data_5V28 # _entry.id 5V28 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5V28 pdb_00005v28 10.2210/pdb5v28/pdb WWPDB D_1000226768 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-03-07 2 'Structure model' 1 1 2018-04-18 3 'Structure model' 1 2 2019-11-27 4 'Structure model' 1 3 2024-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' diffrn_detector 2 3 'Structure model' pdbx_audit_support 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_diffrn_detector.detector' 2 3 'Structure model' '_pdbx_audit_support.funding_organization' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5V28 _pdbx_database_status.recvd_initial_deposition_date 2017-03-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 5V27 PDB . unspecified 5V26 PDB . # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Dornevil, K.' 1 ? 'Liu, F.' 2 ? 'Liu, A.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title '2.72 angstrom crystal structure of P97A 3-hydroxyanthranilate-3,4-dioxygenase from Cupriavidus metallidurans' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dornevil, K.' 1 ? primary 'Liu, F.' 2 ? primary 'Liu, A.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '3-hydroxyanthranilate 3,4-dioxygenase' 23053.877 1 1.13.11.6 ? ? ? 2 non-polymer syn 'FE (II) ION' 55.845 2 ? ? ? ? 3 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143 1 ? ? ? ? 4 water nat water 18.015 10 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '3-hydroxyanthranilate oxygenase,3-HAO,3-hydroxyanthranilic acid dioxygenase,HAD' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSENLYFQGHMLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDD PLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSAQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVH RVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSENLYFQGHMLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDD PLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSAQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVH RVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (II) ION' FE2 3 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 GLU n 1 21 ASN n 1 22 LEU n 1 23 TYR n 1 24 PHE n 1 25 GLN n 1 26 GLY n 1 27 HIS n 1 28 MET n 1 29 LEU n 1 30 THR n 1 31 TYR n 1 32 GLY n 1 33 ALA n 1 34 PRO n 1 35 PHE n 1 36 ASN n 1 37 PHE n 1 38 PRO n 1 39 ARG n 1 40 TRP n 1 41 ILE n 1 42 ASP n 1 43 GLU n 1 44 HIS n 1 45 ALA n 1 46 HIS n 1 47 LEU n 1 48 LEU n 1 49 LYS n 1 50 PRO n 1 51 PRO n 1 52 VAL n 1 53 GLY n 1 54 ASN n 1 55 ARG n 1 56 GLN n 1 57 VAL n 1 58 TRP n 1 59 GLN n 1 60 ASP n 1 61 SER n 1 62 ASP n 1 63 PHE n 1 64 ILE n 1 65 VAL n 1 66 THR n 1 67 VAL n 1 68 VAL n 1 69 GLY n 1 70 GLY n 1 71 PRO n 1 72 ASN n 1 73 HIS n 1 74 ARG n 1 75 THR n 1 76 ASP n 1 77 TYR n 1 78 HIS n 1 79 ASP n 1 80 ASP n 1 81 PRO n 1 82 LEU n 1 83 GLU n 1 84 GLU n 1 85 PHE n 1 86 PHE n 1 87 TYR n 1 88 GLN n 1 89 LEU n 1 90 ARG n 1 91 GLY n 1 92 ASN n 1 93 ALA n 1 94 TYR n 1 95 LEU n 1 96 ASN n 1 97 LEU n 1 98 TRP n 1 99 VAL n 1 100 ASP n 1 101 GLY n 1 102 ARG n 1 103 ARG n 1 104 GLU n 1 105 ARG n 1 106 ALA n 1 107 ASP n 1 108 LEU n 1 109 LYS n 1 110 GLU n 1 111 GLY n 1 112 ASP n 1 113 ILE n 1 114 PHE n 1 115 LEU n 1 116 LEU n 1 117 PRO n 1 118 PRO n 1 119 HIS n 1 120 VAL n 1 121 ARG n 1 122 HIS n 1 123 SER n 1 124 ALA n 1 125 GLN n 1 126 ARG n 1 127 PRO n 1 128 GLU n 1 129 ALA n 1 130 GLY n 1 131 SER n 1 132 ALA n 1 133 CYS n 1 134 LEU n 1 135 VAL n 1 136 ILE n 1 137 GLU n 1 138 ARG n 1 139 GLN n 1 140 ARG n 1 141 PRO n 1 142 ALA n 1 143 GLY n 1 144 MET n 1 145 LEU n 1 146 ASP n 1 147 GLY n 1 148 PHE n 1 149 GLU n 1 150 TRP n 1 151 TYR n 1 152 CYS n 1 153 ASP n 1 154 ALA n 1 155 CYS n 1 156 GLY n 1 157 HIS n 1 158 LEU n 1 159 VAL n 1 160 HIS n 1 161 ARG n 1 162 VAL n 1 163 GLU n 1 164 VAL n 1 165 GLN n 1 166 LEU n 1 167 LYS n 1 168 SER n 1 169 ILE n 1 170 VAL n 1 171 THR n 1 172 ASP n 1 173 LEU n 1 174 PRO n 1 175 PRO n 1 176 LEU n 1 177 PHE n 1 178 GLU n 1 179 SER n 1 180 PHE n 1 181 TYR n 1 182 ALA n 1 183 SER n 1 184 GLU n 1 185 ASP n 1 186 LYS n 1 187 ARG n 1 188 ARG n 1 189 CYS n 1 190 PRO n 1 191 HIS n 1 192 CYS n 1 193 GLY n 1 194 GLN n 1 195 VAL n 1 196 HIS n 1 197 PRO n 1 198 GLY n 1 199 ARG n 1 200 ALA n 1 201 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 201 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'nbaC, Rmet_5193' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 43123 / DSM 2839 / NBRC 102507 / CH34' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 266264 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE2 non-polymer . 'FE (II) ION' ? 'Fe 2' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TRS non-polymer . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1' 122.143 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -26 ? ? ? A . n A 1 2 GLY 2 -25 ? ? ? A . n A 1 3 SER 3 -24 ? ? ? A . n A 1 4 SER 4 -23 ? ? ? A . n A 1 5 HIS 5 -22 ? ? ? A . n A 1 6 HIS 6 -21 ? ? ? A . n A 1 7 HIS 7 -20 ? ? ? A . n A 1 8 HIS 8 -19 ? ? ? A . n A 1 9 HIS 9 -18 ? ? ? A . n A 1 10 HIS 10 -17 ? ? ? A . n A 1 11 SER 11 -16 ? ? ? A . n A 1 12 SER 12 -15 ? ? ? A . n A 1 13 GLY 13 -14 ? ? ? A . n A 1 14 LEU 14 -13 ? ? ? A . n A 1 15 VAL 15 -12 ? ? ? A . n A 1 16 PRO 16 -11 ? ? ? A . n A 1 17 ARG 17 -10 ? ? ? A . n A 1 18 GLY 18 -9 ? ? ? A . n A 1 19 SER 19 -8 ? ? ? A . n A 1 20 GLU 20 -7 ? ? ? A . n A 1 21 ASN 21 -6 ? ? ? A . n A 1 22 LEU 22 -5 ? ? ? A . n A 1 23 TYR 23 -4 ? ? ? A . n A 1 24 PHE 24 -3 ? ? ? A . n A 1 25 GLN 25 -2 ? ? ? A . n A 1 26 GLY 26 -1 ? ? ? A . n A 1 27 HIS 27 0 ? ? ? A . n A 1 28 MET 28 1 1 MET MET A . n A 1 29 LEU 29 2 2 LEU LEU A . n A 1 30 THR 30 3 3 THR THR A . n A 1 31 TYR 31 4 4 TYR TYR A . n A 1 32 GLY 32 5 5 GLY GLY A . n A 1 33 ALA 33 6 6 ALA ALA A . n A 1 34 PRO 34 7 7 PRO PRO A . n A 1 35 PHE 35 8 8 PHE PHE A . n A 1 36 ASN 36 9 9 ASN ASN A . n A 1 37 PHE 37 10 10 PHE PHE A . n A 1 38 PRO 38 11 11 PRO PRO A . n A 1 39 ARG 39 12 12 ARG ARG A . n A 1 40 TRP 40 13 13 TRP TRP A . n A 1 41 ILE 41 14 14 ILE ILE A . n A 1 42 ASP 42 15 15 ASP ASP A . n A 1 43 GLU 43 16 16 GLU GLU A . n A 1 44 HIS 44 17 17 HIS HIS A . n A 1 45 ALA 45 18 18 ALA ALA A . n A 1 46 HIS 46 19 19 HIS HIS A . n A 1 47 LEU 47 20 20 LEU LEU A . n A 1 48 LEU 48 21 21 LEU LEU A . n A 1 49 LYS 49 22 22 LYS LYS A . n A 1 50 PRO 50 23 23 PRO PRO A . n A 1 51 PRO 51 24 24 PRO PRO A . n A 1 52 VAL 52 25 25 VAL VAL A . n A 1 53 GLY 53 26 26 GLY GLY A . n A 1 54 ASN 54 27 27 ASN ASN A . n A 1 55 ARG 55 28 28 ARG ARG A . n A 1 56 GLN 56 29 29 GLN GLN A . n A 1 57 VAL 57 30 30 VAL VAL A . n A 1 58 TRP 58 31 31 TRP TRP A . n A 1 59 GLN 59 32 32 GLN GLN A . n A 1 60 ASP 60 33 33 ASP ASP A . n A 1 61 SER 61 34 34 SER SER A . n A 1 62 ASP 62 35 35 ASP ASP A . n A 1 63 PHE 63 36 36 PHE PHE A . n A 1 64 ILE 64 37 37 ILE ILE A . n A 1 65 VAL 65 38 38 VAL VAL A . n A 1 66 THR 66 39 39 THR THR A . n A 1 67 VAL 67 40 40 VAL VAL A . n A 1 68 VAL 68 41 41 VAL VAL A . n A 1 69 GLY 69 42 42 GLY GLY A . n A 1 70 GLY 70 43 43 GLY GLY A . n A 1 71 PRO 71 44 44 PRO PRO A . n A 1 72 ASN 72 45 45 ASN ASN A . n A 1 73 HIS 73 46 46 HIS HIS A . n A 1 74 ARG 74 47 47 ARG ARG A . n A 1 75 THR 75 48 48 THR THR A . n A 1 76 ASP 76 49 49 ASP ASP A . n A 1 77 TYR 77 50 50 TYR TYR A . n A 1 78 HIS 78 51 51 HIS HIS A . n A 1 79 ASP 79 52 52 ASP ASP A . n A 1 80 ASP 80 53 53 ASP ASP A . n A 1 81 PRO 81 54 54 PRO PRO A . n A 1 82 LEU 82 55 55 LEU LEU A . n A 1 83 GLU 83 56 56 GLU GLU A . n A 1 84 GLU 84 57 57 GLU GLU A . n A 1 85 PHE 85 58 58 PHE PHE A . n A 1 86 PHE 86 59 59 PHE PHE A . n A 1 87 TYR 87 60 60 TYR TYR A . n A 1 88 GLN 88 61 61 GLN GLN A . n A 1 89 LEU 89 62 62 LEU LEU A . n A 1 90 ARG 90 63 63 ARG ARG A . n A 1 91 GLY 91 64 64 GLY GLY A . n A 1 92 ASN 92 65 65 ASN ASN A . n A 1 93 ALA 93 66 66 ALA ALA A . n A 1 94 TYR 94 67 67 TYR TYR A . n A 1 95 LEU 95 68 68 LEU LEU A . n A 1 96 ASN 96 69 69 ASN ASN A . n A 1 97 LEU 97 70 70 LEU LEU A . n A 1 98 TRP 98 71 71 TRP TRP A . n A 1 99 VAL 99 72 72 VAL VAL A . n A 1 100 ASP 100 73 73 ASP ASP A . n A 1 101 GLY 101 74 74 GLY GLY A . n A 1 102 ARG 102 75 75 ARG ARG A . n A 1 103 ARG 103 76 76 ARG ARG A . n A 1 104 GLU 104 77 77 GLU GLU A . n A 1 105 ARG 105 78 78 ARG ARG A . n A 1 106 ALA 106 79 79 ALA ALA A . n A 1 107 ASP 107 80 80 ASP ASP A . n A 1 108 LEU 108 81 81 LEU LEU A . n A 1 109 LYS 109 82 82 LYS LYS A . n A 1 110 GLU 110 83 83 GLU GLU A . n A 1 111 GLY 111 84 84 GLY GLY A . n A 1 112 ASP 112 85 85 ASP ASP A . n A 1 113 ILE 113 86 86 ILE ILE A . n A 1 114 PHE 114 87 87 PHE PHE A . n A 1 115 LEU 115 88 88 LEU LEU A . n A 1 116 LEU 116 89 89 LEU LEU A . n A 1 117 PRO 117 90 90 PRO PRO A . n A 1 118 PRO 118 91 91 PRO PRO A . n A 1 119 HIS 119 92 92 HIS HIS A . n A 1 120 VAL 120 93 93 VAL VAL A . n A 1 121 ARG 121 94 94 ARG ARG A . n A 1 122 HIS 122 95 95 HIS HIS A . n A 1 123 SER 123 96 96 SER SER A . n A 1 124 ALA 124 97 97 ALA ALA A . n A 1 125 GLN 125 98 98 GLN GLN A . n A 1 126 ARG 126 99 99 ARG ARG A . n A 1 127 PRO 127 100 100 PRO PRO A . n A 1 128 GLU 128 101 101 GLU GLU A . n A 1 129 ALA 129 102 102 ALA ALA A . n A 1 130 GLY 130 103 103 GLY GLY A . n A 1 131 SER 131 104 104 SER SER A . n A 1 132 ALA 132 105 105 ALA ALA A . n A 1 133 CYS 133 106 106 CYS CYS A . n A 1 134 LEU 134 107 107 LEU LEU A . n A 1 135 VAL 135 108 108 VAL VAL A . n A 1 136 ILE 136 109 109 ILE ILE A . n A 1 137 GLU 137 110 110 GLU GLU A . n A 1 138 ARG 138 111 111 ARG ARG A . n A 1 139 GLN 139 112 112 GLN GLN A . n A 1 140 ARG 140 113 113 ARG ARG A . n A 1 141 PRO 141 114 114 PRO PRO A . n A 1 142 ALA 142 115 115 ALA ALA A . n A 1 143 GLY 143 116 116 GLY GLY A . n A 1 144 MET 144 117 117 MET MET A . n A 1 145 LEU 145 118 118 LEU LEU A . n A 1 146 ASP 146 119 119 ASP ASP A . n A 1 147 GLY 147 120 120 GLY GLY A . n A 1 148 PHE 148 121 121 PHE PHE A . n A 1 149 GLU 149 122 122 GLU GLU A . n A 1 150 TRP 150 123 123 TRP TRP A . n A 1 151 TYR 151 124 124 TYR TYR A . n A 1 152 CYS 152 125 125 CYS CYS A . n A 1 153 ASP 153 126 126 ASP ASP A . n A 1 154 ALA 154 127 127 ALA ALA A . n A 1 155 CYS 155 128 128 CYS CYS A . n A 1 156 GLY 156 129 129 GLY GLY A . n A 1 157 HIS 157 130 130 HIS HIS A . n A 1 158 LEU 158 131 131 LEU LEU A . n A 1 159 VAL 159 132 132 VAL VAL A . n A 1 160 HIS 160 133 133 HIS HIS A . n A 1 161 ARG 161 134 134 ARG ARG A . n A 1 162 VAL 162 135 135 VAL VAL A . n A 1 163 GLU 163 136 136 GLU GLU A . n A 1 164 VAL 164 137 137 VAL VAL A . n A 1 165 GLN 165 138 138 GLN GLN A . n A 1 166 LEU 166 139 139 LEU LEU A . n A 1 167 LYS 167 140 140 LYS LYS A . n A 1 168 SER 168 141 141 SER SER A . n A 1 169 ILE 169 142 142 ILE ILE A . n A 1 170 VAL 170 143 143 VAL VAL A . n A 1 171 THR 171 144 144 THR THR A . n A 1 172 ASP 172 145 145 ASP ASP A . n A 1 173 LEU 173 146 146 LEU LEU A . n A 1 174 PRO 174 147 147 PRO PRO A . n A 1 175 PRO 175 148 148 PRO PRO A . n A 1 176 LEU 176 149 149 LEU LEU A . n A 1 177 PHE 177 150 150 PHE PHE A . n A 1 178 GLU 178 151 151 GLU GLU A . n A 1 179 SER 179 152 152 SER SER A . n A 1 180 PHE 180 153 153 PHE PHE A . n A 1 181 TYR 181 154 154 TYR TYR A . n A 1 182 ALA 182 155 155 ALA ALA A . n A 1 183 SER 183 156 156 SER SER A . n A 1 184 GLU 184 157 157 GLU GLU A . n A 1 185 ASP 185 158 158 ASP ASP A . n A 1 186 LYS 186 159 159 LYS LYS A . n A 1 187 ARG 187 160 160 ARG ARG A . n A 1 188 ARG 188 161 161 ARG ARG A . n A 1 189 CYS 189 162 162 CYS CYS A . n A 1 190 PRO 190 163 163 PRO PRO A . n A 1 191 HIS 191 164 164 HIS HIS A . n A 1 192 CYS 192 165 165 CYS CYS A . n A 1 193 GLY 193 166 166 GLY GLY A . n A 1 194 GLN 194 167 167 GLN GLN A . n A 1 195 VAL 195 168 168 VAL VAL A . n A 1 196 HIS 196 169 169 HIS HIS A . n A 1 197 PRO 197 170 170 PRO PRO A . n A 1 198 GLY 198 171 171 GLY GLY A . n A 1 199 ARG 199 172 172 ARG ARG A . n A 1 200 ALA 200 173 173 ALA ALA A . n A 1 201 ALA 201 174 174 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE2 1 201 1 FE2 FE A . C 2 FE2 1 202 2 FE2 FE A . D 3 TRS 1 203 1 TRS TRS A . E 4 HOH 1 301 1 HOH HOH A . E 4 HOH 2 302 9 HOH HOH A . E 4 HOH 3 303 2 HOH HOH A . E 4 HOH 4 304 4 HOH HOH A . E 4 HOH 5 305 8 HOH HOH A . E 4 HOH 6 306 10 HOH HOH A . E 4 HOH 7 307 3 HOH HOH A . E 4 HOH 8 308 6 HOH HOH A . E 4 HOH 9 309 7 HOH HOH A . E 4 HOH 10 310 5 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 75 ? CG ? A ARG 102 CG 2 1 Y 1 A ARG 75 ? CD ? A ARG 102 CD 3 1 Y 1 A ARG 75 ? NE ? A ARG 102 NE 4 1 Y 1 A ARG 75 ? CZ ? A ARG 102 CZ 5 1 Y 1 A ARG 75 ? NH1 ? A ARG 102 NH1 6 1 Y 1 A ARG 75 ? NH2 ? A ARG 102 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? . 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 5V28 _cell.details ? _cell.formula_units_Z ? _cell.length_a 58.602 _cell.length_a_esd ? _cell.length_b 58.602 _cell.length_b_esd ? _cell.length_c 231.523 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5V28 _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5V28 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.49 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.58 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM Tris-HCl, 200 mM MgCl2, 20% PEG 8000, and 1 mM DTT, pH 8.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR scanner 300 mm plate' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-07-07 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 47.190 _reflns.entry_id 5V28 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.720 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6174 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 87.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 23.600 _reflns.pdbx_Rmerge_I_obs 0.187 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.004 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.191 _reflns.pdbx_Rpim_I_all 0.036 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 145783 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.720 2.820 ? ? ? ? ? ? ? 36.600 ? ? ? ? 0.514 ? ? ? ? ? ? ? ? 4.600 ? 0.688 ? ? 0.560 0.207 ? 1 1 0.828 ? 2.820 2.930 ? ? ? ? ? ? ? 56.300 ? ? ? ? 0.588 ? ? ? ? ? ? ? ? 7.200 ? 0.759 ? ? 0.621 0.185 ? 2 1 0.847 ? 2.930 3.060 ? ? ? ? ? ? ? 85.400 ? ? ? ? 0.538 ? ? ? ? ? ? ? ? 10.400 ? 0.799 ? ? 0.560 0.142 ? 3 1 0.926 ? 3.060 3.220 ? ? ? ? ? ? ? 96.600 ? ? ? ? 0.448 ? ? ? ? ? ? ? ? 15.000 ? 0.846 ? ? 0.462 0.105 ? 4 1 0.944 ? 3.220 3.430 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.382 ? ? ? ? ? ? ? ? 22.500 ? 0.956 ? ? 0.390 0.078 ? 5 1 0.988 ? 3.430 3.690 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.304 ? ? ? ? ? ? ? ? 28.700 ? 0.957 ? ? 0.309 0.056 ? 6 1 0.994 ? 3.690 4.060 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.249 ? ? ? ? ? ? ? ? 32.200 ? 1.023 ? ? 0.253 0.044 ? 7 1 0.995 ? 4.060 4.650 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.162 ? ? ? ? ? ? ? ? 32.300 ? 1.008 ? ? 0.165 0.029 ? 8 1 0.997 ? 4.650 5.860 ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.141 ? ? ? ? ? ? ? ? 31.500 ? 0.974 ? ? 0.143 0.025 ? 9 1 0.998 ? 5.860 50.000 ? ? ? ? ? ? ? 99.000 ? ? ? ? 0.112 ? ? ? ? ? ? ? ? 27.600 ? 1.242 ? ? 0.114 0.022 ? 10 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 104.020 _refine.B_iso_mean 43.2591 _refine.B_iso_min 22.050 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5V28 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7240 _refine.ls_d_res_low 34.2060 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6099 _refine.ls_number_reflns_R_free 279 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 87.8100 _refine.ls_percent_reflns_R_free 4.5700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1956 _refine.ls_R_factor_R_free 0.2618 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1922 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 17.5400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.7240 _refine_hist.d_res_low 34.2060 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 1439 _refine_hist.pdbx_number_residues_total 174 _refine_hist.pdbx_B_iso_mean_ligand 59.62 _refine_hist.pdbx_B_iso_mean_solvent 35.43 _refine_hist.pdbx_number_atoms_protein 1407 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 1460 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.095 ? 1987 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.053 ? 199 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 266 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 18.070 ? 857 ? f_dihedral_angle_d ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.7240 _refine_ls_shell.d_res_low 3.4314 _refine_ls_shell.number_reflns_all 2503 _refine_ls_shell.number_reflns_obs . _refine_ls_shell.number_reflns_R_free 106 _refine_ls_shell.number_reflns_R_work 2397 _refine_ls_shell.percent_reflns_obs 75.0000 _refine_ls_shell.percent_reflns_R_free . _refine_ls_shell.R_factor_all . _refine_ls_shell.R_factor_obs . _refine_ls_shell.R_factor_R_free 0.3852 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2527 _refine_ls_shell.redundancy_reflns_all . _refine_ls_shell.redundancy_reflns_obs . _refine_ls_shell.wR_factor_all . _refine_ls_shell.wR_factor_obs . _refine_ls_shell.wR_factor_R_free . _refine_ls_shell.wR_factor_R_work . _refine_ls_shell.pdbx_total_number_of_bins_used 2 _refine_ls_shell.pdbx_phase_error . _refine_ls_shell.pdbx_fsc_work . _refine_ls_shell.pdbx_fsc_free . # _struct.entry_id 5V28 _struct.title '2.72 angstrom crystal structure of P97A 3-hydroxyanthranilate-3,4-dioxygenase from Cupriavidus metallidurans' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5V28 _struct_keywords.text 'HAO Kynurenine Cupin Dioxygenase, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code 3HAO_CUPMC _struct_ref.pdbx_db_accession Q1LCS4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERAD LKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKR RCPHCGQVHPGRAA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5V28 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 28 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 201 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q1LCS4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 174 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 174 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5V28 MET A 1 ? UNP Q1LCS4 ? ? 'initiating methionine' -26 1 1 5V28 GLY A 2 ? UNP Q1LCS4 ? ? 'expression tag' -25 2 1 5V28 SER A 3 ? UNP Q1LCS4 ? ? 'expression tag' -24 3 1 5V28 SER A 4 ? UNP Q1LCS4 ? ? 'expression tag' -23 4 1 5V28 HIS A 5 ? UNP Q1LCS4 ? ? 'expression tag' -22 5 1 5V28 HIS A 6 ? UNP Q1LCS4 ? ? 'expression tag' -21 6 1 5V28 HIS A 7 ? UNP Q1LCS4 ? ? 'expression tag' -20 7 1 5V28 HIS A 8 ? UNP Q1LCS4 ? ? 'expression tag' -19 8 1 5V28 HIS A 9 ? UNP Q1LCS4 ? ? 'expression tag' -18 9 1 5V28 HIS A 10 ? UNP Q1LCS4 ? ? 'expression tag' -17 10 1 5V28 SER A 11 ? UNP Q1LCS4 ? ? 'expression tag' -16 11 1 5V28 SER A 12 ? UNP Q1LCS4 ? ? 'expression tag' -15 12 1 5V28 GLY A 13 ? UNP Q1LCS4 ? ? 'expression tag' -14 13 1 5V28 LEU A 14 ? UNP Q1LCS4 ? ? 'expression tag' -13 14 1 5V28 VAL A 15 ? UNP Q1LCS4 ? ? 'expression tag' -12 15 1 5V28 PRO A 16 ? UNP Q1LCS4 ? ? 'expression tag' -11 16 1 5V28 ARG A 17 ? UNP Q1LCS4 ? ? 'expression tag' -10 17 1 5V28 GLY A 18 ? UNP Q1LCS4 ? ? 'expression tag' -9 18 1 5V28 SER A 19 ? UNP Q1LCS4 ? ? 'expression tag' -8 19 1 5V28 GLU A 20 ? UNP Q1LCS4 ? ? 'expression tag' -7 20 1 5V28 ASN A 21 ? UNP Q1LCS4 ? ? 'expression tag' -6 21 1 5V28 LEU A 22 ? UNP Q1LCS4 ? ? 'expression tag' -5 22 1 5V28 TYR A 23 ? UNP Q1LCS4 ? ? 'expression tag' -4 23 1 5V28 PHE A 24 ? UNP Q1LCS4 ? ? 'expression tag' -3 24 1 5V28 GLN A 25 ? UNP Q1LCS4 ? ? 'expression tag' -2 25 1 5V28 GLY A 26 ? UNP Q1LCS4 ? ? 'expression tag' -1 26 1 5V28 HIS A 27 ? UNP Q1LCS4 ? ? 'expression tag' 0 27 1 5V28 ALA A 124 ? UNP Q1LCS4 PRO 97 'engineered mutation' 97 28 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 36 ? HIS A 44 ? ASN A 9 HIS A 17 1 ? 9 HELX_P HELX_P2 AA2 LEU A 173 ? ALA A 182 ? LEU A 146 ALA A 155 1 ? 10 HELX_P HELX_P3 AA3 SER A 183 ? ARG A 188 ? SER A 156 ARG A 161 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 78 ND1 ? ? ? 1_555 B FE2 . FE ? ? A HIS 51 A FE2 201 1_555 ? ? ? ? ? ? ? 2.099 ? ? metalc2 metalc ? ? A GLU 84 OE1 ? ? ? 1_555 B FE2 . FE ? ? A GLU 57 A FE2 201 1_555 ? ? ? ? ? ? ? 1.988 ? ? metalc3 metalc ? ? A GLU 84 OE2 ? ? ? 1_555 B FE2 . FE ? ? A GLU 57 A FE2 201 1_555 ? ? ? ? ? ? ? 2.621 ? ? metalc4 metalc ? ? A HIS 122 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 95 A FE2 201 1_555 ? ? ? ? ? ? ? 2.235 ? ? metalc5 metalc ? ? A CYS 152 SG ? ? ? 1_555 C FE2 . FE ? ? A CYS 125 A FE2 202 1_555 ? ? ? ? ? ? ? 2.567 ? ? metalc6 metalc ? ? A CYS 155 SG ? ? ? 1_555 C FE2 . FE ? ? A CYS 128 A FE2 202 1_555 ? ? ? ? ? ? ? 2.100 ? ? metalc7 metalc ? ? A CYS 189 SG ? ? ? 1_555 C FE2 . FE ? ? A CYS 162 A FE2 202 1_555 ? ? ? ? ? ? ? 2.471 ? ? metalc8 metalc ? ? A CYS 192 SG ? ? ? 1_555 C FE2 . FE ? ? A CYS 165 A FE2 202 1_555 ? ? ? ? ? ? ? 2.256 ? ? metalc9 metalc ? ? B FE2 . FE ? ? ? 1_555 E HOH . O ? ? A FE2 201 A HOH 309 1_555 ? ? ? ? ? ? ? 2.194 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 78 ? A HIS 51 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 OE1 ? A GLU 84 ? A GLU 57 ? 1_555 88.8 ? 2 ND1 ? A HIS 78 ? A HIS 51 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 OE2 ? A GLU 84 ? A GLU 57 ? 1_555 142.9 ? 3 OE1 ? A GLU 84 ? A GLU 57 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 OE2 ? A GLU 84 ? A GLU 57 ? 1_555 54.4 ? 4 ND1 ? A HIS 78 ? A HIS 51 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 NE2 ? A HIS 122 ? A HIS 95 ? 1_555 96.0 ? 5 OE1 ? A GLU 84 ? A GLU 57 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 NE2 ? A HIS 122 ? A HIS 95 ? 1_555 77.6 ? 6 OE2 ? A GLU 84 ? A GLU 57 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 NE2 ? A HIS 122 ? A HIS 95 ? 1_555 82.0 ? 7 ND1 ? A HIS 78 ? A HIS 51 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O ? E HOH . ? A HOH 309 ? 1_555 119.6 ? 8 OE1 ? A GLU 84 ? A GLU 57 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O ? E HOH . ? A HOH 309 ? 1_555 122.9 ? 9 OE2 ? A GLU 84 ? A GLU 57 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O ? E HOH . ? A HOH 309 ? 1_555 82.7 ? 10 NE2 ? A HIS 122 ? A HIS 95 ? 1_555 FE ? B FE2 . ? A FE2 201 ? 1_555 O ? E HOH . ? A HOH 309 ? 1_555 137.0 ? 11 SG ? A CYS 152 ? A CYS 125 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 SG ? A CYS 155 ? A CYS 128 ? 1_555 136.5 ? 12 SG ? A CYS 152 ? A CYS 125 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 SG ? A CYS 189 ? A CYS 162 ? 1_555 108.8 ? 13 SG ? A CYS 155 ? A CYS 128 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 SG ? A CYS 189 ? A CYS 162 ? 1_555 90.1 ? 14 SG ? A CYS 152 ? A CYS 125 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 SG ? A CYS 192 ? A CYS 165 ? 1_555 101.7 ? 15 SG ? A CYS 155 ? A CYS 128 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 SG ? A CYS 192 ? A CYS 165 ? 1_555 115.4 ? 16 SG ? A CYS 189 ? A CYS 162 ? 1_555 FE ? C FE2 . ? A FE2 202 ? 1_555 SG ? A CYS 192 ? A CYS 165 ? 1_555 95.6 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 50 A . ? PRO 23 A PRO 51 A ? PRO 24 A 1 4.61 2 GLY 70 A . ? GLY 43 A PRO 71 A ? PRO 44 A 1 0.45 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 3 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASN A 54 ? GLN A 56 ? ASN A 27 GLN A 29 AA1 2 PHE A 63 ? VAL A 68 ? PHE A 36 VAL A 41 AA1 3 ALA A 132 ? ARG A 138 ? ALA A 105 ARG A 111 AA1 4 GLU A 84 ? ARG A 90 ? GLU A 57 ARG A 63 AA1 5 ILE A 113 ? LEU A 116 ? ILE A 86 LEU A 89 AA2 1 TYR A 77 ? ASP A 79 ? TYR A 50 ASP A 52 AA2 2 ASP A 146 ? TYR A 151 ? ASP A 119 TYR A 124 AA2 3 LEU A 158 ? VAL A 164 ? LEU A 131 VAL A 137 AA3 1 ARG A 105 ? LEU A 108 ? ARG A 78 LEU A 81 AA3 2 ALA A 93 ? LEU A 97 ? ALA A 66 LEU A 70 AA3 3 HIS A 122 ? GLN A 125 ? HIS A 95 GLN A 98 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 55 ? N ARG A 28 O VAL A 67 ? O VAL A 40 AA1 2 3 N ILE A 64 ? N ILE A 37 O GLU A 137 ? O GLU A 110 AA1 3 4 O LEU A 134 ? O LEU A 107 N TYR A 87 ? N TYR A 60 AA1 4 5 N GLU A 84 ? N GLU A 57 O LEU A 116 ? O LEU A 89 AA2 1 2 N TYR A 77 ? N TYR A 50 O GLU A 149 ? O GLU A 122 AA2 2 3 N ASP A 146 ? N ASP A 119 O VAL A 164 ? O VAL A 137 AA3 1 2 O ALA A 106 ? O ALA A 79 N LEU A 95 ? N LEU A 68 AA3 2 3 N TYR A 94 ? N TYR A 67 O GLN A 125 ? O GLN A 98 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A FE2 201 ? 4 'binding site for residue FE2 A 201' AC2 Software A FE2 202 ? 4 'binding site for residue FE2 A 202' AC3 Software A TRS 203 ? 5 'binding site for residue TRS A 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 78 ? HIS A 51 . ? 1_555 ? 2 AC1 4 GLU A 84 ? GLU A 57 . ? 1_555 ? 3 AC1 4 HIS A 122 ? HIS A 95 . ? 1_555 ? 4 AC1 4 HOH E . ? HOH A 309 . ? 1_555 ? 5 AC2 4 CYS A 152 ? CYS A 125 . ? 1_555 ? 6 AC2 4 CYS A 155 ? CYS A 128 . ? 1_555 ? 7 AC2 4 CYS A 189 ? CYS A 162 . ? 1_555 ? 8 AC2 4 CYS A 192 ? CYS A 165 . ? 1_555 ? 9 AC3 5 VAL A 159 ? VAL A 132 . ? 1_555 ? 10 AC3 5 HIS A 160 ? HIS A 133 . ? 1_555 ? 11 AC3 5 ASP A 185 ? ASP A 158 . ? 1_555 ? 12 AC3 5 LYS A 186 ? LYS A 159 . ? 1_555 ? 13 AC3 5 ARG A 188 ? ARG A 161 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 309 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 310 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 25 ? ? -62.17 -72.44 2 1 ASN A 45 ? ? -172.54 114.68 3 1 ASP A 73 ? ? 36.98 53.16 4 1 LEU A 81 ? ? -105.87 72.18 5 1 HIS A 92 ? ? 59.62 2.45 6 1 ALA A 115 ? ? -36.39 125.53 7 1 ALA A 127 ? ? -104.39 -66.55 8 1 LYS A 140 ? ? -121.87 -66.90 9 1 HIS A 164 ? ? -143.44 -42.52 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -26 ? A MET 1 2 1 Y 1 A GLY -25 ? A GLY 2 3 1 Y 1 A SER -24 ? A SER 3 4 1 Y 1 A SER -23 ? A SER 4 5 1 Y 1 A HIS -22 ? A HIS 5 6 1 Y 1 A HIS -21 ? A HIS 6 7 1 Y 1 A HIS -20 ? A HIS 7 8 1 Y 1 A HIS -19 ? A HIS 8 9 1 Y 1 A HIS -18 ? A HIS 9 10 1 Y 1 A HIS -17 ? A HIS 10 11 1 Y 1 A SER -16 ? A SER 11 12 1 Y 1 A SER -15 ? A SER 12 13 1 Y 1 A GLY -14 ? A GLY 13 14 1 Y 1 A LEU -13 ? A LEU 14 15 1 Y 1 A VAL -12 ? A VAL 15 16 1 Y 1 A PRO -11 ? A PRO 16 17 1 Y 1 A ARG -10 ? A ARG 17 18 1 Y 1 A GLY -9 ? A GLY 18 19 1 Y 1 A SER -8 ? A SER 19 20 1 Y 1 A GLU -7 ? A GLU 20 21 1 Y 1 A ASN -6 ? A ASN 21 22 1 Y 1 A LEU -5 ? A LEU 22 23 1 Y 1 A TYR -4 ? A TYR 23 24 1 Y 1 A PHE -3 ? A PHE 24 25 1 Y 1 A GLN -2 ? A GLN 25 26 1 Y 1 A GLY -1 ? A GLY 26 27 1 Y 1 A HIS 0 ? A HIS 27 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FE2 FE FE N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TRS C C N N 349 TRS C1 C N N 350 TRS C2 C N N 351 TRS C3 C N N 352 TRS N N N N 353 TRS O1 O N N 354 TRS O2 O N N 355 TRS O3 O N N 356 TRS H11 H N N 357 TRS H12 H N N 358 TRS H21 H N N 359 TRS H22 H N N 360 TRS H31 H N N 361 TRS H32 H N N 362 TRS HN1 H N N 363 TRS HN2 H N N 364 TRS HN3 H N N 365 TRS HO1 H N N 366 TRS HO2 H N N 367 TRS HO3 H N N 368 TYR N N N N 369 TYR CA C N S 370 TYR C C N N 371 TYR O O N N 372 TYR CB C N N 373 TYR CG C Y N 374 TYR CD1 C Y N 375 TYR CD2 C Y N 376 TYR CE1 C Y N 377 TYR CE2 C Y N 378 TYR CZ C Y N 379 TYR OH O N N 380 TYR OXT O N N 381 TYR H H N N 382 TYR H2 H N N 383 TYR HA H N N 384 TYR HB2 H N N 385 TYR HB3 H N N 386 TYR HD1 H N N 387 TYR HD2 H N N 388 TYR HE1 H N N 389 TYR HE2 H N N 390 TYR HH H N N 391 TYR HXT H N N 392 VAL N N N N 393 VAL CA C N S 394 VAL C C N N 395 VAL O O N N 396 VAL CB C N N 397 VAL CG1 C N N 398 VAL CG2 C N N 399 VAL OXT O N N 400 VAL H H N N 401 VAL H2 H N N 402 VAL HA H N N 403 VAL HB H N N 404 VAL HG11 H N N 405 VAL HG12 H N N 406 VAL HG13 H N N 407 VAL HG21 H N N 408 VAL HG22 H N N 409 VAL HG23 H N N 410 VAL HXT H N N 411 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TRS C C1 sing N N 334 TRS C C2 sing N N 335 TRS C C3 sing N N 336 TRS C N sing N N 337 TRS C1 O1 sing N N 338 TRS C1 H11 sing N N 339 TRS C1 H12 sing N N 340 TRS C2 O2 sing N N 341 TRS C2 H21 sing N N 342 TRS C2 H22 sing N N 343 TRS C3 O3 sing N N 344 TRS C3 H31 sing N N 345 TRS C3 H32 sing N N 346 TRS N HN1 sing N N 347 TRS N HN2 sing N N 348 TRS N HN3 sing N N 349 TRS O1 HO1 sing N N 350 TRS O2 HO2 sing N N 351 TRS O3 HO3 sing N N 352 TYR N CA sing N N 353 TYR N H sing N N 354 TYR N H2 sing N N 355 TYR CA C sing N N 356 TYR CA CB sing N N 357 TYR CA HA sing N N 358 TYR C O doub N N 359 TYR C OXT sing N N 360 TYR CB CG sing N N 361 TYR CB HB2 sing N N 362 TYR CB HB3 sing N N 363 TYR CG CD1 doub Y N 364 TYR CG CD2 sing Y N 365 TYR CD1 CE1 sing Y N 366 TYR CD1 HD1 sing N N 367 TYR CD2 CE2 doub Y N 368 TYR CD2 HD2 sing N N 369 TYR CE1 CZ doub Y N 370 TYR CE1 HE1 sing N N 371 TYR CE2 CZ sing Y N 372 TYR CE2 HE2 sing N N 373 TYR CZ OH sing N N 374 TYR OH HH sing N N 375 TYR OXT HXT sing N N 376 VAL N CA sing N N 377 VAL N H sing N N 378 VAL N H2 sing N N 379 VAL CA C sing N N 380 VAL CA CB sing N N 381 VAL CA HA sing N N 382 VAL C O doub N N 383 VAL C OXT sing N N 384 VAL CB CG1 sing N N 385 VAL CB CG2 sing N N 386 VAL CB HB sing N N 387 VAL CG1 HG11 sing N N 388 VAL CG1 HG12 sing N N 389 VAL CG1 HG13 sing N N 390 VAL CG2 HG21 sing N N 391 VAL CG2 HG22 sing N N 392 VAL CG2 HG23 sing N N 393 VAL OXT HXT sing N N 394 # _pdbx_audit_support.country 'United States' _pdbx_audit_support.funding_organization 'National Science Foundation (NSF, United States)' _pdbx_audit_support.grant_number CHE-1623856 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 5V28 _atom_sites.fract_transf_matrix[1][1] 0.017064 _atom_sites.fract_transf_matrix[1][2] 0.009852 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019704 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004319 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C FE H N O S # loop_