data_5WE1 # _entry.id 5WE1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5WE1 pdb_00005we1 10.2210/pdb5we1/pdb WWPDB D_1000228860 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5WE1 _pdbx_database_status.recvd_initial_deposition_date 2017-07-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kim, J.-K.' 1 ? 'Liu, J.' 2 ? 'Hu, X.' 3 ? 'Yu, C.' 4 ? 'Roskamp, K.' 5 ? 'Sankaran, B.' 6 ? 'Huang, L.' 7 ? 'Komives, E.-A.' 8 ? 'Qiao, F.' 9 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Mol. Cell' _citation.journal_id_ASTM MOCEFL _citation.journal_id_CSD 2168 _citation.journal_id_ISSN 1097-4164 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 68 _citation.language ? _citation.page_first 698 _citation.page_last 714.e5 _citation.title 'Structural Basis for Shelterin Bridge Assembly.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.molcel.2017.10.032 _citation.pdbx_database_id_PubMed 29149597 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, J.K.' 1 ? primary 'Liu, J.' 2 ? primary 'Hu, X.' 3 ? primary 'Yu, C.' 4 ? primary 'Roskamp, K.' 5 ? primary 'Sankaran, B.' 6 ? primary 'Huang, L.' 7 ? primary 'Komives, E.A.' 8 ? primary 'Qiao, F.' 9 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5WE1 _cell.details ? _cell.formula_units_Z ? _cell.length_a 66.110 _cell.length_a_esd ? _cell.length_b 66.110 _cell.length_b_esd ? _cell.length_c 123.160 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5WE1 _symmetry.cell_setting ? _symmetry.Int_Tables_number 144 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protection of telomeres protein poz1,Protection of telomeres protein poz1' 25314.229 2 ? ? ? ? 2 polymer man 'Protection of telomeres protein tpz1' 3964.574 2 ? ? 'UNP residues 476-508' ? 3 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Pot1-associated protein poz1,Pot1-associated protein poz1' 2 'Meiotically up-regulated gene 169 protein' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;SESSIVNACLRYLGYSKSMCHEKMPIFMDIAFIEYCFNLSLDPSSFQGGASQQILWEYSLISNALERLENIELERQNCMR EDGLSKYTNSLLLNKETLNNEALKLYSCAKAGICRWMAFHFLEQEPIDHINFTKFLQDWGSHNEKEMEALQRLSKHKIRK RLIYVSQHKKKMPWSKFNSVLSRYIQCTKLQLEVFCDYDFKQREIVKMLTSNIN ; ;SESSIVNACLRYLGYSKSMCHEKMPIFMDIAFIEYCFNLSLDPSSFQGGASQQILWEYSLISNALERLENIELERQNCMR EDGLSKYTNSLLLNKETLNNEALKLYSCAKAGICRWMAFHFLEQEPIDHINFTKFLQDWGSHNEKEMEALQRLSKHKIRK RLIYVSQHKKKMPWSKFNSVLSRYIQCTKLQLEVFCDYDFKQREIVKMLTSNIN ; A,C ? 2 'polypeptide(L)' no no SEACEMCRLGLPHGSFFELLRDWKKIEEFRNKS SEACEMCRLGLPHGSFFELLRDWKKIEEFRNKS B,D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLU n 1 3 SER n 1 4 SER n 1 5 ILE n 1 6 VAL n 1 7 ASN n 1 8 ALA n 1 9 CYS n 1 10 LEU n 1 11 ARG n 1 12 TYR n 1 13 LEU n 1 14 GLY n 1 15 TYR n 1 16 SER n 1 17 LYS n 1 18 SER n 1 19 MET n 1 20 CYS n 1 21 HIS n 1 22 GLU n 1 23 LYS n 1 24 MET n 1 25 PRO n 1 26 ILE n 1 27 PHE n 1 28 MET n 1 29 ASP n 1 30 ILE n 1 31 ALA n 1 32 PHE n 1 33 ILE n 1 34 GLU n 1 35 TYR n 1 36 CYS n 1 37 PHE n 1 38 ASN n 1 39 LEU n 1 40 SER n 1 41 LEU n 1 42 ASP n 1 43 PRO n 1 44 SER n 1 45 SER n 1 46 PHE n 1 47 GLN n 1 48 GLY n 1 49 GLY n 1 50 ALA n 1 51 SER n 1 52 GLN n 1 53 GLN n 1 54 ILE n 1 55 LEU n 1 56 TRP n 1 57 GLU n 1 58 TYR n 1 59 SER n 1 60 LEU n 1 61 ILE n 1 62 SER n 1 63 ASN n 1 64 ALA n 1 65 LEU n 1 66 GLU n 1 67 ARG n 1 68 LEU n 1 69 GLU n 1 70 ASN n 1 71 ILE n 1 72 GLU n 1 73 LEU n 1 74 GLU n 1 75 ARG n 1 76 GLN n 1 77 ASN n 1 78 CYS n 1 79 MET n 1 80 ARG n 1 81 GLU n 1 82 ASP n 1 83 GLY n 1 84 LEU n 1 85 SER n 1 86 LYS n 1 87 TYR n 1 88 THR n 1 89 ASN n 1 90 SER n 1 91 LEU n 1 92 LEU n 1 93 LEU n 1 94 ASN n 1 95 LYS n 1 96 GLU n 1 97 THR n 1 98 LEU n 1 99 ASN n 1 100 ASN n 1 101 GLU n 1 102 ALA n 1 103 LEU n 1 104 LYS n 1 105 LEU n 1 106 TYR n 1 107 SER n 1 108 CYS n 1 109 ALA n 1 110 LYS n 1 111 ALA n 1 112 GLY n 1 113 ILE n 1 114 CYS n 1 115 ARG n 1 116 TRP n 1 117 MET n 1 118 ALA n 1 119 PHE n 1 120 HIS n 1 121 PHE n 1 122 LEU n 1 123 GLU n 1 124 GLN n 1 125 GLU n 1 126 PRO n 1 127 ILE n 1 128 ASP n 1 129 HIS n 1 130 ILE n 1 131 ASN n 1 132 PHE n 1 133 THR n 1 134 LYS n 1 135 PHE n 1 136 LEU n 1 137 GLN n 1 138 ASP n 1 139 TRP n 1 140 GLY n 1 141 SER n 1 142 HIS n 1 143 ASN n 1 144 GLU n 1 145 LYS n 1 146 GLU n 1 147 MET n 1 148 GLU n 1 149 ALA n 1 150 LEU n 1 151 GLN n 1 152 ARG n 1 153 LEU n 1 154 SER n 1 155 LYS n 1 156 HIS n 1 157 LYS n 1 158 ILE n 1 159 ARG n 1 160 LYS n 1 161 ARG n 1 162 LEU n 1 163 ILE n 1 164 TYR n 1 165 VAL n 1 166 SER n 1 167 GLN n 1 168 HIS n 1 169 LYS n 1 170 LYS n 1 171 LYS n 1 172 MET n 1 173 PRO n 1 174 TRP n 1 175 SER n 1 176 LYS n 1 177 PHE n 1 178 ASN n 1 179 SER n 1 180 VAL n 1 181 LEU n 1 182 SER n 1 183 ARG n 1 184 TYR n 1 185 ILE n 1 186 GLN n 1 187 CYS n 1 188 THR n 1 189 LYS n 1 190 LEU n 1 191 GLN n 1 192 LEU n 1 193 GLU n 1 194 VAL n 1 195 PHE n 1 196 CYS n 1 197 ASP n 1 198 TYR n 1 199 ASP n 1 200 PHE n 1 201 LYS n 1 202 GLN n 1 203 ARG n 1 204 GLU n 1 205 ILE n 1 206 VAL n 1 207 LYS n 1 208 MET n 1 209 LEU n 1 210 THR n 1 211 SER n 1 212 ASN n 1 213 ILE n 1 214 ASN n 2 1 SER n 2 2 GLU n 2 3 ALA n 2 4 CYS n 2 5 GLU n 2 6 MET n 2 7 CYS n 2 8 ARG n 2 9 LEU n 2 10 GLY n 2 11 LEU n 2 12 PRO n 2 13 HIS n 2 14 GLY n 2 15 SER n 2 16 PHE n 2 17 PHE n 2 18 GLU n 2 19 LEU n 2 20 LEU n 2 21 ARG n 2 22 ASP n 2 23 TRP n 2 24 LYS n 2 25 LYS n 2 26 ILE n 2 27 GLU n 2 28 GLU n 2 29 PHE n 2 30 ARG n 2 31 ASN n 2 32 LYS n 2 33 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 47 'Fission yeast' ? 'poz1, SPAC19G12.13c' ? '972 / ATCC 24843' ? ? ? ? 'Schizosaccharomyces pombe' 284812 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 48 214 'Fission yeast' ? 'poz1, SPAC19G12.13c' ? '972 / ATCC 24843' ? ? ? ? 'Schizosaccharomyces pombe (strain 972 / ATCC 24843)' 284812 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 33 'Fission yeast' ? 'tpz1, mug169, SPAC6F6.16c, SPAC6F6.18c' ? '972 / ATCC 24843' ? ? ? ? 'Schizosaccharomyces pombe (strain 972 / ATCC 24843)' 284812 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP POZ1_SCHPO O13852 ? 1 ESSIVNACLRYLGYSKSMCHEKMPIFMDIAFIEYCFNLSLDPSSFQ 30 2 UNP POZ1_SCHPO O13852 ? 1 ;SQQILWEYSLISNALERLENIELERQNCMREDGLVKYTNELLLNKETLNNEALKLYSCAKAGICRWMAFHFLEQEPIDHI NFTKFLQDWGSHNEKEMEALQRLSKHKIRKRLIYVSQHKKKMPWSKFNSVLSRYIQCTKLQLEVFCDYDFKQREIVKMLT SNIN ; 86 3 UNP TPZ1_SCHPO O14246 ? 2 SEACEMCRLGLPHGSFFELLRDWKKIEEFRNKS 476 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5WE1 A 2 ? 47 ? O13852 30 ? 75 ? 30 82 2 2 5WE1 A 51 ? 214 ? O13852 86 ? 249 ? 86 249 3 3 5WE1 B 1 ? 33 ? O14246 476 ? 508 ? 476 508 4 1 5WE1 C 2 ? 47 ? O13852 30 ? 75 ? 30 82 5 2 5WE1 C 51 ? 214 ? O13852 86 ? 249 ? 86 249 6 3 5WE1 D 1 ? 33 ? O14246 476 ? 508 ? 476 508 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5WE1 SER A 1 ? UNP O13852 ? ? 'expression tag' 29 1 1 5WE1 GLY A 48 ? UNP O13852 ? ? linker 83 2 1 5WE1 GLY A 49 ? UNP O13852 ? ? linker 84 3 1 5WE1 ALA A 50 ? UNP O13852 ? ? linker 85 4 2 5WE1 SER A 85 ? UNP O13852 VAL 120 conflict 120 5 2 5WE1 SER A 90 ? UNP O13852 GLU 125 conflict 125 6 4 5WE1 SER C 1 ? UNP O13852 ? ? 'expression tag' 29 7 4 5WE1 GLY C 48 ? UNP O13852 ? ? linker 83 8 4 5WE1 GLY C 49 ? UNP O13852 ? ? linker 84 9 4 5WE1 ALA C 50 ? UNP O13852 ? ? linker 85 10 5 5WE1 SER C 85 ? UNP O13852 VAL 120 conflict 120 11 5 5WE1 SER C 90 ? UNP O13852 GLU 125 conflict 125 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5WE1 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.67 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.93 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M Tris-HCl pH 8.0, 4% Reagent Alcohol, 0.3 M MgCl2 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-04-28 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.977408 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.977408 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5WE1 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.20 _reflns.d_resolution_low 57.25 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9911 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.3 _reflns.pdbx_Rmerge_I_obs 0.104 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.20 _reflns_shell.d_res_low 3.37 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.5 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.765 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5WE1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.202 _refine.ls_d_res_low 51.917 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9872 _refine.ls_number_reflns_R_free 514 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.38 _refine.ls_percent_reflns_R_free 5.21 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2691 _refine.ls_R_factor_R_free 0.3165 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2664 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.00 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5WE2 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 40.96 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.56 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 3511 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 3513 _refine_hist.d_res_high 3.202 _refine_hist.d_res_low 51.917 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 3589 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.269 ? 4798 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 18.087 ? 1364 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.047 ? 500 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 599 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.2022 3.5244 . . 108 2369 99.00 . . . 0.4376 . 0.3305 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5244 4.0342 . . 142 2313 99.00 . . . 0.4302 . 0.2960 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0342 5.0819 . . 124 2366 100.00 . . . 0.2584 . 0.2607 . . . . . . . . . . 'X-RAY DIFFRACTION' 5.0819 51.9242 . . 140 2310 99.00 . . . 0.2828 . 0.2364 . . . . . . . . . . # _struct.entry_id 5WE1 _struct.title 'Structural Basis for Shelterin Bridge Assembly' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5WE1 _struct_keywords.text 'Telomere, Shelterin, Cooperativity, GENE REGULATION' _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 1 ? D N N 2 ? E N N 3 ? F N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 6 ? TYR A 15 ? VAL A 34 TYR A 43 1 ? 10 HELX_P HELX_P2 AA2 SER A 16 ? HIS A 21 ? SER A 44 HIS A 49 1 ? 6 HELX_P HELX_P3 AA3 PRO A 25 ? PHE A 37 ? PRO A 53 PHE A 65 1 ? 13 HELX_P HELX_P4 AA4 GLU A 57 ? MET A 79 ? GLU A 92 MET A 114 1 ? 23 HELX_P HELX_P5 AA5 LYS A 95 ? GLN A 124 ? LYS A 130 GLN A 159 1 ? 30 HELX_P HELX_P6 AA6 ASP A 128 ? LYS A 134 ? ASP A 163 LYS A 169 1 ? 7 HELX_P HELX_P7 AA7 ASN A 143 ? LEU A 153 ? ASN A 178 LEU A 188 1 ? 11 HELX_P HELX_P8 AA8 SER A 154 ? LYS A 157 ? SER A 189 LYS A 192 5 ? 4 HELX_P HELX_P9 AA9 ILE A 158 ? LYS A 169 ? ILE A 193 LYS A 204 1 ? 12 HELX_P HELX_P10 AB1 PRO A 173 ? PHE A 195 ? PRO A 208 PHE A 230 1 ? 23 HELX_P HELX_P11 AB2 GLU B 5 ? LEU B 9 ? GLU B 480 LEU B 484 1 ? 5 HELX_P HELX_P12 AB3 GLY B 14 ? LYS B 32 ? GLY B 489 LYS B 507 1 ? 19 HELX_P HELX_P13 AB4 SER C 4 ? TYR C 15 ? SER C 32 TYR C 43 1 ? 12 HELX_P HELX_P14 AB5 SER C 16 ? HIS C 21 ? SER C 44 HIS C 49 1 ? 6 HELX_P HELX_P15 AB6 PRO C 25 ? PHE C 37 ? PRO C 53 PHE C 65 1 ? 13 HELX_P HELX_P16 AB7 GLU C 57 ? MET C 79 ? GLU C 92 MET C 114 1 ? 23 HELX_P HELX_P17 AB8 LYS C 95 ? GLN C 124 ? LYS C 130 GLN C 159 1 ? 30 HELX_P HELX_P18 AB9 ASP C 128 ? TRP C 139 ? ASP C 163 TRP C 174 1 ? 12 HELX_P HELX_P19 AC1 GLU C 146 ? LYS C 155 ? GLU C 181 LYS C 190 1 ? 10 HELX_P HELX_P20 AC2 LYS C 157 ? SER C 166 ? LYS C 192 SER C 201 1 ? 10 HELX_P HELX_P21 AC3 GLN C 167 ? LYS C 170 ? GLN C 202 LYS C 205 5 ? 4 HELX_P HELX_P22 AC4 PRO C 173 ? PHE C 195 ? PRO C 208 PHE C 230 1 ? 23 HELX_P HELX_P23 AC5 CYS D 4 ? LEU D 9 ? CYS D 479 LEU D 484 1 ? 6 HELX_P HELX_P24 AC6 GLY D 14 ? LYS D 32 ? GLY D 489 LYS D 507 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 78 SG ? ? ? 1_555 A CYS 196 SG ? ? A CYS 113 A CYS 231 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? C CYS 78 SG ? ? ? 1_555 C CYS 196 SG ? ? C CYS 113 C CYS 231 1_555 ? ? ? ? ? ? ? 2.025 ? ? metalc1 metalc ? ? A HIS 21 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 49 A ZN 601 1_555 ? ? ? ? ? ? ? 2.204 ? ? metalc2 metalc ? ? E ZN . ZN ? ? ? 1_555 B CYS 4 SG ? ? A ZN 601 B CYS 479 1_555 ? ? ? ? ? ? ? 2.884 ? ? metalc3 metalc ? ? E ZN . ZN ? ? ? 1_555 B CYS 7 SG ? ? A ZN 601 B CYS 482 1_555 ? ? ? ? ? ? ? 2.344 ? ? metalc4 metalc ? ? E ZN . ZN ? ? ? 1_555 B HIS 13 NE2 ? ? A ZN 601 B HIS 488 1_555 ? ? ? ? ? ? ? 2.090 ? ? metalc5 metalc ? ? C HIS 21 NE2 ? ? ? 1_555 F ZN . ZN ? ? C HIS 49 C ZN 601 1_555 ? ? ? ? ? ? ? 2.131 ? ? metalc6 metalc ? ? F ZN . ZN ? ? ? 1_555 D CYS 4 SG ? ? C ZN 601 D CYS 479 1_555 ? ? ? ? ? ? ? 2.380 ? ? metalc7 metalc ? ? F ZN . ZN ? ? ? 1_555 D CYS 7 SG ? ? C ZN 601 D CYS 482 1_555 ? ? ? ? ? ? ? 2.256 ? ? metalc8 metalc ? ? F ZN . ZN ? ? ? 1_555 D HIS 13 NE2 ? ? C ZN 601 D HIS 488 1_555 ? ? ? ? ? ? ? 2.039 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 125 A . ? GLU 160 A PRO 126 A ? PRO 161 A 1 2.13 2 GLU 125 C . ? GLU 160 C PRO 126 C ? PRO 161 C 1 1.66 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 601 ? 4 'binding site for residue ZN A 601' AC2 Software C ZN 601 ? 4 'binding site for residue ZN C 601' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 21 ? HIS A 49 . ? 1_555 ? 2 AC1 4 CYS B 4 ? CYS B 479 . ? 1_555 ? 3 AC1 4 CYS B 7 ? CYS B 482 . ? 1_555 ? 4 AC1 4 HIS B 13 ? HIS B 488 . ? 1_555 ? 5 AC2 4 HIS C 21 ? HIS C 49 . ? 1_555 ? 6 AC2 4 CYS D 4 ? CYS D 479 . ? 1_555 ? 7 AC2 4 CYS D 7 ? CYS D 482 . ? 1_555 ? 8 AC2 4 HIS D 13 ? HIS D 488 . ? 1_555 ? # _atom_sites.entry_id 5WE1 _atom_sites.fract_transf_matrix[1][1] 0.015126 _atom_sites.fract_transf_matrix[1][2] 0.008733 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017466 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008120 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 29 ? ? ? A . n A 1 2 GLU 2 30 ? ? ? A . n A 1 3 SER 3 31 ? ? ? A . n A 1 4 SER 4 32 32 SER SER A . n A 1 5 ILE 5 33 33 ILE ILE A . n A 1 6 VAL 6 34 34 VAL VAL A . n A 1 7 ASN 7 35 35 ASN ASN A . n A 1 8 ALA 8 36 36 ALA ALA A . n A 1 9 CYS 9 37 37 CYS CYS A . n A 1 10 LEU 10 38 38 LEU LEU A . n A 1 11 ARG 11 39 39 ARG ARG A . n A 1 12 TYR 12 40 40 TYR TYR A . n A 1 13 LEU 13 41 41 LEU LEU A . n A 1 14 GLY 14 42 42 GLY GLY A . n A 1 15 TYR 15 43 43 TYR TYR A . n A 1 16 SER 16 44 44 SER SER A . n A 1 17 LYS 17 45 45 LYS LYS A . n A 1 18 SER 18 46 46 SER SER A . n A 1 19 MET 19 47 47 MET MET A . n A 1 20 CYS 20 48 48 CYS CYS A . n A 1 21 HIS 21 49 49 HIS HIS A . n A 1 22 GLU 22 50 50 GLU GLU A . n A 1 23 LYS 23 51 51 LYS LYS A . n A 1 24 MET 24 52 52 MET MET A . n A 1 25 PRO 25 53 53 PRO PRO A . n A 1 26 ILE 26 54 54 ILE ILE A . n A 1 27 PHE 27 55 55 PHE PHE A . n A 1 28 MET 28 56 56 MET MET A . n A 1 29 ASP 29 57 57 ASP ASP A . n A 1 30 ILE 30 58 58 ILE ILE A . n A 1 31 ALA 31 59 59 ALA ALA A . n A 1 32 PHE 32 60 60 PHE PHE A . n A 1 33 ILE 33 61 61 ILE ILE A . n A 1 34 GLU 34 62 62 GLU GLU A . n A 1 35 TYR 35 63 63 TYR TYR A . n A 1 36 CYS 36 64 64 CYS CYS A . n A 1 37 PHE 37 65 65 PHE PHE A . n A 1 38 ASN 38 66 66 ASN ASN A . n A 1 39 LEU 39 67 67 LEU LEU A . n A 1 40 SER 40 68 68 SER SER A . n A 1 41 LEU 41 76 ? ? ? A . n A 1 42 ASP 42 77 ? ? ? A . n A 1 43 PRO 43 78 ? ? ? A . n A 1 44 SER 44 79 ? ? ? A . n A 1 45 SER 45 80 ? ? ? A . n A 1 46 PHE 46 81 ? ? ? A . n A 1 47 GLN 47 82 ? ? ? A . n A 1 48 GLY 48 83 ? ? ? A . n A 1 49 GLY 49 84 ? ? ? A . n A 1 50 ALA 50 85 ? ? ? A . n A 1 51 SER 51 86 86 SER SER A . n A 1 52 GLN 52 87 87 GLN GLN A . n A 1 53 GLN 53 88 88 GLN GLN A . n A 1 54 ILE 54 89 89 ILE ILE A . n A 1 55 LEU 55 90 90 LEU LEU A . n A 1 56 TRP 56 91 91 TRP TRP A . n A 1 57 GLU 57 92 92 GLU GLU A . n A 1 58 TYR 58 93 93 TYR TYR A . n A 1 59 SER 59 94 94 SER SER A . n A 1 60 LEU 60 95 95 LEU LEU A . n A 1 61 ILE 61 96 96 ILE ILE A . n A 1 62 SER 62 97 97 SER SER A . n A 1 63 ASN 63 98 98 ASN ASN A . n A 1 64 ALA 64 99 99 ALA ALA A . n A 1 65 LEU 65 100 100 LEU LEU A . n A 1 66 GLU 66 101 101 GLU GLU A . n A 1 67 ARG 67 102 102 ARG ARG A . n A 1 68 LEU 68 103 103 LEU LEU A . n A 1 69 GLU 69 104 104 GLU GLU A . n A 1 70 ASN 70 105 105 ASN ASN A . n A 1 71 ILE 71 106 106 ILE ILE A . n A 1 72 GLU 72 107 107 GLU GLU A . n A 1 73 LEU 73 108 108 LEU LEU A . n A 1 74 GLU 74 109 109 GLU GLU A . n A 1 75 ARG 75 110 110 ARG ARG A . n A 1 76 GLN 76 111 111 GLN GLN A . n A 1 77 ASN 77 112 112 ASN ASN A . n A 1 78 CYS 78 113 113 CYS CYS A . n A 1 79 MET 79 114 114 MET MET A . n A 1 80 ARG 80 115 115 ARG ARG A . n A 1 81 GLU 81 116 ? ? ? A . n A 1 82 ASP 82 117 ? ? ? A . n A 1 83 GLY 83 118 ? ? ? A . n A 1 84 LEU 84 119 ? ? ? A . n A 1 85 SER 85 120 ? ? ? A . n A 1 86 LYS 86 121 ? ? ? A . n A 1 87 TYR 87 122 ? ? ? A . n A 1 88 THR 88 123 ? ? ? A . n A 1 89 ASN 89 124 ? ? ? A . n A 1 90 SER 90 125 ? ? ? A . n A 1 91 LEU 91 126 ? ? ? A . n A 1 92 LEU 92 127 127 LEU LEU A . n A 1 93 LEU 93 128 128 LEU LEU A . n A 1 94 ASN 94 129 129 ASN ASN A . n A 1 95 LYS 95 130 130 LYS LYS A . n A 1 96 GLU 96 131 131 GLU GLU A . n A 1 97 THR 97 132 132 THR THR A . n A 1 98 LEU 98 133 133 LEU LEU A . n A 1 99 ASN 99 134 134 ASN ASN A . n A 1 100 ASN 100 135 135 ASN ASN A . n A 1 101 GLU 101 136 136 GLU GLU A . n A 1 102 ALA 102 137 137 ALA ALA A . n A 1 103 LEU 103 138 138 LEU LEU A . n A 1 104 LYS 104 139 139 LYS LYS A . n A 1 105 LEU 105 140 140 LEU LEU A . n A 1 106 TYR 106 141 141 TYR TYR A . n A 1 107 SER 107 142 142 SER SER A . n A 1 108 CYS 108 143 143 CYS CYS A . n A 1 109 ALA 109 144 144 ALA ALA A . n A 1 110 LYS 110 145 145 LYS LYS A . n A 1 111 ALA 111 146 146 ALA ALA A . n A 1 112 GLY 112 147 147 GLY GLY A . n A 1 113 ILE 113 148 148 ILE ILE A . n A 1 114 CYS 114 149 149 CYS CYS A . n A 1 115 ARG 115 150 150 ARG ARG A . n A 1 116 TRP 116 151 151 TRP TRP A . n A 1 117 MET 117 152 152 MET MET A . n A 1 118 ALA 118 153 153 ALA ALA A . n A 1 119 PHE 119 154 154 PHE PHE A . n A 1 120 HIS 120 155 155 HIS HIS A . n A 1 121 PHE 121 156 156 PHE PHE A . n A 1 122 LEU 122 157 157 LEU LEU A . n A 1 123 GLU 123 158 158 GLU GLU A . n A 1 124 GLN 124 159 159 GLN GLN A . n A 1 125 GLU 125 160 160 GLU GLU A . n A 1 126 PRO 126 161 161 PRO PRO A . n A 1 127 ILE 127 162 162 ILE ILE A . n A 1 128 ASP 128 163 163 ASP ASP A . n A 1 129 HIS 129 164 164 HIS HIS A . n A 1 130 ILE 130 165 165 ILE ILE A . n A 1 131 ASN 131 166 166 ASN ASN A . n A 1 132 PHE 132 167 167 PHE PHE A . n A 1 133 THR 133 168 168 THR THR A . n A 1 134 LYS 134 169 169 LYS LYS A . n A 1 135 PHE 135 170 170 PHE PHE A . n A 1 136 LEU 136 171 171 LEU LEU A . n A 1 137 GLN 137 172 172 GLN GLN A . n A 1 138 ASP 138 173 173 ASP ASP A . n A 1 139 TRP 139 174 174 TRP TRP A . n A 1 140 GLY 140 175 175 GLY GLY A . n A 1 141 SER 141 176 176 SER SER A . n A 1 142 HIS 142 177 177 HIS HIS A . n A 1 143 ASN 143 178 178 ASN ASN A . n A 1 144 GLU 144 179 179 GLU GLU A . n A 1 145 LYS 145 180 180 LYS LYS A . n A 1 146 GLU 146 181 181 GLU GLU A . n A 1 147 MET 147 182 182 MET MET A . n A 1 148 GLU 148 183 183 GLU GLU A . n A 1 149 ALA 149 184 184 ALA ALA A . n A 1 150 LEU 150 185 185 LEU LEU A . n A 1 151 GLN 151 186 186 GLN GLN A . n A 1 152 ARG 152 187 187 ARG ARG A . n A 1 153 LEU 153 188 188 LEU LEU A . n A 1 154 SER 154 189 189 SER SER A . n A 1 155 LYS 155 190 190 LYS LYS A . n A 1 156 HIS 156 191 191 HIS HIS A . n A 1 157 LYS 157 192 192 LYS LYS A . n A 1 158 ILE 158 193 193 ILE ILE A . n A 1 159 ARG 159 194 194 ARG ARG A . n A 1 160 LYS 160 195 195 LYS LYS A . n A 1 161 ARG 161 196 196 ARG ARG A . n A 1 162 LEU 162 197 197 LEU LEU A . n A 1 163 ILE 163 198 198 ILE ILE A . n A 1 164 TYR 164 199 199 TYR TYR A . n A 1 165 VAL 165 200 200 VAL VAL A . n A 1 166 SER 166 201 201 SER SER A . n A 1 167 GLN 167 202 202 GLN GLN A . n A 1 168 HIS 168 203 203 HIS HIS A . n A 1 169 LYS 169 204 204 LYS LYS A . n A 1 170 LYS 170 205 205 LYS LYS A . n A 1 171 LYS 171 206 206 LYS LYS A . n A 1 172 MET 172 207 207 MET MET A . n A 1 173 PRO 173 208 208 PRO PRO A . n A 1 174 TRP 174 209 209 TRP TRP A . n A 1 175 SER 175 210 210 SER SER A . n A 1 176 LYS 176 211 211 LYS LYS A . n A 1 177 PHE 177 212 212 PHE PHE A . n A 1 178 ASN 178 213 213 ASN ASN A . n A 1 179 SER 179 214 214 SER SER A . n A 1 180 VAL 180 215 215 VAL VAL A . n A 1 181 LEU 181 216 216 LEU LEU A . n A 1 182 SER 182 217 217 SER SER A . n A 1 183 ARG 183 218 218 ARG ARG A . n A 1 184 TYR 184 219 219 TYR TYR A . n A 1 185 ILE 185 220 220 ILE ILE A . n A 1 186 GLN 186 221 221 GLN GLN A . n A 1 187 CYS 187 222 222 CYS CYS A . n A 1 188 THR 188 223 223 THR THR A . n A 1 189 LYS 189 224 224 LYS LYS A . n A 1 190 LEU 190 225 225 LEU LEU A . n A 1 191 GLN 191 226 226 GLN GLN A . n A 1 192 LEU 192 227 227 LEU LEU A . n A 1 193 GLU 193 228 228 GLU GLU A . n A 1 194 VAL 194 229 229 VAL VAL A . n A 1 195 PHE 195 230 230 PHE PHE A . n A 1 196 CYS 196 231 231 CYS CYS A . n A 1 197 ASP 197 232 232 ASP ASP A . n A 1 198 TYR 198 233 233 TYR TYR A . n A 1 199 ASP 199 234 234 ASP ASP A . n A 1 200 PHE 200 235 235 PHE PHE A . n A 1 201 LYS 201 236 236 LYS LYS A . n A 1 202 GLN 202 237 237 GLN ALA A . n A 1 203 ARG 203 238 ? ? ? A . n A 1 204 GLU 204 239 ? ? ? A . n A 1 205 ILE 205 240 ? ? ? A . n A 1 206 VAL 206 241 ? ? ? A . n A 1 207 LYS 207 242 ? ? ? A . n A 1 208 MET 208 243 ? ? ? A . n A 1 209 LEU 209 244 ? ? ? A . n A 1 210 THR 210 245 ? ? ? A . n A 1 211 SER 211 246 ? ? ? A . n A 1 212 ASN 212 247 ? ? ? A . n A 1 213 ILE 213 248 ? ? ? A . n A 1 214 ASN 214 249 ? ? ? A . n B 2 1 SER 1 476 ? ? ? B . n B 2 2 GLU 2 477 ? ? ? B . n B 2 3 ALA 3 478 ? ? ? B . n B 2 4 CYS 4 479 479 CYS CYS B . n B 2 5 GLU 5 480 480 GLU GLU B . n B 2 6 MET 6 481 481 MET MET B . n B 2 7 CYS 7 482 482 CYS CYS B . n B 2 8 ARG 8 483 483 ARG ARG B . n B 2 9 LEU 9 484 484 LEU LEU B . n B 2 10 GLY 10 485 485 GLY GLY B . n B 2 11 LEU 11 486 486 LEU LEU B . n B 2 12 PRO 12 487 487 PRO PRO B . n B 2 13 HIS 13 488 488 HIS HIS B . n B 2 14 GLY 14 489 489 GLY GLY B . n B 2 15 SER 15 490 490 SER SER B . n B 2 16 PHE 16 491 491 PHE PHE B . n B 2 17 PHE 17 492 492 PHE PHE B . n B 2 18 GLU 18 493 493 GLU GLU B . n B 2 19 LEU 19 494 494 LEU LEU B . n B 2 20 LEU 20 495 495 LEU LEU B . n B 2 21 ARG 21 496 496 ARG ARG B . n B 2 22 ASP 22 497 497 ASP ASP B . n B 2 23 TRP 23 498 498 TRP TRP B . n B 2 24 LYS 24 499 499 LYS LYS B . n B 2 25 LYS 25 500 500 LYS LYS B . n B 2 26 ILE 26 501 501 ILE ILE B . n B 2 27 GLU 27 502 502 GLU GLU B . n B 2 28 GLU 28 503 503 GLU GLU B . n B 2 29 PHE 29 504 504 PHE PHE B . n B 2 30 ARG 30 505 505 ARG ARG B . n B 2 31 ASN 31 506 506 ASN ASN B . n B 2 32 LYS 32 507 507 LYS LYS B . n B 2 33 SER 33 508 ? ? ? B . n C 1 1 SER 1 29 ? ? ? C . n C 1 2 GLU 2 30 ? ? ? C . n C 1 3 SER 3 31 31 SER SER C . n C 1 4 SER 4 32 32 SER SER C . n C 1 5 ILE 5 33 33 ILE ILE C . n C 1 6 VAL 6 34 34 VAL VAL C . n C 1 7 ASN 7 35 35 ASN ASN C . n C 1 8 ALA 8 36 36 ALA ALA C . n C 1 9 CYS 9 37 37 CYS CYS C . n C 1 10 LEU 10 38 38 LEU LEU C . n C 1 11 ARG 11 39 39 ARG ARG C . n C 1 12 TYR 12 40 40 TYR TYR C . n C 1 13 LEU 13 41 41 LEU LEU C . n C 1 14 GLY 14 42 42 GLY GLY C . n C 1 15 TYR 15 43 43 TYR TYR C . n C 1 16 SER 16 44 44 SER SER C . n C 1 17 LYS 17 45 45 LYS LYS C . n C 1 18 SER 18 46 46 SER SER C . n C 1 19 MET 19 47 47 MET MET C . n C 1 20 CYS 20 48 48 CYS CYS C . n C 1 21 HIS 21 49 49 HIS HIS C . n C 1 22 GLU 22 50 50 GLU GLU C . n C 1 23 LYS 23 51 51 LYS LYS C . n C 1 24 MET 24 52 52 MET MET C . n C 1 25 PRO 25 53 53 PRO PRO C . n C 1 26 ILE 26 54 54 ILE ILE C . n C 1 27 PHE 27 55 55 PHE PHE C . n C 1 28 MET 28 56 56 MET MET C . n C 1 29 ASP 29 57 57 ASP ASP C . n C 1 30 ILE 30 58 58 ILE ILE C . n C 1 31 ALA 31 59 59 ALA ALA C . n C 1 32 PHE 32 60 60 PHE PHE C . n C 1 33 ILE 33 61 61 ILE ILE C . n C 1 34 GLU 34 62 62 GLU GLU C . n C 1 35 TYR 35 63 63 TYR TYR C . n C 1 36 CYS 36 64 64 CYS CYS C . n C 1 37 PHE 37 65 65 PHE PHE C . n C 1 38 ASN 38 66 66 ASN ASN C . n C 1 39 LEU 39 67 67 LEU LEU C . n C 1 40 SER 40 68 68 SER SER C . n C 1 41 LEU 41 69 69 LEU LEU C . n C 1 42 ASP 42 77 ? ? ? C . n C 1 43 PRO 43 78 ? ? ? C . n C 1 44 SER 44 79 ? ? ? C . n C 1 45 SER 45 80 ? ? ? C . n C 1 46 PHE 46 81 ? ? ? C . n C 1 47 GLN 47 82 ? ? ? C . n C 1 48 GLY 48 83 ? ? ? C . n C 1 49 GLY 49 84 ? ? ? C . n C 1 50 ALA 50 85 ? ? ? C . n C 1 51 SER 51 86 86 SER SER C . n C 1 52 GLN 52 87 87 GLN GLN C . n C 1 53 GLN 53 88 88 GLN GLN C . n C 1 54 ILE 54 89 89 ILE ILE C . n C 1 55 LEU 55 90 90 LEU LEU C . n C 1 56 TRP 56 91 91 TRP TRP C . n C 1 57 GLU 57 92 92 GLU GLU C . n C 1 58 TYR 58 93 93 TYR TYR C . n C 1 59 SER 59 94 94 SER SER C . n C 1 60 LEU 60 95 95 LEU LEU C . n C 1 61 ILE 61 96 96 ILE ILE C . n C 1 62 SER 62 97 97 SER SER C . n C 1 63 ASN 63 98 98 ASN ASN C . n C 1 64 ALA 64 99 99 ALA ALA C . n C 1 65 LEU 65 100 100 LEU LEU C . n C 1 66 GLU 66 101 101 GLU GLU C . n C 1 67 ARG 67 102 102 ARG ARG C . n C 1 68 LEU 68 103 103 LEU LEU C . n C 1 69 GLU 69 104 104 GLU GLU C . n C 1 70 ASN 70 105 105 ASN ASN C . n C 1 71 ILE 71 106 106 ILE ILE C . n C 1 72 GLU 72 107 107 GLU GLU C . n C 1 73 LEU 73 108 108 LEU LEU C . n C 1 74 GLU 74 109 109 GLU GLU C . n C 1 75 ARG 75 110 110 ARG ARG C . n C 1 76 GLN 76 111 111 GLN GLN C . n C 1 77 ASN 77 112 112 ASN ASN C . n C 1 78 CYS 78 113 113 CYS CYS C . n C 1 79 MET 79 114 114 MET MET C . n C 1 80 ARG 80 115 115 ARG ARG C . n C 1 81 GLU 81 116 ? ? ? C . n C 1 82 ASP 82 117 ? ? ? C . n C 1 83 GLY 83 118 ? ? ? C . n C 1 84 LEU 84 119 ? ? ? C . n C 1 85 SER 85 120 ? ? ? C . n C 1 86 LYS 86 121 ? ? ? C . n C 1 87 TYR 87 122 ? ? ? C . n C 1 88 THR 88 123 ? ? ? C . n C 1 89 ASN 89 124 ? ? ? C . n C 1 90 SER 90 125 ? ? ? C . n C 1 91 LEU 91 126 ? ? ? C . n C 1 92 LEU 92 127 127 LEU LEU C . n C 1 93 LEU 93 128 128 LEU LEU C . n C 1 94 ASN 94 129 129 ASN ASN C . n C 1 95 LYS 95 130 130 LYS LYS C . n C 1 96 GLU 96 131 131 GLU GLU C . n C 1 97 THR 97 132 132 THR THR C . n C 1 98 LEU 98 133 133 LEU LEU C . n C 1 99 ASN 99 134 134 ASN ASN C . n C 1 100 ASN 100 135 135 ASN ASN C . n C 1 101 GLU 101 136 136 GLU GLU C . n C 1 102 ALA 102 137 137 ALA ALA C . n C 1 103 LEU 103 138 138 LEU LEU C . n C 1 104 LYS 104 139 139 LYS LYS C . n C 1 105 LEU 105 140 140 LEU LEU C . n C 1 106 TYR 106 141 141 TYR TYR C . n C 1 107 SER 107 142 142 SER SER C . n C 1 108 CYS 108 143 143 CYS CYS C . n C 1 109 ALA 109 144 144 ALA ALA C . n C 1 110 LYS 110 145 145 LYS LYS C . n C 1 111 ALA 111 146 146 ALA ALA C . n C 1 112 GLY 112 147 147 GLY GLY C . n C 1 113 ILE 113 148 148 ILE ILE C . n C 1 114 CYS 114 149 149 CYS CYS C . n C 1 115 ARG 115 150 150 ARG ARG C . n C 1 116 TRP 116 151 151 TRP TRP C . n C 1 117 MET 117 152 152 MET MET C . n C 1 118 ALA 118 153 153 ALA ALA C . n C 1 119 PHE 119 154 154 PHE PHE C . n C 1 120 HIS 120 155 155 HIS HIS C . n C 1 121 PHE 121 156 156 PHE PHE C . n C 1 122 LEU 122 157 157 LEU LEU C . n C 1 123 GLU 123 158 158 GLU GLU C . n C 1 124 GLN 124 159 159 GLN GLN C . n C 1 125 GLU 125 160 160 GLU GLU C . n C 1 126 PRO 126 161 161 PRO PRO C . n C 1 127 ILE 127 162 162 ILE ILE C . n C 1 128 ASP 128 163 163 ASP ASP C . n C 1 129 HIS 129 164 164 HIS HIS C . n C 1 130 ILE 130 165 165 ILE ILE C . n C 1 131 ASN 131 166 166 ASN ASN C . n C 1 132 PHE 132 167 167 PHE PHE C . n C 1 133 THR 133 168 168 THR THR C . n C 1 134 LYS 134 169 169 LYS LYS C . n C 1 135 PHE 135 170 170 PHE PHE C . n C 1 136 LEU 136 171 171 LEU LEU C . n C 1 137 GLN 137 172 172 GLN GLN C . n C 1 138 ASP 138 173 173 ASP ASP C . n C 1 139 TRP 139 174 174 TRP TRP C . n C 1 140 GLY 140 175 175 GLY GLY C . n C 1 141 SER 141 176 176 SER SER C . n C 1 142 HIS 142 177 177 HIS HIS C . n C 1 143 ASN 143 178 178 ASN ASN C . n C 1 144 GLU 144 179 179 GLU GLU C . n C 1 145 LYS 145 180 180 LYS LYS C . n C 1 146 GLU 146 181 181 GLU GLU C . n C 1 147 MET 147 182 182 MET MET C . n C 1 148 GLU 148 183 183 GLU GLU C . n C 1 149 ALA 149 184 184 ALA ALA C . n C 1 150 LEU 150 185 185 LEU LEU C . n C 1 151 GLN 151 186 186 GLN GLN C . n C 1 152 ARG 152 187 187 ARG ARG C . n C 1 153 LEU 153 188 188 LEU LEU C . n C 1 154 SER 154 189 189 SER SER C . n C 1 155 LYS 155 190 190 LYS LYS C . n C 1 156 HIS 156 191 191 HIS HIS C . n C 1 157 LYS 157 192 192 LYS LYS C . n C 1 158 ILE 158 193 193 ILE ILE C . n C 1 159 ARG 159 194 194 ARG ARG C . n C 1 160 LYS 160 195 195 LYS LYS C . n C 1 161 ARG 161 196 196 ARG ARG C . n C 1 162 LEU 162 197 197 LEU LEU C . n C 1 163 ILE 163 198 198 ILE ILE C . n C 1 164 TYR 164 199 199 TYR TYR C . n C 1 165 VAL 165 200 200 VAL VAL C . n C 1 166 SER 166 201 201 SER SER C . n C 1 167 GLN 167 202 202 GLN GLN C . n C 1 168 HIS 168 203 203 HIS HIS C . n C 1 169 LYS 169 204 204 LYS LYS C . n C 1 170 LYS 170 205 205 LYS LYS C . n C 1 171 LYS 171 206 206 LYS LYS C . n C 1 172 MET 172 207 207 MET MET C . n C 1 173 PRO 173 208 208 PRO PRO C . n C 1 174 TRP 174 209 209 TRP TRP C . n C 1 175 SER 175 210 210 SER SER C . n C 1 176 LYS 176 211 211 LYS LYS C . n C 1 177 PHE 177 212 212 PHE PHE C . n C 1 178 ASN 178 213 213 ASN ASN C . n C 1 179 SER 179 214 214 SER SER C . n C 1 180 VAL 180 215 215 VAL VAL C . n C 1 181 LEU 181 216 216 LEU LEU C . n C 1 182 SER 182 217 217 SER SER C . n C 1 183 ARG 183 218 218 ARG ARG C . n C 1 184 TYR 184 219 219 TYR TYR C . n C 1 185 ILE 185 220 220 ILE ILE C . n C 1 186 GLN 186 221 221 GLN GLN C . n C 1 187 CYS 187 222 222 CYS CYS C . n C 1 188 THR 188 223 223 THR THR C . n C 1 189 LYS 189 224 224 LYS LYS C . n C 1 190 LEU 190 225 225 LEU LEU C . n C 1 191 GLN 191 226 226 GLN GLN C . n C 1 192 LEU 192 227 227 LEU LEU C . n C 1 193 GLU 193 228 228 GLU GLU C . n C 1 194 VAL 194 229 229 VAL VAL C . n C 1 195 PHE 195 230 230 PHE PHE C . n C 1 196 CYS 196 231 231 CYS CYS C . n C 1 197 ASP 197 232 232 ASP ASP C . n C 1 198 TYR 198 233 233 TYR TYR C . n C 1 199 ASP 199 234 234 ASP ASP C . n C 1 200 PHE 200 235 235 PHE PHE C . n C 1 201 LYS 201 236 236 LYS LYS C . n C 1 202 GLN 202 237 237 GLN ALA C . n C 1 203 ARG 203 238 ? ? ? C . n C 1 204 GLU 204 239 ? ? ? C . n C 1 205 ILE 205 240 ? ? ? C . n C 1 206 VAL 206 241 ? ? ? C . n C 1 207 LYS 207 242 ? ? ? C . n C 1 208 MET 208 243 ? ? ? C . n C 1 209 LEU 209 244 ? ? ? C . n C 1 210 THR 210 245 ? ? ? C . n C 1 211 SER 211 246 ? ? ? C . n C 1 212 ASN 212 247 ? ? ? C . n C 1 213 ILE 213 248 ? ? ? C . n C 1 214 ASN 214 249 ? ? ? C . n D 2 1 SER 1 476 ? ? ? D . n D 2 2 GLU 2 477 ? ? ? D . n D 2 3 ALA 3 478 478 ALA ALA D . n D 2 4 CYS 4 479 479 CYS CYS D . n D 2 5 GLU 5 480 480 GLU GLU D . n D 2 6 MET 6 481 481 MET MET D . n D 2 7 CYS 7 482 482 CYS CYS D . n D 2 8 ARG 8 483 483 ARG ARG D . n D 2 9 LEU 9 484 484 LEU LEU D . n D 2 10 GLY 10 485 485 GLY GLY D . n D 2 11 LEU 11 486 486 LEU LEU D . n D 2 12 PRO 12 487 487 PRO PRO D . n D 2 13 HIS 13 488 488 HIS HIS D . n D 2 14 GLY 14 489 489 GLY GLY D . n D 2 15 SER 15 490 490 SER SER D . n D 2 16 PHE 16 491 491 PHE PHE D . n D 2 17 PHE 17 492 492 PHE PHE D . n D 2 18 GLU 18 493 493 GLU GLU D . n D 2 19 LEU 19 494 494 LEU LEU D . n D 2 20 LEU 20 495 495 LEU LEU D . n D 2 21 ARG 21 496 496 ARG ARG D . n D 2 22 ASP 22 497 497 ASP ASP D . n D 2 23 TRP 23 498 498 TRP TRP D . n D 2 24 LYS 24 499 499 LYS LYS D . n D 2 25 LYS 25 500 500 LYS LYS D . n D 2 26 ILE 26 501 501 ILE ILE D . n D 2 27 GLU 27 502 502 GLU GLU D . n D 2 28 GLU 28 503 503 GLU GLU D . n D 2 29 PHE 29 504 504 PHE PHE D . n D 2 30 ARG 30 505 505 ARG ARG D . n D 2 31 ASN 31 506 506 ASN ASN D . n D 2 32 LYS 32 507 507 LYS LYS D . n D 2 33 SER 33 508 ? ? ? D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 ZN 1 601 1 ZN ZN A . F 3 ZN 1 601 2 ZN ZN C . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6610 ? 1 MORE -142 ? 1 'SSA (A^2)' 24420 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 21 ? A HIS 49 ? 1_555 ZN ? E ZN . ? A ZN 601 ? 1_555 SG ? B CYS 4 ? B CYS 479 ? 1_555 123.8 ? 2 NE2 ? A HIS 21 ? A HIS 49 ? 1_555 ZN ? E ZN . ? A ZN 601 ? 1_555 SG ? B CYS 7 ? B CYS 482 ? 1_555 71.2 ? 3 SG ? B CYS 4 ? B CYS 479 ? 1_555 ZN ? E ZN . ? A ZN 601 ? 1_555 SG ? B CYS 7 ? B CYS 482 ? 1_555 161.7 ? 4 NE2 ? A HIS 21 ? A HIS 49 ? 1_555 ZN ? E ZN . ? A ZN 601 ? 1_555 NE2 ? B HIS 13 ? B HIS 488 ? 1_555 104.8 ? 5 SG ? B CYS 4 ? B CYS 479 ? 1_555 ZN ? E ZN . ? A ZN 601 ? 1_555 NE2 ? B HIS 13 ? B HIS 488 ? 1_555 107.6 ? 6 SG ? B CYS 7 ? B CYS 482 ? 1_555 ZN ? E ZN . ? A ZN 601 ? 1_555 NE2 ? B HIS 13 ? B HIS 488 ? 1_555 74.9 ? 7 NE2 ? C HIS 21 ? C HIS 49 ? 1_555 ZN ? F ZN . ? C ZN 601 ? 1_555 SG ? D CYS 4 ? D CYS 479 ? 1_555 118.1 ? 8 NE2 ? C HIS 21 ? C HIS 49 ? 1_555 ZN ? F ZN . ? C ZN 601 ? 1_555 SG ? D CYS 7 ? D CYS 482 ? 1_555 71.9 ? 9 SG ? D CYS 4 ? D CYS 479 ? 1_555 ZN ? F ZN . ? C ZN 601 ? 1_555 SG ? D CYS 7 ? D CYS 482 ? 1_555 147.0 ? 10 NE2 ? C HIS 21 ? C HIS 49 ? 1_555 ZN ? F ZN . ? C ZN 601 ? 1_555 NE2 ? D HIS 13 ? D HIS 488 ? 1_555 102.3 ? 11 SG ? D CYS 4 ? D CYS 479 ? 1_555 ZN ? F ZN . ? C ZN 601 ? 1_555 NE2 ? D HIS 13 ? D HIS 488 ? 1_555 123.9 ? 12 SG ? D CYS 7 ? D CYS 482 ? 1_555 ZN ? F ZN . ? C ZN 601 ? 1_555 NE2 ? D HIS 13 ? D HIS 488 ? 1_555 79.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-12-20 2 'Structure model' 1 1 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_initial_refinement_model 5 2 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 4 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 5 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 6 2 'Structure model' '_struct_conn.ptnr1_label_asym_id' 7 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 2 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 11 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 2 'Structure model' '_struct_conn.ptnr2_label_seq_id' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.8 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 3 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? 7.2.1 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 5 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 6 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 C _pdbx_validate_close_contact.auth_comp_id_1 TYR _pdbx_validate_close_contact.auth_seq_id_1 93 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OG _pdbx_validate_close_contact.auth_asym_id_2 C _pdbx_validate_close_contact.auth_comp_id_2 SER _pdbx_validate_close_contact.auth_seq_id_2 97 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.18 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE1 _pdbx_validate_symm_contact.auth_asym_id_1 C _pdbx_validate_symm_contact.auth_comp_id_1 GLU _pdbx_validate_symm_contact.auth_seq_id_1 131 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NH2 _pdbx_validate_symm_contact.auth_asym_id_2 D _pdbx_validate_symm_contact.auth_comp_id_2 ARG _pdbx_validate_symm_contact.auth_seq_id_2 496 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_674 _pdbx_validate_symm_contact.dist 2.14 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 114 ? ? -83.68 44.83 2 1 LEU A 171 ? ? -81.97 46.53 3 1 SER A 176 ? ? -44.82 157.50 4 1 VAL A 229 ? ? -82.32 -75.15 5 1 MET C 114 ? ? -79.24 47.93 6 1 VAL C 229 ? ? -83.16 -72.33 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 237 ? CG ? A GLN 202 CG 2 1 Y 1 A GLN 237 ? CD ? A GLN 202 CD 3 1 Y 1 A GLN 237 ? OE1 ? A GLN 202 OE1 4 1 Y 1 A GLN 237 ? NE2 ? A GLN 202 NE2 5 1 Y 1 C GLN 237 ? CG ? C GLN 202 CG 6 1 Y 1 C GLN 237 ? CD ? C GLN 202 CD 7 1 Y 1 C GLN 237 ? OE1 ? C GLN 202 OE1 8 1 Y 1 C GLN 237 ? NE2 ? C GLN 202 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 29 ? A SER 1 2 1 Y 1 A GLU 30 ? A GLU 2 3 1 Y 1 A SER 31 ? A SER 3 4 1 Y 1 A LEU 76 ? A LEU 41 5 1 Y 1 A ASP 77 ? A ASP 42 6 1 Y 1 A PRO 78 ? A PRO 43 7 1 Y 1 A SER 79 ? A SER 44 8 1 Y 1 A SER 80 ? A SER 45 9 1 Y 1 A PHE 81 ? A PHE 46 10 1 Y 1 A GLN 82 ? A GLN 47 11 1 Y 1 A GLY 83 ? A GLY 48 12 1 Y 1 A GLY 84 ? A GLY 49 13 1 Y 1 A ALA 85 ? A ALA 50 14 1 Y 1 A GLU 116 ? A GLU 81 15 1 Y 1 A ASP 117 ? A ASP 82 16 1 Y 1 A GLY 118 ? A GLY 83 17 1 Y 1 A LEU 119 ? A LEU 84 18 1 Y 1 A SER 120 ? A SER 85 19 1 Y 1 A LYS 121 ? A LYS 86 20 1 Y 1 A TYR 122 ? A TYR 87 21 1 Y 1 A THR 123 ? A THR 88 22 1 Y 1 A ASN 124 ? A ASN 89 23 1 Y 1 A SER 125 ? A SER 90 24 1 Y 1 A LEU 126 ? A LEU 91 25 1 Y 1 A ARG 238 ? A ARG 203 26 1 Y 1 A GLU 239 ? A GLU 204 27 1 Y 1 A ILE 240 ? A ILE 205 28 1 Y 1 A VAL 241 ? A VAL 206 29 1 Y 1 A LYS 242 ? A LYS 207 30 1 Y 1 A MET 243 ? A MET 208 31 1 Y 1 A LEU 244 ? A LEU 209 32 1 Y 1 A THR 245 ? A THR 210 33 1 Y 1 A SER 246 ? A SER 211 34 1 Y 1 A ASN 247 ? A ASN 212 35 1 Y 1 A ILE 248 ? A ILE 213 36 1 Y 1 A ASN 249 ? A ASN 214 37 1 Y 1 B SER 476 ? B SER 1 38 1 Y 1 B GLU 477 ? B GLU 2 39 1 Y 1 B ALA 478 ? B ALA 3 40 1 Y 1 B SER 508 ? B SER 33 41 1 Y 1 C SER 29 ? C SER 1 42 1 Y 1 C GLU 30 ? C GLU 2 43 1 Y 1 C ASP 77 ? C ASP 42 44 1 Y 1 C PRO 78 ? C PRO 43 45 1 Y 1 C SER 79 ? C SER 44 46 1 Y 1 C SER 80 ? C SER 45 47 1 Y 1 C PHE 81 ? C PHE 46 48 1 Y 1 C GLN 82 ? C GLN 47 49 1 Y 1 C GLY 83 ? C GLY 48 50 1 Y 1 C GLY 84 ? C GLY 49 51 1 Y 1 C ALA 85 ? C ALA 50 52 1 Y 1 C GLU 116 ? C GLU 81 53 1 Y 1 C ASP 117 ? C ASP 82 54 1 Y 1 C GLY 118 ? C GLY 83 55 1 Y 1 C LEU 119 ? C LEU 84 56 1 Y 1 C SER 120 ? C SER 85 57 1 Y 1 C LYS 121 ? C LYS 86 58 1 Y 1 C TYR 122 ? C TYR 87 59 1 Y 1 C THR 123 ? C THR 88 60 1 Y 1 C ASN 124 ? C ASN 89 61 1 Y 1 C SER 125 ? C SER 90 62 1 Y 1 C LEU 126 ? C LEU 91 63 1 Y 1 C ARG 238 ? C ARG 203 64 1 Y 1 C GLU 239 ? C GLU 204 65 1 Y 1 C ILE 240 ? C ILE 205 66 1 Y 1 C VAL 241 ? C VAL 206 67 1 Y 1 C LYS 242 ? C LYS 207 68 1 Y 1 C MET 243 ? C MET 208 69 1 Y 1 C LEU 244 ? C LEU 209 70 1 Y 1 C THR 245 ? C THR 210 71 1 Y 1 C SER 246 ? C SER 211 72 1 Y 1 C ASN 247 ? C ASN 212 73 1 Y 1 C ILE 248 ? C ILE 213 74 1 Y 1 C ASN 249 ? C ASN 214 75 1 Y 1 D SER 476 ? D SER 1 76 1 Y 1 D GLU 477 ? D GLU 2 77 1 Y 1 D SER 508 ? D SER 33 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 ZN ZN ZN N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5WE2 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #