data_5W3R # _entry.id 5W3R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5W3R pdb_00005w3r 10.2210/pdb5w3r/pdb WWPDB D_1000228307 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5W3R _pdbx_database_status.recvd_initial_deposition_date 2017-06-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'McKercher, M.A.' 1 ? 'Wuttke, D.S.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proteins _citation.journal_id_ASTM PSFGEY _citation.journal_id_CSD 0867 _citation.journal_id_ISSN 1097-0134 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 86 _citation.language ? _citation.page_first 164 _citation.page_last 176 _citation.title 'Diversity in peptide recognition by the SH2 domain of SH2B1.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/prot.25420 _citation.pdbx_database_id_PubMed 29127727 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'McKercher, M.A.' 1 ? primary 'Guan, X.' 2 ? primary 'Tan, Z.' 3 ? primary 'Wuttke, D.S.' 4 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 5W3R _cell.details ? _cell.formula_units_Z ? _cell.length_a 29.010 _cell.length_a_esd ? _cell.length_b 52.750 _cell.length_b_esd ? _cell.length_c 60.730 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5W3R _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SH2B adapter protein 1' 12664.433 1 ? 'E583A, E584A, W593H' 'SH2 Domain (UNP residues 519-628)' ? 2 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 3 non-polymer syn PHENOL 94.111 3 ? ? ? ? 4 water nat water 18.015 115 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Pro-rich,PH and SH2 domain-containing signaling mediator,PSM,SH2 domain-containing protein 1B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMDQPLSGYPWFHGMLSRLKAAQLVLTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNAAGQCRVQHLHF QSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPSS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMDQPLSGYPWFHGMLSRLKAAQLVLTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNAAGQCRVQHLHF QSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPSS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ASP n 1 6 GLN n 1 7 PRO n 1 8 LEU n 1 9 SER n 1 10 GLY n 1 11 TYR n 1 12 PRO n 1 13 TRP n 1 14 PHE n 1 15 HIS n 1 16 GLY n 1 17 MET n 1 18 LEU n 1 19 SER n 1 20 ARG n 1 21 LEU n 1 22 LYS n 1 23 ALA n 1 24 ALA n 1 25 GLN n 1 26 LEU n 1 27 VAL n 1 28 LEU n 1 29 THR n 1 30 GLY n 1 31 GLY n 1 32 THR n 1 33 GLY n 1 34 SER n 1 35 HIS n 1 36 GLY n 1 37 VAL n 1 38 PHE n 1 39 LEU n 1 40 VAL n 1 41 ARG n 1 42 GLN n 1 43 SER n 1 44 GLU n 1 45 THR n 1 46 ARG n 1 47 ARG n 1 48 GLY n 1 49 GLU n 1 50 TYR n 1 51 VAL n 1 52 LEU n 1 53 THR n 1 54 PHE n 1 55 ASN n 1 56 PHE n 1 57 GLN n 1 58 GLY n 1 59 LYS n 1 60 ALA n 1 61 LYS n 1 62 HIS n 1 63 LEU n 1 64 ARG n 1 65 LEU n 1 66 SER n 1 67 LEU n 1 68 ASN n 1 69 ALA n 1 70 ALA n 1 71 GLY n 1 72 GLN n 1 73 CYS n 1 74 ARG n 1 75 VAL n 1 76 GLN n 1 77 HIS n 1 78 LEU n 1 79 HIS n 1 80 PHE n 1 81 GLN n 1 82 SER n 1 83 ILE n 1 84 PHE n 1 85 ASP n 1 86 MET n 1 87 LEU n 1 88 GLU n 1 89 HIS n 1 90 PHE n 1 91 ARG n 1 92 VAL n 1 93 HIS n 1 94 PRO n 1 95 ILE n 1 96 PRO n 1 97 LEU n 1 98 GLU n 1 99 SER n 1 100 GLY n 1 101 GLY n 1 102 SER n 1 103 SER n 1 104 ASP n 1 105 VAL n 1 106 VAL n 1 107 LEU n 1 108 VAL n 1 109 SER n 1 110 TYR n 1 111 VAL n 1 112 PRO n 1 113 SER n 1 114 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 114 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SH2B1, KIAA1299, SH2B' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SH2B1_HUMAN _struct_ref.pdbx_db_accession Q9NRF2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DQPLSGYPWFHGMLSRLKAAQLVLTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIF DMLEHFRVHPIPLESGGSSDVVLVSYVPSS ; _struct_ref.pdbx_align_begin 519 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5W3R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 114 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NRF2 _struct_ref_seq.db_align_beg 519 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 628 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 519 _struct_ref_seq.pdbx_auth_seq_align_end 628 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5W3R GLY A 1 ? UNP Q9NRF2 ? ? 'expression tag' 515 1 1 5W3R SER A 2 ? UNP Q9NRF2 ? ? 'expression tag' 516 2 1 5W3R HIS A 3 ? UNP Q9NRF2 ? ? 'expression tag' 517 3 1 5W3R MET A 4 ? UNP Q9NRF2 ? ? 'expression tag' 518 4 1 5W3R ALA A 69 ? UNP Q9NRF2 GLU 583 'engineered mutation' 583 5 1 5W3R ALA A 70 ? UNP Q9NRF2 GLU 584 'engineered mutation' 584 6 1 5W3R HIS A 79 ? UNP Q9NRF2 TRP 593 'engineered mutation' 593 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IPH non-polymer . PHENOL ? 'C6 H6 O' 94.111 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5W3R _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.83 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 32.95 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 3350, potassium sulfate, phenol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-03-29 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 12.070 _reflns.entry_id 5W3R _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.386 _reflns.d_resolution_low 52.750 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 19492 _reflns.number_obs 19492 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.500 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.083 _reflns.pdbx_netI_over_av_sigmaI 4.000 _reflns.pdbx_netI_over_sigmaI 14.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.091 _reflns.pdbx_Rpim_I_all 0.035 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 127670 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.390 1.460 ? 2.300 ? ? ? ? ? 98.100 ? ? ? ? 0.325 ? ? ? ? ? ? ? ? 5.900 0.325 ? ? ? 0.356 0.143 ? 1 1 ? ? 1.460 1.550 ? 3.300 ? ? ? ? ? 99.200 ? ? ? ? 0.220 ? ? ? ? ? ? ? ? 6.900 0.220 ? ? ? 0.238 0.090 ? 2 1 ? ? 1.550 1.660 ? 4.300 ? ? ? ? ? 99.500 ? ? ? ? 0.158 ? ? ? ? ? ? ? ? 6.800 0.158 ? ? ? 0.171 0.064 ? 3 1 ? ? 1.660 1.790 ? 5.400 ? ? ? ? ? 99.800 ? ? ? ? 0.121 ? ? ? ? ? ? ? ? 6.800 0.121 ? ? ? 0.131 0.050 ? 4 1 ? ? 1.790 1.960 ? 6.600 ? ? ? ? ? 99.900 ? ? ? ? 0.091 ? ? ? ? ? ? ? ? 6.800 0.091 ? ? ? 0.099 0.037 ? 5 1 ? ? 1.960 2.190 ? 7.900 ? ? ? ? ? 100.000 ? ? ? ? 0.071 ? ? ? ? ? ? ? ? 6.700 0.071 ? ? ? 0.077 0.029 ? 6 1 ? ? 2.190 2.530 ? 7.500 ? ? ? ? ? 99.900 ? ? ? ? 0.069 ? ? ? ? ? ? ? ? 6.600 0.069 ? ? ? 0.075 0.029 ? 7 1 ? ? 2.530 3.100 ? 7.300 ? ? ? ? ? 100.000 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 6.300 0.074 ? ? ? 0.081 0.032 ? 8 1 ? ? 3.100 4.380 ? 6.800 ? ? ? ? ? 100.000 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 6.100 0.078 ? ? ? 0.085 0.034 ? 9 1 ? ? 4.380 52.750 ? 7.000 ? ? ? ? ? 99.400 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 6.200 0.067 ? ? ? 0.074 0.029 ? 10 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 71.200 _refine.B_iso_mean 18.5265 _refine.B_iso_min 6.940 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5W3R _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.3860 _refine.ls_d_res_low 30.3650 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19445 _refine.ls_number_reflns_R_free 972 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.3300 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1455 _refine.ls_R_factor_R_free 0.1678 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1443 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'Solved using a previous poor-resolution unpublished structure, which, in turn, was solved using 2HDV as a model' _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 15.4700 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.3860 _refine_hist.d_res_low 30.3650 _refine_hist.pdbx_number_atoms_ligand 44 _refine_hist.number_atoms_solvent 125 _refine_hist.number_atoms_total 1054 _refine_hist.pdbx_number_residues_total 114 _refine_hist.pdbx_B_iso_mean_ligand 41.96 _refine_hist.pdbx_B_iso_mean_solvent 25.48 _refine_hist.pdbx_number_atoms_protein 885 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 956 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.975 ? 1290 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.083 ? 134 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 167 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.148 ? 335 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.3860 1.4591 2680 . 134 2546 98.0000 . . . 0.2245 0.0000 0.1650 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 1.4591 1.5505 2715 . 136 2579 99.0000 . . . 0.1905 0.0000 0.1293 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 1.5505 1.6702 2728 . 136 2592 99.0000 . . . 0.1570 0.0000 0.1294 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 1.6702 1.8383 2766 . 139 2627 100.0000 . . . 0.1779 0.0000 0.1264 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 1.8383 2.1042 2791 . 139 2652 100.0000 . . . 0.1438 0.0000 0.1255 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.1042 2.6508 2812 . 141 2671 100.0000 . . . 0.1616 0.0000 0.1458 . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.6508 30.3723 2953 . 147 2806 100.0000 . . . 0.1700 0.0000 0.1588 . . . . . . 7 . . . # _struct.entry_id 5W3R _struct.title 'SH2B1 SH2 Domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5W3R _struct_keywords.text 'SH2B1, SH2, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 7 ? TYR A 11 ? PRO A 521 TYR A 525 5 ? 5 HELX_P HELX_P2 AA2 SER A 19 ? THR A 29 ? SER A 533 THR A 543 1 ? 11 HELX_P HELX_P3 AA3 GLY A 30 ? HIS A 35 ? GLY A 544 HIS A 549 5 ? 6 HELX_P HELX_P4 AA4 SER A 82 ? HIS A 93 ? SER A 596 HIS A 607 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 14 ? MET A 17 ? PHE A 528 MET A 531 AA1 2 VAL A 37 ? GLN A 42 ? VAL A 551 GLN A 556 AA1 3 TYR A 50 ? PHE A 56 ? TYR A 564 PHE A 570 AA1 4 LYS A 59 ? LEU A 67 ? LYS A 573 LEU A 581 AA1 5 CYS A 73 ? VAL A 75 ? CYS A 587 VAL A 589 AA1 6 LEU A 78 ? PHE A 80 ? LEU A 592 PHE A 594 AA2 1 PHE A 14 ? MET A 17 ? PHE A 528 MET A 531 AA2 2 VAL A 37 ? GLN A 42 ? VAL A 551 GLN A 556 AA2 3 SER A 109 ? TYR A 110 ? SER A 623 TYR A 624 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N HIS A 15 ? N HIS A 529 O VAL A 40 ? O VAL A 554 AA1 2 3 N ARG A 41 ? N ARG A 555 O VAL A 51 ? O VAL A 565 AA1 3 4 N PHE A 56 ? N PHE A 570 O LYS A 59 ? O LYS A 573 AA1 4 5 N SER A 66 ? N SER A 580 O ARG A 74 ? O ARG A 588 AA1 5 6 N CYS A 73 ? N CYS A 587 O PHE A 80 ? O PHE A 594 AA2 1 2 N HIS A 15 ? N HIS A 529 O VAL A 40 ? O VAL A 554 AA2 2 3 N PHE A 38 ? N PHE A 552 O SER A 109 ? O SER A 623 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A PO4 701 ? 7 'binding site for residue PO4 A 701' AC2 Software A IPH 702 ? 6 'binding site for residue IPH A 702' AC3 Software A IPH 703 ? 3 'binding site for residue IPH A 703' AC4 Software A IPH 704 ? 7 'binding site for residue IPH A 704' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ARG A 20 ? ARG A 534 . ? 1_555 ? 2 AC1 7 ARG A 41 ? ARG A 555 . ? 1_555 ? 3 AC1 7 SER A 43 ? SER A 557 . ? 1_555 ? 4 AC1 7 GLU A 44 ? GLU A 558 . ? 1_555 ? 5 AC1 7 THR A 45 ? THR A 559 . ? 1_555 ? 6 AC1 7 ARG A 64 ? ARG A 578 . ? 1_555 ? 7 AC1 7 HOH F . ? HOH A 818 . ? 1_555 ? 8 AC2 6 GLY A 48 ? GLY A 562 . ? 1_555 ? 9 AC2 6 TYR A 50 ? TYR A 564 . ? 1_555 ? 10 AC2 6 LEU A 65 ? LEU A 579 . ? 1_555 ? 11 AC2 6 LEU A 67 ? LEU A 581 . ? 1_555 ? 12 AC2 6 CYS A 73 ? CYS A 587 . ? 1_555 ? 13 AC2 6 HOH F . ? HOH A 819 . ? 1_555 ? 14 AC3 3 ARG A 47 ? ARG A 561 . ? 3_554 ? 15 AC3 3 ARG A 91 ? ARG A 605 . ? 1_555 ? 16 AC3 3 VAL A 108 ? VAL A 622 . ? 1_555 ? 17 AC4 7 PHE A 56 ? PHE A 570 . ? 1_555 ? 18 AC4 7 GLN A 76 ? GLN A 590 . ? 1_555 ? 19 AC4 7 ILE A 95 ? ILE A 609 . ? 1_555 ? 20 AC4 7 PRO A 96 ? PRO A 610 . ? 1_555 ? 21 AC4 7 LEU A 97 ? LEU A 611 . ? 1_555 ? 22 AC4 7 SER A 103 ? SER A 617 . ? 1_555 ? 23 AC4 7 VAL A 105 ? VAL A 619 . ? 1_555 ? # _atom_sites.entry_id 5W3R _atom_sites.fract_transf_matrix[1][1] 0.034471 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018957 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016466 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 515 515 GLY GLY A . n A 1 2 SER 2 516 516 SER SER A . n A 1 3 HIS 3 517 517 HIS HIS A . n A 1 4 MET 4 518 518 MET MET A . n A 1 5 ASP 5 519 519 ASP ASP A . n A 1 6 GLN 6 520 520 GLN GLN A . n A 1 7 PRO 7 521 521 PRO PRO A . n A 1 8 LEU 8 522 522 LEU LEU A . n A 1 9 SER 9 523 523 SER SER A . n A 1 10 GLY 10 524 524 GLY GLY A . n A 1 11 TYR 11 525 525 TYR TYR A . n A 1 12 PRO 12 526 526 PRO PRO A . n A 1 13 TRP 13 527 527 TRP TRP A . n A 1 14 PHE 14 528 528 PHE PHE A . n A 1 15 HIS 15 529 529 HIS HIS A . n A 1 16 GLY 16 530 530 GLY GLY A . n A 1 17 MET 17 531 531 MET MET A . n A 1 18 LEU 18 532 532 LEU LEU A . n A 1 19 SER 19 533 533 SER SER A . n A 1 20 ARG 20 534 534 ARG ARG A . n A 1 21 LEU 21 535 535 LEU LEU A . n A 1 22 LYS 22 536 536 LYS LYS A . n A 1 23 ALA 23 537 537 ALA ALA A . n A 1 24 ALA 24 538 538 ALA ALA A . n A 1 25 GLN 25 539 539 GLN GLN A . n A 1 26 LEU 26 540 540 LEU LEU A . n A 1 27 VAL 27 541 541 VAL VAL A . n A 1 28 LEU 28 542 542 LEU LEU A . n A 1 29 THR 29 543 543 THR THR A . n A 1 30 GLY 30 544 544 GLY GLY A . n A 1 31 GLY 31 545 545 GLY GLY A . n A 1 32 THR 32 546 546 THR THR A . n A 1 33 GLY 33 547 547 GLY GLY A . n A 1 34 SER 34 548 548 SER SER A . n A 1 35 HIS 35 549 549 HIS HIS A . n A 1 36 GLY 36 550 550 GLY GLY A . n A 1 37 VAL 37 551 551 VAL VAL A . n A 1 38 PHE 38 552 552 PHE PHE A . n A 1 39 LEU 39 553 553 LEU LEU A . n A 1 40 VAL 40 554 554 VAL VAL A . n A 1 41 ARG 41 555 555 ARG ARG A . n A 1 42 GLN 42 556 556 GLN GLN A . n A 1 43 SER 43 557 557 SER SER A . n A 1 44 GLU 44 558 558 GLU GLU A . n A 1 45 THR 45 559 559 THR THR A . n A 1 46 ARG 46 560 560 ARG ARG A . n A 1 47 ARG 47 561 561 ARG ARG A . n A 1 48 GLY 48 562 562 GLY GLY A . n A 1 49 GLU 49 563 563 GLU GLU A . n A 1 50 TYR 50 564 564 TYR TYR A . n A 1 51 VAL 51 565 565 VAL VAL A . n A 1 52 LEU 52 566 566 LEU LEU A . n A 1 53 THR 53 567 567 THR THR A . n A 1 54 PHE 54 568 568 PHE PHE A . n A 1 55 ASN 55 569 569 ASN ASN A . n A 1 56 PHE 56 570 570 PHE PHE A . n A 1 57 GLN 57 571 571 GLN GLN A . n A 1 58 GLY 58 572 572 GLY GLY A . n A 1 59 LYS 59 573 573 LYS LYS A . n A 1 60 ALA 60 574 574 ALA ALA A . n A 1 61 LYS 61 575 575 LYS LYS A . n A 1 62 HIS 62 576 576 HIS HIS A . n A 1 63 LEU 63 577 577 LEU LEU A . n A 1 64 ARG 64 578 578 ARG ARG A . n A 1 65 LEU 65 579 579 LEU LEU A . n A 1 66 SER 66 580 580 SER SER A . n A 1 67 LEU 67 581 581 LEU LEU A . n A 1 68 ASN 68 582 582 ASN ASN A . n A 1 69 ALA 69 583 583 ALA ALA A . n A 1 70 ALA 70 584 584 ALA ALA A . n A 1 71 GLY 71 585 585 GLY GLY A . n A 1 72 GLN 72 586 586 GLN GLN A . n A 1 73 CYS 73 587 587 CYS CYS A . n A 1 74 ARG 74 588 588 ARG ARG A . n A 1 75 VAL 75 589 589 VAL VAL A . n A 1 76 GLN 76 590 590 GLN GLN A . n A 1 77 HIS 77 591 591 HIS HIS A . n A 1 78 LEU 78 592 592 LEU LEU A . n A 1 79 HIS 79 593 593 HIS HIS A . n A 1 80 PHE 80 594 594 PHE PHE A . n A 1 81 GLN 81 595 595 GLN GLN A . n A 1 82 SER 82 596 596 SER SER A . n A 1 83 ILE 83 597 597 ILE ILE A . n A 1 84 PHE 84 598 598 PHE PHE A . n A 1 85 ASP 85 599 599 ASP ASP A . n A 1 86 MET 86 600 600 MET MET A . n A 1 87 LEU 87 601 601 LEU LEU A . n A 1 88 GLU 88 602 602 GLU GLU A . n A 1 89 HIS 89 603 603 HIS HIS A . n A 1 90 PHE 90 604 604 PHE PHE A . n A 1 91 ARG 91 605 605 ARG ARG A . n A 1 92 VAL 92 606 606 VAL VAL A . n A 1 93 HIS 93 607 607 HIS HIS A . n A 1 94 PRO 94 608 608 PRO PRO A . n A 1 95 ILE 95 609 609 ILE ILE A . n A 1 96 PRO 96 610 610 PRO PRO A . n A 1 97 LEU 97 611 611 LEU LEU A . n A 1 98 GLU 98 612 612 GLU GLU A . n A 1 99 SER 99 613 613 SER SER A . n A 1 100 GLY 100 614 614 GLY GLY A . n A 1 101 GLY 101 615 615 GLY GLY A . n A 1 102 SER 102 616 616 SER SER A . n A 1 103 SER 103 617 617 SER SER A . n A 1 104 ASP 104 618 618 ASP ASP A . n A 1 105 VAL 105 619 619 VAL VAL A . n A 1 106 VAL 106 620 620 VAL VAL A . n A 1 107 LEU 107 621 621 LEU LEU A . n A 1 108 VAL 108 622 622 VAL VAL A . n A 1 109 SER 109 623 623 SER SER A . n A 1 110 TYR 110 624 624 TYR TYR A . n A 1 111 VAL 111 625 625 VAL VAL A . n A 1 112 PRO 112 626 626 PRO PRO A . n A 1 113 SER 113 627 627 SER SER A . n A 1 114 SER 114 628 628 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PO4 1 701 1 PO4 PO4 A . C 3 IPH 1 702 1 IPH IPH A . D 3 IPH 1 703 2 IPH IPH A . E 3 IPH 1 704 3 IPH IPH A . F 4 HOH 1 801 142 HOH HOH A . F 4 HOH 2 802 144 HOH HOH A . F 4 HOH 3 803 123 HOH HOH A . F 4 HOH 4 804 46 HOH HOH A . F 4 HOH 5 805 101 HOH HOH A . F 4 HOH 6 806 84 HOH HOH A . F 4 HOH 7 807 35 HOH HOH A . F 4 HOH 8 808 119 HOH HOH A . F 4 HOH 9 809 16 HOH HOH A . F 4 HOH 10 810 106 HOH HOH A . F 4 HOH 11 811 51 HOH HOH A . F 4 HOH 12 812 107 HOH HOH A . F 4 HOH 13 813 10 HOH HOH A . F 4 HOH 14 814 38 HOH HOH A . F 4 HOH 15 815 1 HOH HOH A . F 4 HOH 16 816 78 HOH HOH A . F 4 HOH 17 817 60 HOH HOH A . F 4 HOH 18 818 45 HOH HOH A . F 4 HOH 19 819 5 HOH HOH A . F 4 HOH 20 820 70 HOH HOH A . F 4 HOH 21 821 99 HOH HOH A . F 4 HOH 22 822 55 HOH HOH A . F 4 HOH 23 823 117 HOH HOH A . F 4 HOH 24 824 22 HOH HOH A . F 4 HOH 25 825 37 HOH HOH A . F 4 HOH 26 826 19 HOH HOH A . F 4 HOH 27 827 25 HOH HOH A . F 4 HOH 28 828 27 HOH HOH A . F 4 HOH 29 829 17 HOH HOH A . F 4 HOH 30 830 13 HOH HOH A . F 4 HOH 31 831 69 HOH HOH A . F 4 HOH 32 832 110 HOH HOH A . F 4 HOH 33 833 49 HOH HOH A . F 4 HOH 34 834 14 HOH HOH A . F 4 HOH 35 835 30 HOH HOH A . F 4 HOH 36 836 56 HOH HOH A . F 4 HOH 37 837 2 HOH HOH A . F 4 HOH 38 838 12 HOH HOH A . F 4 HOH 39 839 48 HOH HOH A . F 4 HOH 40 840 63 HOH HOH A . F 4 HOH 41 841 79 HOH HOH A . F 4 HOH 42 842 44 HOH HOH A . F 4 HOH 43 843 4 HOH HOH A . F 4 HOH 44 844 9 HOH HOH A . F 4 HOH 45 845 21 HOH HOH A . F 4 HOH 46 846 43 HOH HOH A . F 4 HOH 47 847 39 HOH HOH A . F 4 HOH 48 848 115 HOH HOH A . F 4 HOH 49 849 42 HOH HOH A . F 4 HOH 50 850 54 HOH HOH A . F 4 HOH 51 851 20 HOH HOH A . F 4 HOH 52 852 138 HOH HOH A . F 4 HOH 53 853 40 HOH HOH A . F 4 HOH 54 854 3 HOH HOH A . F 4 HOH 55 855 31 HOH HOH A . F 4 HOH 56 856 53 HOH HOH A . F 4 HOH 57 857 136 HOH HOH A . F 4 HOH 58 858 82 HOH HOH A . F 4 HOH 59 859 105 HOH HOH A . F 4 HOH 60 860 59 HOH HOH A . F 4 HOH 61 861 92 HOH HOH A . F 4 HOH 62 862 29 HOH HOH A . F 4 HOH 63 863 47 HOH HOH A . F 4 HOH 64 864 8 HOH HOH A . F 4 HOH 65 865 64 HOH HOH A . F 4 HOH 66 866 74 HOH HOH A . F 4 HOH 67 867 18 HOH HOH A . F 4 HOH 68 868 11 HOH HOH A . F 4 HOH 69 869 26 HOH HOH A . F 4 HOH 70 870 140 HOH HOH A . F 4 HOH 71 871 141 HOH HOH A . F 4 HOH 72 872 104 HOH HOH A . F 4 HOH 73 873 6 HOH HOH A . F 4 HOH 74 874 126 HOH HOH A . F 4 HOH 75 875 66 HOH HOH A . F 4 HOH 76 876 134 HOH HOH A . F 4 HOH 77 877 62 HOH HOH A . F 4 HOH 78 878 91 HOH HOH A . F 4 HOH 79 879 85 HOH HOH A . F 4 HOH 80 880 28 HOH HOH A . F 4 HOH 81 881 34 HOH HOH A . F 4 HOH 82 882 36 HOH HOH A . F 4 HOH 83 883 50 HOH HOH A . F 4 HOH 84 884 15 HOH HOH A . F 4 HOH 85 885 65 HOH HOH A . F 4 HOH 86 886 137 HOH HOH A . F 4 HOH 87 887 116 HOH HOH A . F 4 HOH 88 888 125 HOH HOH A . F 4 HOH 89 889 68 HOH HOH A . F 4 HOH 90 890 121 HOH HOH A . F 4 HOH 91 891 75 HOH HOH A . F 4 HOH 92 892 143 HOH HOH A . F 4 HOH 93 893 124 HOH HOH A . F 4 HOH 94 894 102 HOH HOH A . F 4 HOH 95 895 72 HOH HOH A . F 4 HOH 96 896 61 HOH HOH A . F 4 HOH 97 897 94 HOH HOH A . F 4 HOH 98 898 131 HOH HOH A . F 4 HOH 99 899 95 HOH HOH A . F 4 HOH 100 900 71 HOH HOH A . F 4 HOH 101 901 80 HOH HOH A . F 4 HOH 102 902 93 HOH HOH A . F 4 HOH 103 903 90 HOH HOH A . F 4 HOH 104 904 100 HOH HOH A . F 4 HOH 105 905 87 HOH HOH A . F 4 HOH 106 906 52 HOH HOH A . F 4 HOH 107 907 98 HOH HOH A . F 4 HOH 108 908 120 HOH HOH A . F 4 HOH 109 909 77 HOH HOH A . F 4 HOH 110 910 57 HOH HOH A . F 4 HOH 111 911 97 HOH HOH A . F 4 HOH 112 912 103 HOH HOH A . F 4 HOH 113 913 33 HOH HOH A . F 4 HOH 114 914 58 HOH HOH A . F 4 HOH 115 915 96 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-11-22 2 'Structure model' 1 1 2018-04-25 3 'Structure model' 1 2 2019-11-27 4 'Structure model' 1 3 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Source and taxonomy' 4 3 'Structure model' 'Author supporting evidence' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' entity_src_gen 3 3 'Structure model' pdbx_audit_support 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation.year' 6 2 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line' 7 2 'Structure model' '_entity_src_gen.pdbx_host_org_strain' 8 3 'Structure model' '_pdbx_audit_support.funding_organization' 9 4 'Structure model' '_database_2.pdbx_DOI' 10 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_phasing_MR.entry_id 5W3R _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 5.030 _pdbx_phasing_MR.d_res_low_rotation 30.360 _pdbx_phasing_MR.d_res_high_translation 5.030 _pdbx_phasing_MR.d_res_low_translation 30.360 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.22 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.6.1 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1_2155 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 558 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 801 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.12 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 861 ? ? 1_555 O A HOH 870 ? ? 2_455 2.07 2 1 NH2 A ARG 560 ? ? 1_555 O A GLN 571 ? B 3_644 2.10 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 571 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id A _pdbx_validate_torsion.phi 29.09 _pdbx_validate_torsion.psi 58.35 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 519 ? CG ? A ASP 5 CG 2 1 Y 1 A ASP 519 ? OD1 ? A ASP 5 OD1 3 1 Y 1 A ASP 519 ? OD2 ? A ASP 5 OD2 4 1 Y 1 A GLU 612 ? CG ? A GLU 98 CG 5 1 Y 1 A GLU 612 ? CD ? A GLU 98 CD 6 1 Y 1 A GLU 612 ? OE1 ? A GLU 98 OE1 7 1 Y 1 A GLU 612 ? OE2 ? A GLU 98 OE2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 IPH C1 C Y N 183 IPH C2 C Y N 184 IPH C3 C Y N 185 IPH C4 C Y N 186 IPH C5 C Y N 187 IPH C6 C Y N 188 IPH O1 O N N 189 IPH H2 H N N 190 IPH H3 H N N 191 IPH H4 H N N 192 IPH H5 H N N 193 IPH H6 H N N 194 IPH HO1 H N N 195 LEU N N N N 196 LEU CA C N S 197 LEU C C N N 198 LEU O O N N 199 LEU CB C N N 200 LEU CG C N N 201 LEU CD1 C N N 202 LEU CD2 C N N 203 LEU OXT O N N 204 LEU H H N N 205 LEU H2 H N N 206 LEU HA H N N 207 LEU HB2 H N N 208 LEU HB3 H N N 209 LEU HG H N N 210 LEU HD11 H N N 211 LEU HD12 H N N 212 LEU HD13 H N N 213 LEU HD21 H N N 214 LEU HD22 H N N 215 LEU HD23 H N N 216 LEU HXT H N N 217 LYS N N N N 218 LYS CA C N S 219 LYS C C N N 220 LYS O O N N 221 LYS CB C N N 222 LYS CG C N N 223 LYS CD C N N 224 LYS CE C N N 225 LYS NZ N N N 226 LYS OXT O N N 227 LYS H H N N 228 LYS H2 H N N 229 LYS HA H N N 230 LYS HB2 H N N 231 LYS HB3 H N N 232 LYS HG2 H N N 233 LYS HG3 H N N 234 LYS HD2 H N N 235 LYS HD3 H N N 236 LYS HE2 H N N 237 LYS HE3 H N N 238 LYS HZ1 H N N 239 LYS HZ2 H N N 240 LYS HZ3 H N N 241 LYS HXT H N N 242 MET N N N N 243 MET CA C N S 244 MET C C N N 245 MET O O N N 246 MET CB C N N 247 MET CG C N N 248 MET SD S N N 249 MET CE C N N 250 MET OXT O N N 251 MET H H N N 252 MET H2 H N N 253 MET HA H N N 254 MET HB2 H N N 255 MET HB3 H N N 256 MET HG2 H N N 257 MET HG3 H N N 258 MET HE1 H N N 259 MET HE2 H N N 260 MET HE3 H N N 261 MET HXT H N N 262 PHE N N N N 263 PHE CA C N S 264 PHE C C N N 265 PHE O O N N 266 PHE CB C N N 267 PHE CG C Y N 268 PHE CD1 C Y N 269 PHE CD2 C Y N 270 PHE CE1 C Y N 271 PHE CE2 C Y N 272 PHE CZ C Y N 273 PHE OXT O N N 274 PHE H H N N 275 PHE H2 H N N 276 PHE HA H N N 277 PHE HB2 H N N 278 PHE HB3 H N N 279 PHE HD1 H N N 280 PHE HD2 H N N 281 PHE HE1 H N N 282 PHE HE2 H N N 283 PHE HZ H N N 284 PHE HXT H N N 285 PO4 P P N N 286 PO4 O1 O N N 287 PO4 O2 O N N 288 PO4 O3 O N N 289 PO4 O4 O N N 290 PRO N N N N 291 PRO CA C N S 292 PRO C C N N 293 PRO O O N N 294 PRO CB C N N 295 PRO CG C N N 296 PRO CD C N N 297 PRO OXT O N N 298 PRO H H N N 299 PRO HA H N N 300 PRO HB2 H N N 301 PRO HB3 H N N 302 PRO HG2 H N N 303 PRO HG3 H N N 304 PRO HD2 H N N 305 PRO HD3 H N N 306 PRO HXT H N N 307 SER N N N N 308 SER CA C N S 309 SER C C N N 310 SER O O N N 311 SER CB C N N 312 SER OG O N N 313 SER OXT O N N 314 SER H H N N 315 SER H2 H N N 316 SER HA H N N 317 SER HB2 H N N 318 SER HB3 H N N 319 SER HG H N N 320 SER HXT H N N 321 THR N N N N 322 THR CA C N S 323 THR C C N N 324 THR O O N N 325 THR CB C N R 326 THR OG1 O N N 327 THR CG2 C N N 328 THR OXT O N N 329 THR H H N N 330 THR H2 H N N 331 THR HA H N N 332 THR HB H N N 333 THR HG1 H N N 334 THR HG21 H N N 335 THR HG22 H N N 336 THR HG23 H N N 337 THR HXT H N N 338 TRP N N N N 339 TRP CA C N S 340 TRP C C N N 341 TRP O O N N 342 TRP CB C N N 343 TRP CG C Y N 344 TRP CD1 C Y N 345 TRP CD2 C Y N 346 TRP NE1 N Y N 347 TRP CE2 C Y N 348 TRP CE3 C Y N 349 TRP CZ2 C Y N 350 TRP CZ3 C Y N 351 TRP CH2 C Y N 352 TRP OXT O N N 353 TRP H H N N 354 TRP H2 H N N 355 TRP HA H N N 356 TRP HB2 H N N 357 TRP HB3 H N N 358 TRP HD1 H N N 359 TRP HE1 H N N 360 TRP HE3 H N N 361 TRP HZ2 H N N 362 TRP HZ3 H N N 363 TRP HH2 H N N 364 TRP HXT H N N 365 TYR N N N N 366 TYR CA C N S 367 TYR C C N N 368 TYR O O N N 369 TYR CB C N N 370 TYR CG C Y N 371 TYR CD1 C Y N 372 TYR CD2 C Y N 373 TYR CE1 C Y N 374 TYR CE2 C Y N 375 TYR CZ C Y N 376 TYR OH O N N 377 TYR OXT O N N 378 TYR H H N N 379 TYR H2 H N N 380 TYR HA H N N 381 TYR HB2 H N N 382 TYR HB3 H N N 383 TYR HD1 H N N 384 TYR HD2 H N N 385 TYR HE1 H N N 386 TYR HE2 H N N 387 TYR HH H N N 388 TYR HXT H N N 389 VAL N N N N 390 VAL CA C N S 391 VAL C C N N 392 VAL O O N N 393 VAL CB C N N 394 VAL CG1 C N N 395 VAL CG2 C N N 396 VAL OXT O N N 397 VAL H H N N 398 VAL H2 H N N 399 VAL HA H N N 400 VAL HB H N N 401 VAL HG11 H N N 402 VAL HG12 H N N 403 VAL HG13 H N N 404 VAL HG21 H N N 405 VAL HG22 H N N 406 VAL HG23 H N N 407 VAL HXT H N N 408 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 IPH C1 C2 doub Y N 173 IPH C1 C6 sing Y N 174 IPH C1 O1 sing N N 175 IPH C2 C3 sing Y N 176 IPH C2 H2 sing N N 177 IPH C3 C4 doub Y N 178 IPH C3 H3 sing N N 179 IPH C4 C5 sing Y N 180 IPH C4 H4 sing N N 181 IPH C5 C6 doub Y N 182 IPH C5 H5 sing N N 183 IPH C6 H6 sing N N 184 IPH O1 HO1 sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MET N CA sing N N 231 MET N H sing N N 232 MET N H2 sing N N 233 MET CA C sing N N 234 MET CA CB sing N N 235 MET CA HA sing N N 236 MET C O doub N N 237 MET C OXT sing N N 238 MET CB CG sing N N 239 MET CB HB2 sing N N 240 MET CB HB3 sing N N 241 MET CG SD sing N N 242 MET CG HG2 sing N N 243 MET CG HG3 sing N N 244 MET SD CE sing N N 245 MET CE HE1 sing N N 246 MET CE HE2 sing N N 247 MET CE HE3 sing N N 248 MET OXT HXT sing N N 249 PHE N CA sing N N 250 PHE N H sing N N 251 PHE N H2 sing N N 252 PHE CA C sing N N 253 PHE CA CB sing N N 254 PHE CA HA sing N N 255 PHE C O doub N N 256 PHE C OXT sing N N 257 PHE CB CG sing N N 258 PHE CB HB2 sing N N 259 PHE CB HB3 sing N N 260 PHE CG CD1 doub Y N 261 PHE CG CD2 sing Y N 262 PHE CD1 CE1 sing Y N 263 PHE CD1 HD1 sing N N 264 PHE CD2 CE2 doub Y N 265 PHE CD2 HD2 sing N N 266 PHE CE1 CZ doub Y N 267 PHE CE1 HE1 sing N N 268 PHE CE2 CZ sing Y N 269 PHE CE2 HE2 sing N N 270 PHE CZ HZ sing N N 271 PHE OXT HXT sing N N 272 PO4 P O1 doub N N 273 PO4 P O2 sing N N 274 PO4 P O3 sing N N 275 PO4 P O4 sing N N 276 PRO N CA sing N N 277 PRO N CD sing N N 278 PRO N H sing N N 279 PRO CA C sing N N 280 PRO CA CB sing N N 281 PRO CA HA sing N N 282 PRO C O doub N N 283 PRO C OXT sing N N 284 PRO CB CG sing N N 285 PRO CB HB2 sing N N 286 PRO CB HB3 sing N N 287 PRO CG CD sing N N 288 PRO CG HG2 sing N N 289 PRO CG HG3 sing N N 290 PRO CD HD2 sing N N 291 PRO CD HD3 sing N N 292 PRO OXT HXT sing N N 293 SER N CA sing N N 294 SER N H sing N N 295 SER N H2 sing N N 296 SER CA C sing N N 297 SER CA CB sing N N 298 SER CA HA sing N N 299 SER C O doub N N 300 SER C OXT sing N N 301 SER CB OG sing N N 302 SER CB HB2 sing N N 303 SER CB HB3 sing N N 304 SER OG HG sing N N 305 SER OXT HXT sing N N 306 THR N CA sing N N 307 THR N H sing N N 308 THR N H2 sing N N 309 THR CA C sing N N 310 THR CA CB sing N N 311 THR CA HA sing N N 312 THR C O doub N N 313 THR C OXT sing N N 314 THR CB OG1 sing N N 315 THR CB CG2 sing N N 316 THR CB HB sing N N 317 THR OG1 HG1 sing N N 318 THR CG2 HG21 sing N N 319 THR CG2 HG22 sing N N 320 THR CG2 HG23 sing N N 321 THR OXT HXT sing N N 322 TRP N CA sing N N 323 TRP N H sing N N 324 TRP N H2 sing N N 325 TRP CA C sing N N 326 TRP CA CB sing N N 327 TRP CA HA sing N N 328 TRP C O doub N N 329 TRP C OXT sing N N 330 TRP CB CG sing N N 331 TRP CB HB2 sing N N 332 TRP CB HB3 sing N N 333 TRP CG CD1 doub Y N 334 TRP CG CD2 sing Y N 335 TRP CD1 NE1 sing Y N 336 TRP CD1 HD1 sing N N 337 TRP CD2 CE2 doub Y N 338 TRP CD2 CE3 sing Y N 339 TRP NE1 CE2 sing Y N 340 TRP NE1 HE1 sing N N 341 TRP CE2 CZ2 sing Y N 342 TRP CE3 CZ3 doub Y N 343 TRP CE3 HE3 sing N N 344 TRP CZ2 CH2 doub Y N 345 TRP CZ2 HZ2 sing N N 346 TRP CZ3 CH2 sing Y N 347 TRP CZ3 HZ3 sing N N 348 TRP CH2 HH2 sing N N 349 TRP OXT HXT sing N N 350 TYR N CA sing N N 351 TYR N H sing N N 352 TYR N H2 sing N N 353 TYR CA C sing N N 354 TYR CA CB sing N N 355 TYR CA HA sing N N 356 TYR C O doub N N 357 TYR C OXT sing N N 358 TYR CB CG sing N N 359 TYR CB HB2 sing N N 360 TYR CB HB3 sing N N 361 TYR CG CD1 doub Y N 362 TYR CG CD2 sing Y N 363 TYR CD1 CE1 sing Y N 364 TYR CD1 HD1 sing N N 365 TYR CD2 CE2 doub Y N 366 TYR CD2 HD2 sing N N 367 TYR CE1 CZ doub Y N 368 TYR CE1 HE1 sing N N 369 TYR CE2 CZ sing Y N 370 TYR CE2 HE2 sing N N 371 TYR CZ OH sing N N 372 TYR OH HH sing N N 373 TYR OXT HXT sing N N 374 VAL N CA sing N N 375 VAL N H sing N N 376 VAL N H2 sing N N 377 VAL CA C sing N N 378 VAL CA CB sing N N 379 VAL CA HA sing N N 380 VAL C O doub N N 381 VAL C OXT sing N N 382 VAL CB CG1 sing N N 383 VAL CB CG2 sing N N 384 VAL CB HB sing N N 385 VAL CG1 HG11 sing N N 386 VAL CG1 HG12 sing N N 387 VAL CG1 HG13 sing N N 388 VAL CG2 HG21 sing N N 389 VAL CG2 HG22 sing N N 390 VAL CG2 HG23 sing N N 391 VAL OXT HXT sing N N 392 # _pdbx_audit_support.funding_organization 'National Science Foundation (NSF, United States)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number MCB1121842 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PHOSPHATE ION' PO4 3 PHENOL IPH 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2HDV _pdbx_initial_refinement_model.details 'Solved using a previous poor-resolution unpublished structure, which, in turn, was solved using 2HDV as a model' # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #