE N H sing N N 174 ILE N H2 sing N N 175 ILE CA C sing N N 176 ILE CA CB sing N N 177 ILE CA HA sing N N 178 ILE C O doub N N 179 ILE C OXT sing N N 180 ILE CB CG1 sing N N 181 ILE CB CG2 sing N N 182 ILE CB HB sing N N 183 ILE CG1 CD1 sing N N 184 ILE CG1 HG12 sing N N 185 ILE CG1 HG13 sing N N 186 ILE CG2 HG21 sing N N 187 ILE CG2 HG22 sing N N 188 ILE CG2 HG23 sing N N 189 ILE CD1 HD11 sing N N 190 ILE CD1 HD12 sing N N 191 ILE CD1 HD13 sing N N 192 ILE OXT HXT sing N N 193 LEU N CA sing N N 194 LEU N H sing N N 195 LEU N H2 sing N N 196 LEU CA C sing N N 197 LEU CA CB sing N N 198 LEU CA HA sing N N 199 LEU C O doub N N 200 LEU C OXT sing N N 201 LEU CB CG sing N N 202 LEU CB HB2 sing N N 203 LEU CB HB3 sing N N 204 LEU CG CD1 sing N N 205 LEU CG CD2 sing N N 206 LEU CG HG sing N N 207 LEU CD1 HD11 sing N N 208 LEU CD1 HD12 sing N N 209 LEU CD1 HD13 sing N N 210 LEU CD2 HD21 sing N N 211 LEU CD2 HD22 sing N N 212 LEU CD2 HD23 sing N N 213 LEU OXT HXT sing N N 214 LYS N CA sing N N 215 LYS N H sing N N 216 LYS N H2 sing N N 217 LYS CA C sing N N 218 LYS CA CB sing N N 219 LYS CA HA sing N N 220 LYS C O doub N N 221 LYS C OXT sing N N 222 LYS CB CG sing N N 223 LYS CB HB2 sing N N 224 LYS CB HB3 sing N N 225 LYS CG CD sing N N 226 LYS CG HG2 sing N N 227 LYS CG HG3 sing N N 228 LYS CD CE sing N N 229 LYS CD HD2 sing N N 230 LYS CD HD3 sing N N 231 LYS CE NZ sing N N 232 LYS CE HE2 sing N N 233 LYS CE HE3 sing N N 234 LYS NZ HZ1 sing N N 235 LYS NZ HZ2 sing N N 236 LYS NZ HZ3 sing N N 237 LYS OXT HXT sing N N 238 MET N CA sing N N 239 MET N H sing N N 240 MET N H2 sing N N 241 MET CA C sing N N 242 MET CA CB sing N N 243 MET CA HA sing N N 244 MET C O doub N N 245 MET C OXT sing N N 246 MET CB CG sing N N 247 MET CB HB2 sing N N 248 MET CB HB3 sing N N 249 MET CG SD sing N N 250 MET CG HG2 sing N N 251 MET CG HG3 sing N N 252 MET SD CE sing N N 253 MET CE HE1 sing N N 254 MET CE HE2 sing N N 255 MET CE HE3 sing N N 256 MET OXT HXT sing N N 257 PHE N CA sing N N 258 PHE N H sing N N 259 PHE N H2 sing N N 260 PHE CA C sing N N 261 PHE CA CB sing N N 262 PHE CA HA sing N N 263 PHE C O doub N N 264 PHE C OXT sing N N 265 PHE CB CG sing N N 266 PHE CB HB2 sing N N 267 PHE CB HB3 sing N N 268 PHE CG CD1 doub Y N 269 PHE CG CD2 sing Y N 270 PHE CD1 CE1 sing Y N 271 PHE CD1 HD1 sing N N 272 PHE CD2 CE2 doub Y N 273 PHE CD2 HD2 sing N N 274 PHE CE1 CZ doub Y N 275 PHE CE1 HE1 sing N N 276 PHE CE2 CZ sing Y N 277 PHE CE2 HE2 sing N N 278 PHE CZ HZ sing N N 279 PHE OXT HXT sing N N 280 PRO N CA sing N N 281 PRO N CD sing N N 282 PRO N H sing N N 283 PRO CA C sing N N 284 PRO CA CB sing N N 285 PRO CA HA sing N N 286 PRO C O doub N N 287 PRO C OXT sing N N 288 PRO CB CG sing N N 289 PRO CB HB2 sing N N 290 PRO CB HB3 sing N N 291 PRO CG CD sing N N 292 PRO CG HG2 sing N N 293 PRO CG HG3 sing N N 294 PRO CD HD2 sing N N 295 PRO CD HD3 sing N N 296 PRO OXT HXT sing N N 297 SER N CA sing N N 298 SER N H sing N N 299 SER N H2 sing N N 300 SER CA C sing N N 301 SER CA CB sing N N 302 SER CA HA sing N N 303 SER C O doub N N 304 SER C OXT sing N N 305 SER CB OG sing N N 306 SER CB HB2 sing N N 307 SER CB HB3 sing N N 308 SER OG HG sing N N 309 SER OXT HXT sing N N 310 THR N CA sing N N 311 THR N H sing N N 312 THR N H2 sing N N 313 THR CA C sing N N 314 THR CA CB sing N N 315 THR CA HA sing N N 316 THR C O doub N N 317 THR C OXT sing N N 318 THR CB OG1 sing N N 319 THR CB CG2 sing N N 320 THR CB HB sing N N 321 THR OG1 HG1 sing N N 322 THR CG2 HG21 sing N N 323 THR CG2 HG22 sing N N 324 THR CG2 HG23 sing N N 325 THR OXT HXT sing N N 326 TRP N CA sing N N 327 TRP N H sing N N 328 TRP N H2 sing N N 329 TRP CA C sing N N 330 TRP CA CB sing N N 331 TRP CA HA sing N N 332 TRP C O doub N N 333 TRP C OXT sing N N 334 TRP CB CG sing N N 335 TRP CB HB2 sing N N 336 TRP CB HB3 sing N N 337 TRP CG CD1 doub Y N 338 TRP CG CD2 sing Y N 339 TRP CD1 NE1 sing Y N 340 TRP CD1 HD1 sing N N 341 TRP CD2 CE2 doub Y N 342 TRP CD2 CE3 sing Y N 343 TRP NE1 CE2 sing Y N 344 TRP NE1 HE1 sing N N 345 TRP CE2 CZ2 sing Y N 346 TRP CE3 CZ3 doub Y N 347 TRP CE3 HE3 sing N N 348 TRP CZ2 CH2 doub Y N 349 TRP CZ2 HZ2 sing N N 350 TRP CZ3 CH2 sing Y N 351 TRP CZ3 HZ3 sing N N 352 TRP CH2 HH2 sing N N 353 TRP OXT HXT sing N N 354 TYR N CA sing N N 355 TYR N H sing N N 356 TYR N H2 sing N N 357 TYR CA C sing N N 358 TYR CA CB sing N N 359 TYR CA HA sing N N 360 TYR C O doub N N 361 TYR C OXT sing N N 362 TYR CB CG sing N N 363 TYR CB HB2 sing N N 364 TYR CB HB3 sing N N 365 TYR CG CD1 doub Y N 366 TYR CG CD2 sing Y N 367 TYR CD1 CE1 sing Y N 368 TYR CD1 HD1 sing N N 369 TYR CD2 CE2 doub Y N 370 TYR CD2 HD2 sing N N 371 TYR CE1 CZ doub Y N 372 TYR CE1 HE1 sing N N 373 TYR CE2 CZ sing Y N 374 TYR CE2 HE2 sing N N 375 TYR CZ OH sing N N 376 TYR OH HH sing N N 377 TYR OXT HXT sing N N 378 VAL N CA sing N N 379 VAL N H sing N N 380 VAL N H2 sing N N 381 VAL CA C sing N N 382 VAL CA CB sing N N 383 VAL CA HA sing N N 384 VAL C O doub N N 385 VAL C OXT sing N N 386 VAL CB CG1 sing N N 387 VAL CB CG2 sing N N 388 VAL CB HB sing N N 389 VAL CG1 HG11 sing N N 390 VAL CG1 HG12 sing N N 391 VAL CG1 HG13 sing N N 392 VAL CG2 HG21 sing N N 393 VAL CG2 HG22 sing N N 394 VAL CG2 HG23 sing N N 395 VAL OXT HXT sing N N 396 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Heart, Lung, and Blood Institute (NIH/NHLBI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1N9P _pdbx_initial_refinement_model.details ? #