data_5VWC # _entry.id 5VWC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5VWC pdb_00005vwc 10.2210/pdb5vwc/pdb WWPDB D_1000228039 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 2W4F _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5VWC _pdbx_database_status.recvd_initial_deposition_date 2017-05-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lim, K.Y.B.' 1 ? 'Kvansakul, M.' 2 0000-0003-2639-2498 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Biol. Chem.' _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 292 _citation.language ? _citation.page_first 20425 _citation.page_last 20436 _citation.title 'Structural basis for the differential interaction of Scribble PDZ domains with the guanine nucleotide exchange factor beta-PIX.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.M117.799452 _citation.pdbx_database_id_PubMed 29061852 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lim, K.Y.B.' 1 ? primary 'Godde, N.J.' 2 ? primary 'Humbert, P.O.' 3 ? primary 'Kvansakul, M.' 4 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5VWC _cell.details ? _cell.formula_units_Z ? _cell.length_a 35.490 _cell.length_a_esd ? _cell.length_b 41.693 _cell.length_b_esd ? _cell.length_c 51.570 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5VWC _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein scribble homolog' 10539.828 1 ? ? 'UNP Residues 725-815' ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 3 ? ? ? ? 3 water nat water 18.015 48 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'hScrib,Protein LAP4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSMEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVE ALRGAGTAVQMRVWRERETSV ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSMEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVE ALRGAGTAVQMRVWRERETSV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 GLU n 1 8 GLU n 1 9 LEU n 1 10 THR n 1 11 LEU n 1 12 THR n 1 13 ILE n 1 14 LEU n 1 15 ARG n 1 16 GLN n 1 17 THR n 1 18 GLY n 1 19 GLY n 1 20 LEU n 1 21 GLY n 1 22 ILE n 1 23 SER n 1 24 ILE n 1 25 ALA n 1 26 GLY n 1 27 GLY n 1 28 LYS n 1 29 GLY n 1 30 SER n 1 31 THR n 1 32 PRO n 1 33 TYR n 1 34 LYS n 1 35 GLY n 1 36 ASP n 1 37 ASP n 1 38 GLU n 1 39 GLY n 1 40 ILE n 1 41 PHE n 1 42 ILE n 1 43 SER n 1 44 ARG n 1 45 VAL n 1 46 SER n 1 47 GLU n 1 48 GLU n 1 49 GLY n 1 50 PRO n 1 51 ALA n 1 52 ALA n 1 53 ARG n 1 54 ALA n 1 55 GLY n 1 56 VAL n 1 57 ARG n 1 58 VAL n 1 59 GLY n 1 60 ASP n 1 61 LYS n 1 62 LEU n 1 63 LEU n 1 64 GLU n 1 65 VAL n 1 66 ASN n 1 67 GLY n 1 68 VAL n 1 69 ALA n 1 70 LEU n 1 71 GLN n 1 72 GLY n 1 73 ALA n 1 74 GLU n 1 75 HIS n 1 76 HIS n 1 77 GLU n 1 78 ALA n 1 79 VAL n 1 80 GLU n 1 81 ALA n 1 82 LEU n 1 83 ARG n 1 84 GLY n 1 85 ALA n 1 86 GLY n 1 87 THR n 1 88 ALA n 1 89 VAL n 1 90 GLN n 1 91 MET n 1 92 ARG n 1 93 VAL n 1 94 TRP n 1 95 ARG n 1 96 GLU n 1 97 ARG n 1 98 GLU n 1 99 THR n 1 100 SER n 1 101 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 101 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SCRIB, CRIB1, KIAA0147, LAP4, SCRB1, VARTUL' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli K-12' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 83333 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SCRIB_HUMAN _struct_ref.pdbx_db_accession Q14160 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAG TAVQMRVWRER ; _struct_ref.pdbx_align_begin 725 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5VWC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 97 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14160 _struct_ref_seq.db_align_beg 725 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 815 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 725 _struct_ref_seq.pdbx_auth_seq_align_end 815 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5VWC GLY A 1 ? UNP Q14160 ? ? 'expression tag' 719 1 1 5VWC PRO A 2 ? UNP Q14160 ? ? 'expression tag' 720 2 1 5VWC LEU A 3 ? UNP Q14160 ? ? 'expression tag' 721 3 1 5VWC GLY A 4 ? UNP Q14160 ? ? 'expression tag' 722 4 1 5VWC SER A 5 ? UNP Q14160 ? ? 'expression tag' 723 5 1 5VWC MET A 6 ? UNP Q14160 ? ? 'expression tag' 724 6 1 5VWC GLU A 98 ? UNP Q14160 ? ? 'expression tag' 816 7 1 5VWC THR A 99 ? UNP Q14160 ? ? 'expression tag' 817 8 1 5VWC SER A 100 ? UNP Q14160 ? ? 'expression tag' 818 9 1 5VWC VAL A 101 ? UNP Q14160 ? ? 'expression tag' 819 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5VWC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.81 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 32.2 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% (w/v) polyethylene glycol 3350, 0.2M magnesium chloride hexahydrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-07-20 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9537 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9537 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX1 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5VWC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.91 _reflns.d_resolution_low 41.69 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6245 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.7 _reflns.pdbx_Rmerge_I_obs 0.076 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.91 _reflns_shell.d_res_low 1.95 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.5 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2229 _reflns_shell.percent_possible_all 95.6 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.425 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.856 _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5VWC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.911 _refine.ls_d_res_low 32.422 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6245 _refine.ls_number_reflns_R_free 296 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.22 _refine.ls_percent_reflns_R_free 4.74 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1970 _refine.ls_R_factor_R_free 0.2268 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1954 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2W4F _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 16.33 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.15 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 703 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.number_atoms_solvent 48 _refine_hist.number_atoms_total 763 _refine_hist.d_res_high 1.911 _refine_hist.d_res_low 32.422 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 726 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.923 ? 974 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 17.593 ? 433 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.059 ? 110 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 130 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.9106 2.4071 . . 132 2922 99.00 . . . 0.2410 . 0.2003 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4071 32.4270 . . 164 3027 99.00 . . . 0.2225 . 0.1933 . . . . . . . . . . # _struct.entry_id 5VWC _struct.title 'Crystal structure of human Scribble PDZ1 domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5VWC _struct_keywords.text 'PDZ, LAP, Scribble, polarity, STRUCTURAL PROTEIN' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 49 ? GLY A 55 ? GLY A 767 GLY A 773 1 ? 7 HELX_P HELX_P2 AA2 GLU A 74 ? GLY A 84 ? GLU A 792 GLY A 802 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 8 ? LEU A 14 ? GLU A 726 LEU A 732 AA1 2 ALA A 88 ? TRP A 94 ? ALA A 806 TRP A 812 AA1 3 LYS A 61 ? VAL A 65 ? LYS A 779 VAL A 783 AA1 4 VAL A 68 ? ALA A 69 ? VAL A 786 ALA A 787 AA2 1 ILE A 22 ? GLY A 26 ? ILE A 740 GLY A 744 AA2 2 ILE A 40 ? VAL A 45 ? ILE A 758 VAL A 763 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 11 ? N LEU A 729 O MET A 91 ? O MET A 809 AA1 2 3 O ARG A 92 ? O ARG A 810 N LEU A 63 ? N LEU A 781 AA1 3 4 N VAL A 65 ? N VAL A 783 O VAL A 68 ? O VAL A 786 AA2 1 2 N ALA A 25 ? N ALA A 743 O PHE A 41 ? O PHE A 759 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A EDO 901 ? 4 'binding site for residue EDO A 901' AC2 Software A EDO 902 ? 5 'binding site for residue EDO A 902' AC3 Software A EDO 903 ? 5 'binding site for residue EDO A 903' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLY A 35 ? GLY A 753 . ? 3_555 ? 2 AC1 4 ARG A 53 ? ARG A 771 . ? 3_455 ? 3 AC1 4 GLU A 80 ? GLU A 798 . ? 1_555 ? 4 AC1 4 ARG A 83 ? ARG A 801 . ? 1_555 ? 5 AC2 5 HIS A 75 ? HIS A 793 . ? 1_555 ? 6 AC2 5 HIS A 76 ? HIS A 794 . ? 1_555 ? 7 AC2 5 VAL A 79 ? VAL A 797 . ? 1_555 ? 8 AC2 5 HOH E . ? HOH A 1007 . ? 1_555 ? 9 AC2 5 HOH E . ? HOH A 1009 . ? 1_555 ? 10 AC3 5 GLU A 7 ? GLU A 725 . ? 1_555 ? 11 AC3 5 ASN A 66 ? ASN A 784 . ? 4_545 ? 12 AC3 5 GLY A 67 ? GLY A 785 . ? 4_545 ? 13 AC3 5 TRP A 94 ? TRP A 812 . ? 1_555 ? 14 AC3 5 GLU A 98 ? GLU A 816 . ? 1_555 ? # _atom_sites.entry_id 5VWC _atom_sites.fract_transf_matrix[1][1] 0.028177 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023985 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019391 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 719 ? ? ? A . n A 1 2 PRO 2 720 ? ? ? A . n A 1 3 LEU 3 721 ? ? ? A . n A 1 4 GLY 4 722 ? ? ? A . n A 1 5 SER 5 723 ? ? ? A . n A 1 6 MET 6 724 724 MET ALA A . n A 1 7 GLU 7 725 725 GLU GLU A . n A 1 8 GLU 8 726 726 GLU GLU A . n A 1 9 LEU 9 727 727 LEU LEU A . n A 1 10 THR 10 728 728 THR THR A . n A 1 11 LEU 11 729 729 LEU LEU A . n A 1 12 THR 12 730 730 THR THR A . n A 1 13 ILE 13 731 731 ILE ILE A . n A 1 14 LEU 14 732 732 LEU LEU A . n A 1 15 ARG 15 733 733 ARG ARG A . n A 1 16 GLN 16 734 734 GLN GLN A . n A 1 17 THR 17 735 735 THR THR A . n A 1 18 GLY 18 736 736 GLY GLY A . n A 1 19 GLY 19 737 737 GLY GLY A . n A 1 20 LEU 20 738 738 LEU LEU A . n A 1 21 GLY 21 739 739 GLY GLY A . n A 1 22 ILE 22 740 740 ILE ILE A . n A 1 23 SER 23 741 741 SER SER A . n A 1 24 ILE 24 742 742 ILE ILE A . n A 1 25 ALA 25 743 743 ALA ALA A . n A 1 26 GLY 26 744 744 GLY GLY A . n A 1 27 GLY 27 745 745 GLY GLY A . n A 1 28 LYS 28 746 746 LYS LYS A . n A 1 29 GLY 29 747 747 GLY GLY A . n A 1 30 SER 30 748 748 SER SER A . n A 1 31 THR 31 749 749 THR THR A . n A 1 32 PRO 32 750 750 PRO PRO A . n A 1 33 TYR 33 751 751 TYR TYR A . n A 1 34 LYS 34 752 752 LYS LYS A . n A 1 35 GLY 35 753 753 GLY GLY A . n A 1 36 ASP 36 754 754 ASP ASP A . n A 1 37 ASP 37 755 755 ASP ASP A . n A 1 38 GLU 38 756 756 GLU GLU A . n A 1 39 GLY 39 757 757 GLY GLY A . n A 1 40 ILE 40 758 758 ILE ILE A . n A 1 41 PHE 41 759 759 PHE PHE A . n A 1 42 ILE 42 760 760 ILE ILE A . n A 1 43 SER 43 761 761 SER SER A . n A 1 44 ARG 44 762 762 ARG ARG A . n A 1 45 VAL 45 763 763 VAL VAL A . n A 1 46 SER 46 764 764 SER SER A . n A 1 47 GLU 47 765 765 GLU GLU A . n A 1 48 GLU 48 766 766 GLU GLU A . n A 1 49 GLY 49 767 767 GLY GLY A . n A 1 50 PRO 50 768 768 PRO PRO A . n A 1 51 ALA 51 769 769 ALA ALA A . n A 1 52 ALA 52 770 770 ALA ALA A . n A 1 53 ARG 53 771 771 ARG ARG A . n A 1 54 ALA 54 772 772 ALA ALA A . n A 1 55 GLY 55 773 773 GLY GLY A . n A 1 56 VAL 56 774 774 VAL VAL A . n A 1 57 ARG 57 775 775 ARG ARG A . n A 1 58 VAL 58 776 776 VAL VAL A . n A 1 59 GLY 59 777 777 GLY GLY A . n A 1 60 ASP 60 778 778 ASP ASP A . n A 1 61 LYS 61 779 779 LYS LYS A . n A 1 62 LEU 62 780 780 LEU LEU A . n A 1 63 LEU 63 781 781 LEU LEU A . n A 1 64 GLU 64 782 782 GLU GLU A . n A 1 65 VAL 65 783 783 VAL VAL A . n A 1 66 ASN 66 784 784 ASN ASN A . n A 1 67 GLY 67 785 785 GLY GLY A . n A 1 68 VAL 68 786 786 VAL VAL A . n A 1 69 ALA 69 787 787 ALA ALA A . n A 1 70 LEU 70 788 788 LEU LEU A . n A 1 71 GLN 71 789 789 GLN GLN A . n A 1 72 GLY 72 790 790 GLY GLY A . n A 1 73 ALA 73 791 791 ALA ALA A . n A 1 74 GLU 74 792 792 GLU GLU A . n A 1 75 HIS 75 793 793 HIS HIS A . n A 1 76 HIS 76 794 794 HIS HIS A . n A 1 77 GLU 77 795 795 GLU GLU A . n A 1 78 ALA 78 796 796 ALA ALA A . n A 1 79 VAL 79 797 797 VAL VAL A . n A 1 80 GLU 80 798 798 GLU GLU A . n A 1 81 ALA 81 799 799 ALA ALA A . n A 1 82 LEU 82 800 800 LEU LEU A . n A 1 83 ARG 83 801 801 ARG ARG A . n A 1 84 GLY 84 802 802 GLY GLY A . n A 1 85 ALA 85 803 803 ALA ALA A . n A 1 86 GLY 86 804 804 GLY GLY A . n A 1 87 THR 87 805 805 THR THR A . n A 1 88 ALA 88 806 806 ALA ALA A . n A 1 89 VAL 89 807 807 VAL VAL A . n A 1 90 GLN 90 808 808 GLN GLN A . n A 1 91 MET 91 809 809 MET MET A . n A 1 92 ARG 92 810 810 ARG ARG A . n A 1 93 VAL 93 811 811 VAL VAL A . n A 1 94 TRP 94 812 812 TRP TRP A . n A 1 95 ARG 95 813 813 ARG ARG A . n A 1 96 GLU 96 814 814 GLU GLU A . n A 1 97 ARG 97 815 815 ARG ARG A . n A 1 98 GLU 98 816 816 GLU GLU A . n A 1 99 THR 99 817 817 THR THR A . n A 1 100 SER 100 818 818 SER SER A . n A 1 101 VAL 101 819 819 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 901 1 EDO EDO A . C 2 EDO 1 902 2 EDO EDO A . D 2 EDO 1 903 3 EDO EDO A . E 3 HOH 1 1001 23 HOH HOH A . E 3 HOH 2 1002 15 HOH HOH A . E 3 HOH 3 1003 39 HOH HOH A . E 3 HOH 4 1004 44 HOH HOH A . E 3 HOH 5 1005 43 HOH HOH A . E 3 HOH 6 1006 41 HOH HOH A . E 3 HOH 7 1007 51 HOH HOH A . E 3 HOH 8 1008 46 HOH HOH A . E 3 HOH 9 1009 5 HOH HOH A . E 3 HOH 10 1010 37 HOH HOH A . E 3 HOH 11 1011 11 HOH HOH A . E 3 HOH 12 1012 18 HOH HOH A . E 3 HOH 13 1013 17 HOH HOH A . E 3 HOH 14 1014 42 HOH HOH A . E 3 HOH 15 1015 3 HOH HOH A . E 3 HOH 16 1016 40 HOH HOH A . E 3 HOH 17 1017 1 HOH HOH A . E 3 HOH 18 1018 48 HOH HOH A . E 3 HOH 19 1019 10 HOH HOH A . E 3 HOH 20 1020 8 HOH HOH A . E 3 HOH 21 1021 12 HOH HOH A . E 3 HOH 22 1022 30 HOH HOH A . E 3 HOH 23 1023 14 HOH HOH A . E 3 HOH 24 1024 2 HOH HOH A . E 3 HOH 25 1025 28 HOH HOH A . E 3 HOH 26 1026 9 HOH HOH A . E 3 HOH 27 1027 22 HOH HOH A . E 3 HOH 28 1028 20 HOH HOH A . E 3 HOH 29 1029 21 HOH HOH A . E 3 HOH 30 1030 31 HOH HOH A . E 3 HOH 31 1031 49 HOH HOH A . E 3 HOH 32 1032 7 HOH HOH A . E 3 HOH 33 1033 4 HOH HOH A . E 3 HOH 34 1034 35 HOH HOH A . E 3 HOH 35 1035 24 HOH HOH A . E 3 HOH 36 1036 52 HOH HOH A . E 3 HOH 37 1037 50 HOH HOH A . E 3 HOH 38 1038 34 HOH HOH A . E 3 HOH 39 1039 45 HOH HOH A . E 3 HOH 40 1040 25 HOH HOH A . E 3 HOH 41 1041 33 HOH HOH A . E 3 HOH 42 1042 13 HOH HOH A . E 3 HOH 43 1043 19 HOH HOH A . E 3 HOH 44 1044 26 HOH HOH A . E 3 HOH 45 1045 32 HOH HOH A . E 3 HOH 46 1046 47 HOH HOH A . E 3 HOH 47 1047 29 HOH HOH A . E 3 HOH 48 1048 36 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 470 ? 1 MORE 5 ? 1 'SSA (A^2)' 5800 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-11-08 2 'Structure model' 1 1 2017-12-27 3 'Structure model' 1 2 2020-01-01 4 'Structure model' 1 3 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' pdbx_audit_support 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_pdbx_audit_support.funding_organization' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -12.2659 -12.9378 3.3037 0.1653 0.1363 0.1919 -0.0044 -0.1012 -0.1563 0.1224 0.3148 0.3414 0.1680 -0.1570 -0.3194 0.2410 0.0661 0.0979 -0.0015 0.2659 0.3733 0.0776 -0.1948 0.1261 'X-RAY DIFFRACTION' 2 ? refined -2.5949 -4.4644 11.6333 0.1314 0.1367 0.1236 -0.0027 0.0198 -0.0278 0.0472 0.1650 0.1683 0.0744 0.1123 0.0494 -0.0827 -0.0929 -0.0718 -0.0052 -0.0761 0.0368 0.0151 -0.0789 -0.0038 'X-RAY DIFFRACTION' 3 ? refined -10.8479 -10.0437 14.7774 0.1089 0.1597 0.1241 -0.0234 0.0147 -0.0039 0.1585 0.4018 0.2832 -0.0259 0.1995 -0.1672 0.0811 -0.2794 -0.0892 0.2535 0.1736 0.3350 0.0003 -0.0009 0.1829 'X-RAY DIFFRACTION' 4 ? refined -6.8037 -10.4962 6.8797 0.1677 0.0965 0.1052 -0.0181 -0.0415 0.0123 0.2344 0.0432 0.2730 0.0509 -0.2539 -0.0530 -0.0611 -0.1732 -0.0685 -0.2467 -0.0857 0.1897 -0.1009 -0.0087 -0.1230 'X-RAY DIFFRACTION' 5 ? refined -3.9898 -0.8073 1.1151 0.1843 0.1282 0.2751 0.0243 0.0129 0.0404 0.0153 0.0088 0.0132 0.0056 -0.0026 -0.0244 -0.0110 -0.0297 0.0322 -0.0923 -0.0041 -0.0649 -0.0355 0.1202 -0.0000 'X-RAY DIFFRACTION' 6 ? refined -9.4037 -1.3377 5.9837 0.1619 0.1533 0.1489 0.0372 -0.0360 -0.0466 0.0853 0.1649 0.0065 0.0980 -0.0315 -0.0285 0.0537 0.0304 0.1617 -0.1398 -0.2884 0.3820 -0.0580 -0.1051 -0.0040 'X-RAY DIFFRACTION' 7 ? refined 1.2907 -20.8323 7.8518 0.1600 0.1396 0.1648 -0.0003 0.0024 0.0333 0.0123 0.0085 0.0025 -0.0081 0.0148 -0.0001 0.0707 0.0220 -0.0229 -0.0189 -0.0794 -0.0523 0.0128 0.0024 0.0000 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 724 through 732 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 733 through 757 ) ; 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 758 through 772 ) ; 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 773 through 783 ) ; 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 784 through 792 ) ; 'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 793 through 812 ) ; 'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 813 through 819 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HH12 A ARG 815 ? ? O A HOH 1002 ? ? 1.32 2 1 HE A ARG 733 ? ? O A GLY 804 ? ? 1.60 3 1 OE2 A GLU 725 ? ? O A HOH 1001 ? ? 1.84 4 1 NH1 A ARG 815 ? ? O A HOH 1002 ? ? 1.89 5 1 OE2 A GLU 792 ? ? O A HOH 1003 ? ? 2.15 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 724 ? CG ? A MET 6 CG 2 1 Y 1 A MET 724 ? SD ? A MET 6 SD 3 1 Y 1 A MET 724 ? CE ? A MET 6 CE 4 1 Y 1 A GLU 766 ? CG ? A GLU 48 CG 5 1 Y 1 A GLU 766 ? CD ? A GLU 48 CD 6 1 Y 1 A GLU 766 ? OE1 ? A GLU 48 OE1 7 1 Y 1 A GLU 766 ? OE2 ? A GLU 48 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 719 ? A GLY 1 2 1 Y 1 A PRO 720 ? A PRO 2 3 1 Y 1 A LEU 721 ? A LEU 3 4 1 Y 1 A GLY 722 ? A GLY 4 5 1 Y 1 A SER 723 ? A SER 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 EDO C1 C N N 74 EDO O1 O N N 75 EDO C2 C N N 76 EDO O2 O N N 77 EDO H11 H N N 78 EDO H12 H N N 79 EDO HO1 H N N 80 EDO H21 H N N 81 EDO H22 H N N 82 EDO HO2 H N N 83 GLN N N N N 84 GLN CA C N S 85 GLN C C N N 86 GLN O O N N 87 GLN CB C N N 88 GLN CG C N N 89 GLN CD C N N 90 GLN OE1 O N N 91 GLN NE2 N N N 92 GLN OXT O N N 93 GLN H H N N 94 GLN H2 H N N 95 GLN HA H N N 96 GLN HB2 H N N 97 GLN HB3 H N N 98 GLN HG2 H N N 99 GLN HG3 H N N 100 GLN HE21 H N N 101 GLN HE22 H N N 102 GLN HXT H N N 103 GLU N N N N 104 GLU CA C N S 105 GLU C C N N 106 GLU O O N N 107 GLU CB C N N 108 GLU CG C N N 109 GLU CD C N N 110 GLU OE1 O N N 111 GLU OE2 O N N 112 GLU OXT O N N 113 GLU H H N N 114 GLU H2 H N N 115 GLU HA H N N 116 GLU HB2 H N N 117 GLU HB3 H N N 118 GLU HG2 H N N 119 GLU HG3 H N N 120 GLU HE2 H N N 121 GLU HXT H N N 122 GLY N N N N 123 GLY CA C N N 124 GLY C C N N 125 GLY O O N N 126 GLY OXT O N N 127 GLY H H N N 128 GLY H2 H N N 129 GLY HA2 H N N 130 GLY HA3 H N N 131 GLY HXT H N N 132 HIS N N N N 133 HIS CA C N S 134 HIS C C N N 135 HIS O O N N 136 HIS CB C N N 137 HIS CG C Y N 138 HIS ND1 N Y N 139 HIS CD2 C Y N 140 HIS CE1 C Y N 141 HIS NE2 N Y N 142 HIS OXT O N N 143 HIS H H N N 144 HIS H2 H N N 145 HIS HA H N N 146 HIS HB2 H N N 147 HIS HB3 H N N 148 HIS HD1 H N N 149 HIS HD2 H N N 150 HIS HE1 H N N 151 HIS HE2 H N N 152 HIS HXT H N N 153 HOH O O N N 154 HOH H1 H N N 155 HOH H2 H N N 156 ILE N N N N 157 ILE CA C N S 158 ILE C C N N 159 ILE O O N N 160 ILE CB C N S 161 ILE CG1 C N N 162 ILE CG2 C N N 163 ILE CD1 C N N 164 ILE OXT O N N 165 ILE H H N N 166 ILE H2 H N N 167 ILE HA H N N 168 ILE HB H N N 169 ILE HG12 H N N 170 ILE HG13 H N N 171 ILE HG21 H N N 172 ILE HG22 H N N 173 ILE HG23 H N N 174 ILE HD11 H N N 175 ILE HD12 H N N 176 ILE HD13 H N N 177 ILE HXT H N N 178 LEU N N N N 179 LEU CA C N S 180 LEU C C N N 181 LEU O O N N 182 LEU CB C N N 183 LEU CG C N N 184 LEU CD1 C N N 185 LEU CD2 C N N 186 LEU OXT O N N 187 LEU H H N N 188 LEU H2 H N N 189 LEU HA H N N 190 LEU HB2 H N N 191 LEU HB3 H N N 192 LEU HG H N N 193 LEU HD11 H N N 194 LEU HD12 H N N 195 LEU HD13 H N N 196 LEU HD21 H N N 197 LEU HD22 H N N 198 LEU HD23 H N N 199 LEU HXT H N N 200 LYS N N N N 201 LYS CA C N S 202 LYS C C N N 203 LYS O O N N 204 LYS CB C N N 205 LYS CG C N N 206 LYS CD C N N 207 LYS CE C N N 208 LYS NZ N N N 209 LYS OXT O N N 210 LYS H H N N 211 LYS H2 H N N 212 LYS HA H N N 213 LYS HB2 H N N 214 LYS HB3 H N N 215 LYS HG2 H N N 216 LYS HG3 H N N 217 LYS HD2 H N N 218 LYS HD3 H N N 219 LYS HE2 H N N 220 LYS HE3 H N N 221 LYS HZ1 H N N 222 LYS HZ2 H N N 223 LYS HZ3 H N N 224 LYS HXT H N N 225 MET N N N N 226 MET CA C N S 227 MET C C N N 228 MET O O N N 229 MET CB C N N 230 MET CG C N N 231 MET SD S N N 232 MET CE C N N 233 MET OXT O N N 234 MET H H N N 235 MET H2 H N N 236 MET HA H N N 237 MET HB2 H N N 238 MET HB3 H N N 239 MET HG2 H N N 240 MET HG3 H N N 241 MET HE1 H N N 242 MET HE2 H N N 243 MET HE3 H N N 244 MET HXT H N N 245 PHE N N N N 246 PHE CA C N S 247 PHE C C N N 248 PHE O O N N 249 PHE CB C N N 250 PHE CG C Y N 251 PHE CD1 C Y N 252 PHE CD2 C Y N 253 PHE CE1 C Y N 254 PHE CE2 C Y N 255 PHE CZ C Y N 256 PHE OXT O N N 257 PHE H H N N 258 PHE H2 H N N 259 PHE HA H N N 260 PHE HB2 H N N 261 PHE HB3 H N N 262 PHE HD1 H N N 263 PHE HD2 H N N 264 PHE HE1 H N N 265 PHE HE2 H N N 266 PHE HZ H N N 267 PHE HXT H N N 268 PRO N N N N 269 PRO CA C N S 270 PRO C C N N 271 PRO O O N N 272 PRO CB C N N 273 PRO CG C N N 274 PRO CD C N N 275 PRO OXT O N N 276 PRO H H N N 277 PRO HA H N N 278 PRO HB2 H N N 279 PRO HB3 H N N 280 PRO HG2 H N N 281 PRO HG3 H N N 282 PRO HD2 H N N 283 PRO HD3 H N N 284 PRO HXT H N N 285 SER N N N N 286 SER CA C N S 287 SER C C N N 288 SER O O N N 289 SER CB C N N 290 SER OG O N N 291 SER OXT O N N 292 SER H H N N 293 SER H2 H N N 294 SER HA H N N 295 SER HB2 H N N 296 SER HB3 H N N 297 SER HG H N N 298 SER HXT H N N 299 THR N N N N 300 THR CA C N S 301 THR C C N N 302 THR O O N N 303 THR CB C N R 304 THR OG1 O N N 305 THR CG2 C N N 306 THR OXT O N N 307 THR H H N N 308 THR H2 H N N 309 THR HA H N N 310 THR HB H N N 311 THR HG1 H N N 312 THR HG21 H N N 313 THR HG22 H N N 314 THR HG23 H N N 315 THR HXT H N N 316 TRP N N N N 317 TRP CA C N S 318 TRP C C N N 319 TRP O O N N 320 TRP CB C N N 321 TRP CG C Y N 322 TRP CD1 C Y N 323 TRP CD2 C Y N 324 TRP NE1 N Y N 325 TRP CE2 C Y N 326 TRP CE3 C Y N 327 TRP CZ2 C Y N 328 TRP CZ3 C Y N 329 TRP CH2 C Y N 330 TRP OXT O N N 331 TRP H H N N 332 TRP H2 H N N 333 TRP HA H N N 334 TRP HB2 H N N 335 TRP HB3 H N N 336 TRP HD1 H N N 337 TRP HE1 H N N 338 TRP HE3 H N N 339 TRP HZ2 H N N 340 TRP HZ3 H N N 341 TRP HH2 H N N 342 TRP HXT H N N 343 TYR N N N N 344 TYR CA C N S 345 TYR C C N N 346 TYR O O N N 347 TYR CB C N N 348 TYR CG C Y N 349 TYR CD1 C Y N 350 TYR CD2 C Y N 351 TYR CE1 C Y N 352 TYR CE2 C Y N 353 TYR CZ C Y N 354 TYR OH O N N 355 TYR OXT O N N 356 TYR H H N N 357 TYR H2 H N N 358 TYR HA H N N 359 TYR HB2 H N N 360 TYR HB3 H N N 361 TYR HD1 H N N 362 TYR HD2 H N N 363 TYR HE1 H N N 364 TYR HE2 H N N 365 TYR HH H N N 366 TYR HXT H N N 367 VAL N N N N 368 VAL CA C N S 369 VAL C C N N 370 VAL O O N N 371 VAL CB C N N 372 VAL CG1 C N N 373 VAL CG2 C N N 374 VAL OXT O N N 375 VAL H H N N 376 VAL H2 H N N 377 VAL HA H N N 378 VAL HB H N N 379 VAL HG11 H N N 380 VAL HG12 H N N 381 VAL HG13 H N N 382 VAL HG21 H N N 383 VAL HG22 H N N 384 VAL HG23 H N N 385 VAL HXT H N N 386 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 EDO C1 O1 sing N N 70 EDO C1 C2 sing N N 71 EDO C1 H11 sing N N 72 EDO C1 H12 sing N N 73 EDO O1 HO1 sing N N 74 EDO C2 O2 sing N N 75 EDO C2 H21 sing N N 76 EDO C2 H22 sing N N 77 EDO O2 HO2 sing N N 78 GLN N CA sing N N 79 GLN N H sing N N 80 GLN N H2 sing N N 81 GLN CA C sing N N 82 GLN CA CB sing N N 83 GLN CA HA sing N N 84 GLN C O doub N N 85 GLN C OXT sing N N 86 GLN CB CG sing N N 87 GLN CB HB2 sing N N 88 GLN CB HB3 sing N N 89 GLN CG CD sing N N 90 GLN CG HG2 sing N N 91 GLN CG HG3 sing N N 92 GLN CD OE1 doub N N 93 GLN CD NE2 sing N N 94 GLN NE2 HE21 sing N N 95 GLN NE2 HE22 sing N N 96 GLN OXT HXT sing N N 97 GLU N CA sing N N 98 GLU N H sing N N 99 GLU N H2 sing N N 100 GLU CA C sing N N 101 GLU CA CB sing N N 102 GLU CA HA sing N N 103 GLU C O doub N N 104 GLU C OXT sing N N 105 GLU CB CG sing N N 106 GLU CB HB2 sing N N 107 GLU CB HB3 sing N N 108 GLU CG CD sing N N 109 GLU CG HG2 sing N N 110 GLU CG HG3 sing N N 111 GLU CD OE1 doub N N 112 GLU CD OE2 sing N N 113 GLU OE2 HE2 sing N N 114 GLU OXT HXT sing N N 115 GLY N CA sing N N 116 GLY N H sing N N 117 GLY N H2 sing N N 118 GLY CA C sing N N 119 GLY CA HA2 sing N N 120 GLY CA HA3 sing N N 121 GLY C O doub N N 122 GLY C OXT sing N N 123 GLY OXT HXT sing N N 124 HIS N CA sing N N 125 HIS N H sing N N 126 HIS N H2 sing N N 127 HIS CA C sing N N 128 HIS CA CB sing N N 129 HIS CA HA sing N N 130 HIS C O doub N N 131 HIS C OXT sing N N 132 HIS CB CG sing N N 133 HIS CB HB2 sing N N 134 HIS CB HB3 sing N N 135 HIS CG ND1 sing Y N 136 HIS CG CD2 doub Y N 137 HIS ND1 CE1 doub Y N 138 HIS ND1 HD1 sing N N 139 HIS CD2 NE2 sing Y N 140 HIS CD2 HD2 sing N N 141 HIS CE1 NE2 sing Y N 142 HIS CE1 HE1 sing N N 143 HIS NE2 HE2 sing N N 144 HIS OXT HXT sing N N 145 HOH O H1 sing N N 146 HOH O H2 sing N N 147 ILE N CA sing N N 148 ILE N H sing N N 149 ILE N H2 sing N N 150 ILE CA C sing N N 151 ILE CA CB sing N N 152 ILE CA HA sing N N 153 ILE C O doub N N 154 ILE C OXT sing N N 155 ILE CB CG1 sing N N 156 ILE CB CG2 sing N N 157 ILE CB HB sing N N 158 ILE CG1 CD1 sing N N 159 ILE CG1 HG12 sing N N 160 ILE CG1 HG13 sing N N 161 ILE CG2 HG21 sing N N 162 ILE CG2 HG22 sing N N 163 ILE CG2 HG23 sing N N 164 ILE CD1 HD11 sing N N 165 ILE CD1 HD12 sing N N 166 ILE CD1 HD13 sing N N 167 ILE OXT HXT sing N N 168 LEU N CA sing N N 169 LEU N H sing N N 170 LEU N H2 sing N N 171 LEU CA C sing N N 172 LEU CA CB sing N N 173 LEU CA HA sing N N 174 LEU C O doub N N 175 LEU C OXT sing N N 176 LEU CB CG sing N N 177 LEU CB HB2 sing N N 178 LEU CB HB3 sing N N 179 LEU CG CD1 sing N N 180 LEU CG CD2 sing N N 181 LEU CG HG sing N N 182 LEU CD1 HD11 sing N N 183 LEU CD1 HD12 sing N N 184 LEU CD1 HD13 sing N N 185 LEU CD2 HD21 sing N N 186 LEU CD2 HD22 sing N N 187 LEU CD2 HD23 sing N N 188 LEU OXT HXT sing N N 189 LYS N CA sing N N 190 LYS N H sing N N 191 LYS N H2 sing N N 192 LYS CA C sing N N 193 LYS CA CB sing N N 194 LYS CA HA sing N N 195 LYS C O doub N N 196 LYS C OXT sing N N 197 LYS CB CG sing N N 198 LYS CB HB2 sing N N 199 LYS CB HB3 sing N N 200 LYS CG CD sing N N 201 LYS CG HG2 sing N N 202 LYS CG HG3 sing N N 203 LYS CD CE sing N N 204 LYS CD HD2 sing N N 205 LYS CD HD3 sing N N 206 LYS CE NZ sing N N 207 LYS CE HE2 sing N N 208 LYS CE HE3 sing N N 209 LYS NZ HZ1 sing N N 210 LYS NZ HZ2 sing N N 211 LYS NZ HZ3 sing N N 212 LYS OXT HXT sing N N 213 MET N CA sing N N 214 MET N H sing N N 215 MET N H2 sing N N 216 MET CA C sing N N 217 MET CA CB sing N N 218 MET CA HA sing N N 219 MET C O doub N N 220 MET C OXT sing N N 221 MET CB CG sing N N 222 MET CB HB2 sing N N 223 MET CB HB3 sing N N 224 MET CG SD sing N N 225 MET CG HG2 sing N N 226 MET CG HG3 sing N N 227 MET SD CE sing N N 228 MET CE HE1 sing N N 229 MET CE HE2 sing N N 230 MET CE HE3 sing N N 231 MET OXT HXT sing N N 232 PHE N CA sing N N 233 PHE N H sing N N 234 PHE N H2 sing N N 235 PHE CA C sing N N 236 PHE CA CB sing N N 237 PHE CA HA sing N N 238 PHE C O doub N N 239 PHE C OXT sing N N 240 PHE CB CG sing N N 241 PHE CB HB2 sing N N 242 PHE CB HB3 sing N N 243 PHE CG CD1 doub Y N 244 PHE CG CD2 sing Y N 245 PHE CD1 CE1 sing Y N 246 PHE CD1 HD1 sing N N 247 PHE CD2 CE2 doub Y N 248 PHE CD2 HD2 sing N N 249 PHE CE1 CZ doub Y N 250 PHE CE1 HE1 sing N N 251 PHE CE2 CZ sing Y N 252 PHE CE2 HE2 sing N N 253 PHE CZ HZ sing N N 254 PHE OXT HXT sing N N 255 PRO N CA sing N N 256 PRO N CD sing N N 257 PRO N H sing N N 258 PRO CA C sing N N 259 PRO CA CB sing N N 260 PRO CA HA sing N N 261 PRO C O doub N N 262 PRO C OXT sing N N 263 PRO CB CG sing N N 264 PRO CB HB2 sing N N 265 PRO CB HB3 sing N N 266 PRO CG CD sing N N 267 PRO CG HG2 sing N N 268 PRO CG HG3 sing N N 269 PRO CD HD2 sing N N 270 PRO CD HD3 sing N N 271 PRO OXT HXT sing N N 272 SER N CA sing N N 273 SER N H sing N N 274 SER N H2 sing N N 275 SER CA C sing N N 276 SER CA CB sing N N 277 SER CA HA sing N N 278 SER C O doub N N 279 SER C OXT sing N N 280 SER CB OG sing N N 281 SER CB HB2 sing N N 282 SER CB HB3 sing N N 283 SER OG HG sing N N 284 SER OXT HXT sing N N 285 THR N CA sing N N 286 THR N H sing N N 287 THR N H2 sing N N 288 THR CA C sing N N 289 THR CA CB sing N N 290 THR CA HA sing N N 291 THR C O doub N N 292 THR C OXT sing N N 293 THR CB OG1 sing N N 294 THR CB CG2 sing N N 295 THR CB HB sing N N 296 THR OG1 HG1 sing N N 297 THR CG2 HG21 sing N N 298 THR CG2 HG22 sing N N 299 THR CG2 HG23 sing N N 300 THR OXT HXT sing N N 301 TRP N CA sing N N 302 TRP N H sing N N 303 TRP N H2 sing N N 304 TRP CA C sing N N 305 TRP CA CB sing N N 306 TRP CA HA sing N N 307 TRP C O doub N N 308 TRP C OXT sing N N 309 TRP CB CG sing N N 310 TRP CB HB2 sing N N 311 TRP CB HB3 sing N N 312 TRP CG CD1 doub Y N 313 TRP CG CD2 sing Y N 314 TRP CD1 NE1 sing Y N 315 TRP CD1 HD1 sing N N 316 TRP CD2 CE2 doub Y N 317 TRP CD2 CE3 sing Y N 318 TRP NE1 CE2 sing Y N 319 TRP NE1 HE1 sing N N 320 TRP CE2 CZ2 sing Y N 321 TRP CE3 CZ3 doub Y N 322 TRP CE3 HE3 sing N N 323 TRP CZ2 CH2 doub Y N 324 TRP CZ2 HZ2 sing N N 325 TRP CZ3 CH2 sing Y N 326 TRP CZ3 HZ3 sing N N 327 TRP CH2 HH2 sing N N 328 TRP OXT HXT sing N N 329 TYR N CA sing N N 330 TYR N H sing N N 331 TYR N H2 sing N N 332 TYR CA C sing N N 333 TYR CA CB sing N N 334 TYR CA HA sing N N 335 TYR C O doub N N 336 TYR C OXT sing N N 337 TYR CB CG sing N N 338 TYR CB HB2 sing N N 339 TYR CB HB3 sing N N 340 TYR CG CD1 doub Y N 341 TYR CG CD2 sing Y N 342 TYR CD1 CE1 sing Y N 343 TYR CD1 HD1 sing N N 344 TYR CD2 CE2 doub Y N 345 TYR CD2 HD2 sing N N 346 TYR CE1 CZ doub Y N 347 TYR CE1 HE1 sing N N 348 TYR CE2 CZ sing Y N 349 TYR CE2 HE2 sing N N 350 TYR CZ OH sing N N 351 TYR OH HH sing N N 352 TYR OXT HXT sing N N 353 VAL N CA sing N N 354 VAL N H sing N N 355 VAL N H2 sing N N 356 VAL CA C sing N N 357 VAL CA CB sing N N 358 VAL CA HA sing N N 359 VAL C O doub N N 360 VAL C OXT sing N N 361 VAL CB CG1 sing N N 362 VAL CB CG2 sing N N 363 VAL CB HB sing N N 364 VAL CG1 HG11 sing N N 365 VAL CG1 HG12 sing N N 366 VAL CG1 HG13 sing N N 367 VAL CG2 HG21 sing N N 368 VAL CG2 HG22 sing N N 369 VAL CG2 HG23 sing N N 370 VAL OXT HXT sing N N 371 # loop_ _pdbx_audit_support.country _pdbx_audit_support.funding_organization _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal Australia 'National Health and Medical Research Council (NHMRC, Australia)' APP1007918 1 Australia 'Australian Research Council (ARC)' FT130101349 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2W4F _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #