data_5WLQ # _entry.id 5WLQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5WLQ pdb_00005wlq 10.2210/pdb5wlq/pdb WWPDB D_1000229222 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5WLQ _pdbx_database_status.recvd_initial_deposition_date 2017-07-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Andreas, M.P.' 1 ? 'Ajay, G.' 2 ? 'Gellings, J.' 3 ? 'Rayment, I.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Struct. Biol.' _citation.journal_id_ASTM JSBIEM _citation.journal_id_CSD 0803 _citation.journal_id_ISSN 1095-8657 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 200 _citation.language ? _citation.page_first 219 _citation.page_last 228 _citation.title ;Design considerations in coiled-coil fusion constructs for the structural determination of a problematic region of the human cardiac myosin rod. ; _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jsb.2017.07.006 _citation.pdbx_database_id_PubMed 28743637 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Andreas, M.P.' 1 ? primary 'Ajay, G.' 2 ? primary 'Gellings, J.A.' 3 ? primary 'Rayment, I.' 4 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5WLQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 141.756 _cell.length_a_esd ? _cell.length_b 141.756 _cell.length_b_esd ? _cell.length_c 87.381 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5WLQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Capsid assembly scaffolding protein,Myosin-7,Microtubule-associated protein RP/EB family member 1' 20781.934 1 ? ? 'UNP P13848 residues 2-48 UNP Q15691 residues 208-256, UNP P12883 residues 1677-1755' ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn 'trimethylamine oxide' 75.110 4 ? ? ? ? 4 water nat water 18.015 8 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Gene product 7,gp7,Head morphogenesis protein,Protein p7,Scaffold protein,Myosin heavy chain 7,Myosin heavy chain slow isoform,MyHC-slow,Myosin heavy chain,cardiac muscle beta isoform,MyHC-beta,APC-binding protein EB1,End-binding protein 1,EB1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GGSGPLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKRNNLLQAELEELRAVVEQTERSRKLAEQE LIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAEDLEKERDFYFGKLRNIELICQENEGENDP VLQRIVDILYATDEGFVIPD ; _entity_poly.pdbx_seq_one_letter_code_can ;GGSGPLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKRNNLLQAELEELRAVVEQTERSRKLAEQE LIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAEDLEKERDFYFGKLRNIELICQENEGENDP VLQRIVDILYATDEGFVIPD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 SER n 1 4 GLY n 1 5 PRO n 1 6 LEU n 1 7 LYS n 1 8 PRO n 1 9 GLU n 1 10 GLU n 1 11 HIS n 1 12 GLU n 1 13 ASP n 1 14 ILE n 1 15 LEU n 1 16 ASN n 1 17 LYS n 1 18 LEU n 1 19 LEU n 1 20 ASP n 1 21 PRO n 1 22 GLU n 1 23 LEU n 1 24 ALA n 1 25 GLN n 1 26 SER n 1 27 GLU n 1 28 ARG n 1 29 THR n 1 30 GLU n 1 31 ALA n 1 32 LEU n 1 33 GLN n 1 34 GLN n 1 35 LEU n 1 36 ARG n 1 37 VAL n 1 38 ASN n 1 39 TYR n 1 40 GLY n 1 41 SER n 1 42 PHE n 1 43 VAL n 1 44 SER n 1 45 GLU n 1 46 TYR n 1 47 ASN n 1 48 ASP n 1 49 LEU n 1 50 THR n 1 51 LYS n 1 52 ARG n 1 53 ASN n 1 54 ASN n 1 55 LEU n 1 56 LEU n 1 57 GLN n 1 58 ALA n 1 59 GLU n 1 60 LEU n 1 61 GLU n 1 62 GLU n 1 63 LEU n 1 64 ARG n 1 65 ALA n 1 66 VAL n 1 67 VAL n 1 68 GLU n 1 69 GLN n 1 70 THR n 1 71 GLU n 1 72 ARG n 1 73 SER n 1 74 ARG n 1 75 LYS n 1 76 LEU n 1 77 ALA n 1 78 GLU n 1 79 GLN n 1 80 GLU n 1 81 LEU n 1 82 ILE n 1 83 GLU n 1 84 THR n 1 85 SER n 1 86 GLU n 1 87 ARG n 1 88 VAL n 1 89 GLN n 1 90 LEU n 1 91 LEU n 1 92 HIS n 1 93 SER n 1 94 GLN n 1 95 ASN n 1 96 THR n 1 97 SER n 1 98 LEU n 1 99 ILE n 1 100 ASN n 1 101 GLN n 1 102 LYS n 1 103 LYS n 1 104 LYS n 1 105 MET n 1 106 ASP n 1 107 ALA n 1 108 ASP n 1 109 LEU n 1 110 SER n 1 111 GLN n 1 112 LEU n 1 113 GLN n 1 114 THR n 1 115 GLU n 1 116 VAL n 1 117 GLU n 1 118 GLU n 1 119 ALA n 1 120 VAL n 1 121 GLN n 1 122 GLU n 1 123 CYS n 1 124 ARG n 1 125 ASN n 1 126 ALA n 1 127 GLU n 1 128 GLU n 1 129 LYS n 1 130 ALA n 1 131 GLU n 1 132 ASP n 1 133 LEU n 1 134 GLU n 1 135 LYS n 1 136 GLU n 1 137 ARG n 1 138 ASP n 1 139 PHE n 1 140 TYR n 1 141 PHE n 1 142 GLY n 1 143 LYS n 1 144 LEU n 1 145 ARG n 1 146 ASN n 1 147 ILE n 1 148 GLU n 1 149 LEU n 1 150 ILE n 1 151 CYS n 1 152 GLN n 1 153 GLU n 1 154 ASN n 1 155 GLU n 1 156 GLY n 1 157 GLU n 1 158 ASN n 1 159 ASP n 1 160 PRO n 1 161 VAL n 1 162 LEU n 1 163 GLN n 1 164 ARG n 1 165 ILE n 1 166 VAL n 1 167 ASP n 1 168 ILE n 1 169 LEU n 1 170 TYR n 1 171 ALA n 1 172 THR n 1 173 ASP n 1 174 GLU n 1 175 GLY n 1 176 PHE n 1 177 VAL n 1 178 ILE n 1 179 PRO n 1 180 ASP n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 51 ? ? ? ? ? ? ? ? ? 'Bacillus phage phi29' 10756 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 52 130 Human ? 'MYH7, MYHCB' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 3 sample 'Biological sequence' 131 180 Human ? MAPRE1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP SCAF_BPPH2 P13848 ? 1 PLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTK 2 2 UNP MYH7_HUMAN P12883 ? 1 RNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKA 1677 3 UNP MARE1_HUMAN Q15691 ? 1 EDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPD 208 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5WLQ A 5 ? 51 ? P13848 2 ? 48 ? 2 48 2 2 5WLQ A 52 ? 130 ? P12883 1677 ? 1755 ? 1677 1755 3 3 5WLQ A 131 ? 180 ? Q15691 208 ? 257 ? 1756 1805 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5WLQ GLY A 1 ? UNP P13848 ? ? 'expression tag' -2 1 1 5WLQ GLY A 2 ? UNP P13848 ? ? 'expression tag' -1 2 1 5WLQ SER A 3 ? UNP P13848 ? ? 'expression tag' 0 3 1 5WLQ GLY A 4 ? UNP P13848 ? ? 'expression tag' 1 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TMO non-polymer . 'trimethylamine oxide' ? 'C3 H9 N O' 75.110 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5WLQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 6.3 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 80.4 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 9.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.6 M Ammonium Aulfate, 500 mM Trimethyl Ammonium N-Oxide, 100 mM Bis-tris Propane pH 9.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-12-07 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97934 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97934 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5WLQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.1 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9815 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.6 _reflns.pdbx_Rmerge_I_obs 0.117 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.10 _reflns_shell.d_res_low 3.15 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.46 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 478 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.667 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 19.5 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5WLQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.104 _refine.ls_d_res_low 41.161 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9244 _refine.ls_number_reflns_R_free 462 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.31 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2231 _refine.ls_R_factor_R_free 0.2364 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2224 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1IK9 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.75 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.29 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 848 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 25 _refine_hist.number_atoms_solvent 8 _refine_hist.number_atoms_total 881 _refine_hist.d_res_high 3.104 _refine_hist.d_res_low 41.161 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 875 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.486 ? 1180 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.230 ? 549 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.032 ? 132 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 ? 154 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.1036 3.5525 . . 132 2501 83.00 . . . 0.2681 . 0.2454 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5525 4.4749 . . 160 3050 100.00 . . . 0.2027 . 0.2076 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.4749 41.1651 . . 170 3231 100.00 . . . 0.2522 . 0.2253 . . . . . . . . . . # _struct.entry_id 5WLQ _struct.title 'Crystal Structure of Amino Acids 1677-1755 of Human Beta Cardiac Myosin Fused to Gp7 and Eb1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5WLQ _struct_keywords.text 'Myosin, Gp7, Coiled-Coil, Eb1, MOTOR PROTEIN' _struct_keywords.pdbx_keywords 'MOTOR PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 7 ? LEU A 18 ? LYS A 4 LEU A 15 1 ? 12 HELX_P HELX_P2 AA2 ALA A 24 ? LYS A 103 ? ALA A 21 LYS A 1728 1 ? 80 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id B _struct_conn.ptnr1_label_comp_id SO4 _struct_conn.ptnr1_label_seq_id . _struct_conn.ptnr1_label_atom_id O3 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id D _struct_conn.ptnr2_label_comp_id TMO _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id CAD _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id SO4 _struct_conn.ptnr1_auth_seq_id 1901 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id TMO _struct_conn.ptnr2_auth_seq_id 1903 _struct_conn.ptnr2_symmetry 7_565 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.373 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A TMO 1902 ? 2 'binding site for residue TMO A 1902' AC2 Software A TMO 1904 ? 2 'binding site for residue TMO A 1904' AC3 Software A SO4 1901 ? 4 'binding site for residues SO4 A 1901 and TMO A 1903' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 SER A 44 ? SER A 41 . ? 1_555 ? 2 AC1 2 ASN A 47 ? ASN A 44 . ? 1_555 ? 3 AC2 2 LEU A 6 ? LEU A 3 . ? 12_565 ? 4 AC2 2 PHE A 42 ? PHE A 39 . ? 12_565 ? 5 AC3 4 LEU A 23 ? LEU A 20 . ? 12_565 ? 6 AC3 4 GLN A 25 ? GLN A 22 . ? 12_565 ? 7 AC3 4 ARG A 74 ? ARG A 1699 . ? 1_555 ? 8 AC3 4 LYS A 75 ? LYS A 1700 . ? 1_555 ? # _atom_sites.entry_id 5WLQ _atom_sites.fract_transf_matrix[1][1] 0.007054 _atom_sites.fract_transf_matrix[1][2] 0.004073 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008146 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011444 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 GLY 2 -1 ? ? ? A . n A 1 3 SER 3 0 0 SER SER A . n A 1 4 GLY 4 1 1 GLY GLY A . n A 1 5 PRO 5 2 2 PRO PRO A . n A 1 6 LEU 6 3 3 LEU LEU A . n A 1 7 LYS 7 4 4 LYS LYS A . n A 1 8 PRO 8 5 5 PRO PRO A . n A 1 9 GLU 9 6 6 GLU GLU A . n A 1 10 GLU 10 7 7 GLU GLU A . n A 1 11 HIS 11 8 8 HIS HIS A . n A 1 12 GLU 12 9 9 GLU GLU A . n A 1 13 ASP 13 10 10 ASP ASP A . n A 1 14 ILE 14 11 11 ILE ILE A . n A 1 15 LEU 15 12 12 LEU LEU A . n A 1 16 ASN 16 13 13 ASN ASN A . n A 1 17 LYS 17 14 14 LYS LYS A . n A 1 18 LEU 18 15 15 LEU LEU A . n A 1 19 LEU 19 16 16 LEU LEU A . n A 1 20 ASP 20 17 17 ASP ASP A . n A 1 21 PRO 21 18 18 PRO PRO A . n A 1 22 GLU 22 19 19 GLU GLU A . n A 1 23 LEU 23 20 20 LEU LEU A . n A 1 24 ALA 24 21 21 ALA ALA A . n A 1 25 GLN 25 22 22 GLN GLN A . n A 1 26 SER 26 23 23 SER SER A . n A 1 27 GLU 27 24 24 GLU GLU A . n A 1 28 ARG 28 25 25 ARG ARG A . n A 1 29 THR 29 26 26 THR THR A . n A 1 30 GLU 30 27 27 GLU GLU A . n A 1 31 ALA 31 28 28 ALA ALA A . n A 1 32 LEU 32 29 29 LEU LEU A . n A 1 33 GLN 33 30 30 GLN GLN A . n A 1 34 GLN 34 31 31 GLN GLN A . n A 1 35 LEU 35 32 32 LEU LEU A . n A 1 36 ARG 36 33 33 ARG ARG A . n A 1 37 VAL 37 34 34 VAL VAL A . n A 1 38 ASN 38 35 35 ASN ASN A . n A 1 39 TYR 39 36 36 TYR TYR A . n A 1 40 GLY 40 37 37 GLY GLY A . n A 1 41 SER 41 38 38 SER SER A . n A 1 42 PHE 42 39 39 PHE PHE A . n A 1 43 VAL 43 40 40 VAL VAL A . n A 1 44 SER 44 41 41 SER SER A . n A 1 45 GLU 45 42 42 GLU GLU A . n A 1 46 TYR 46 43 43 TYR TYR A . n A 1 47 ASN 47 44 44 ASN ASN A . n A 1 48 ASP 48 45 45 ASP ASP A . n A 1 49 LEU 49 46 46 LEU LEU A . n A 1 50 THR 50 47 47 THR THR A . n A 1 51 LYS 51 48 48 LYS LYS A . n A 1 52 ARG 52 1677 1677 ARG ARG A . n A 1 53 ASN 53 1678 1678 ASN ASN A . n A 1 54 ASN 54 1679 1679 ASN ASN A . n A 1 55 LEU 55 1680 1680 LEU LEU A . n A 1 56 LEU 56 1681 1681 LEU LEU A . n A 1 57 GLN 57 1682 1682 GLN GLN A . n A 1 58 ALA 58 1683 1683 ALA ALA A . n A 1 59 GLU 59 1684 1684 GLU GLU A . n A 1 60 LEU 60 1685 1685 LEU LEU A . n A 1 61 GLU 61 1686 1686 GLU GLU A . n A 1 62 GLU 62 1687 1687 GLU GLU A . n A 1 63 LEU 63 1688 1688 LEU LEU A . n A 1 64 ARG 64 1689 1689 ARG ARG A . n A 1 65 ALA 65 1690 1690 ALA ALA A . n A 1 66 VAL 66 1691 1691 VAL VAL A . n A 1 67 VAL 67 1692 1692 VAL VAL A . n A 1 68 GLU 68 1693 1693 GLU GLU A . n A 1 69 GLN 69 1694 1694 GLN GLN A . n A 1 70 THR 70 1695 1695 THR THR A . n A 1 71 GLU 71 1696 1696 GLU GLU A . n A 1 72 ARG 72 1697 1697 ARG ARG A . n A 1 73 SER 73 1698 1698 SER SER A . n A 1 74 ARG 74 1699 1699 ARG ARG A . n A 1 75 LYS 75 1700 1700 LYS LYS A . n A 1 76 LEU 76 1701 1701 LEU LEU A . n A 1 77 ALA 77 1702 1702 ALA ALA A . n A 1 78 GLU 78 1703 1703 GLU GLU A . n A 1 79 GLN 79 1704 1704 GLN GLN A . n A 1 80 GLU 80 1705 1705 GLU GLU A . n A 1 81 LEU 81 1706 1706 LEU LEU A . n A 1 82 ILE 82 1707 1707 ILE ILE A . n A 1 83 GLU 83 1708 1708 GLU GLU A . n A 1 84 THR 84 1709 1709 THR THR A . n A 1 85 SER 85 1710 1710 SER SER A . n A 1 86 GLU 86 1711 1711 GLU GLU A . n A 1 87 ARG 87 1712 1712 ARG ARG A . n A 1 88 VAL 88 1713 1713 VAL VAL A . n A 1 89 GLN 89 1714 1714 GLN GLN A . n A 1 90 LEU 90 1715 1715 LEU LEU A . n A 1 91 LEU 91 1716 1716 LEU LEU A . n A 1 92 HIS 92 1717 1717 HIS HIS A . n A 1 93 SER 93 1718 1718 SER SER A . n A 1 94 GLN 94 1719 1719 GLN GLN A . n A 1 95 ASN 95 1720 1720 ASN ASN A . n A 1 96 THR 96 1721 1721 THR THR A . n A 1 97 SER 97 1722 1722 SER SER A . n A 1 98 LEU 98 1723 1723 LEU LEU A . n A 1 99 ILE 99 1724 1724 ILE ILE A . n A 1 100 ASN 100 1725 1725 ASN ASN A . n A 1 101 GLN 101 1726 1726 GLN GLN A . n A 1 102 LYS 102 1727 1727 LYS LYS A . n A 1 103 LYS 103 1728 1728 LYS LYS A . n A 1 104 LYS 104 1729 1729 LYS LYS A . n A 1 105 MET 105 1730 1730 MET MET A . n A 1 106 ASP 106 1731 1731 ASP ASP A . n A 1 107 ALA 107 1732 ? ? ? A . n A 1 108 ASP 108 1733 ? ? ? A . n A 1 109 LEU 109 1734 ? ? ? A . n A 1 110 SER 110 1735 ? ? ? A . n A 1 111 GLN 111 1736 ? ? ? A . n A 1 112 LEU 112 1737 ? ? ? A . n A 1 113 GLN 113 1738 ? ? ? A . n A 1 114 THR 114 1739 ? ? ? A . n A 1 115 GLU 115 1740 ? ? ? A . n A 1 116 VAL 116 1741 ? ? ? A . n A 1 117 GLU 117 1742 ? ? ? A . n A 1 118 GLU 118 1743 ? ? ? A . n A 1 119 ALA 119 1744 ? ? ? A . n A 1 120 VAL 120 1745 ? ? ? A . n A 1 121 GLN 121 1746 ? ? ? A . n A 1 122 GLU 122 1747 ? ? ? A . n A 1 123 CYS 123 1748 ? ? ? A . n A 1 124 ARG 124 1749 ? ? ? A . n A 1 125 ASN 125 1750 ? ? ? A . n A 1 126 ALA 126 1751 ? ? ? A . n A 1 127 GLU 127 1752 ? ? ? A . n A 1 128 GLU 128 1753 ? ? ? A . n A 1 129 LYS 129 1754 ? ? ? A . n A 1 130 ALA 130 1755 ? ? ? A . n A 1 131 GLU 131 1756 ? ? ? A . n A 1 132 ASP 132 1757 ? ? ? A . n A 1 133 LEU 133 1758 ? ? ? A . n A 1 134 GLU 134 1759 ? ? ? A . n A 1 135 LYS 135 1760 ? ? ? A . n A 1 136 GLU 136 1761 ? ? ? A . n A 1 137 ARG 137 1762 ? ? ? A . n A 1 138 ASP 138 1763 ? ? ? A . n A 1 139 PHE 139 1764 ? ? ? A . n A 1 140 TYR 140 1765 ? ? ? A . n A 1 141 PHE 141 1766 ? ? ? A . n A 1 142 GLY 142 1767 ? ? ? A . n A 1 143 LYS 143 1768 ? ? ? A . n A 1 144 LEU 144 1769 ? ? ? A . n A 1 145 ARG 145 1770 ? ? ? A . n A 1 146 ASN 146 1771 ? ? ? A . n A 1 147 ILE 147 1772 ? ? ? A . n A 1 148 GLU 148 1773 ? ? ? A . n A 1 149 LEU 149 1774 ? ? ? A . n A 1 150 ILE 150 1775 ? ? ? A . n A 1 151 CYS 151 1776 ? ? ? A . n A 1 152 GLN 152 1777 ? ? ? A . n A 1 153 GLU 153 1778 ? ? ? A . n A 1 154 ASN 154 1779 ? ? ? A . n A 1 155 GLU 155 1780 ? ? ? A . n A 1 156 GLY 156 1781 ? ? ? A . n A 1 157 GLU 157 1782 ? ? ? A . n A 1 158 ASN 158 1783 ? ? ? A . n A 1 159 ASP 159 1784 ? ? ? A . n A 1 160 PRO 160 1785 ? ? ? A . n A 1 161 VAL 161 1786 ? ? ? A . n A 1 162 LEU 162 1787 ? ? ? A . n A 1 163 GLN 163 1788 ? ? ? A . n A 1 164 ARG 164 1789 ? ? ? A . n A 1 165 ILE 165 1790 ? ? ? A . n A 1 166 VAL 166 1791 ? ? ? A . n A 1 167 ASP 167 1792 ? ? ? A . n A 1 168 ILE 168 1793 ? ? ? A . n A 1 169 LEU 169 1794 ? ? ? A . n A 1 170 TYR 170 1795 ? ? ? A . n A 1 171 ALA 171 1796 ? ? ? A . n A 1 172 THR 172 1797 ? ? ? A . n A 1 173 ASP 173 1798 ? ? ? A . n A 1 174 GLU 174 1799 ? ? ? A . n A 1 175 GLY 175 1800 ? ? ? A . n A 1 176 PHE 176 1801 ? ? ? A . n A 1 177 VAL 177 1802 ? ? ? A . n A 1 178 ILE 178 1803 ? ? ? A . n A 1 179 PRO 179 1804 ? ? ? A . n A 1 180 ASP 180 1805 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 1901 1 SO4 SO4 A . C 3 TMO 1 1902 1 TMO TMO A . D 3 TMO 1 1903 2 TMO TMO A . E 3 TMO 1 1904 3 TMO TMO A . F 3 TMO 1 1905 4 TMO TMO A . G 4 HOH 1 2001 12 HOH HOH A . G 4 HOH 2 2002 11 HOH HOH A . G 4 HOH 3 2003 2 HOH HOH A . G 4 HOH 4 2004 6 HOH HOH A . G 4 HOH 5 2005 3 HOH HOH A . G 4 HOH 6 2006 5 HOH HOH A . G 4 HOH 7 2007 4 HOH HOH A . G 4 HOH 8 2008 13 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5630 ? 1 MORE -59 ? 1 'SSA (A^2)' 13890 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_565 x,x-y+1,-z+1/6 0.5000000000 0.8660254038 0.0000000000 -70.8780000000 0.8660254038 -0.5000000000 0.0000000000 122.7642971389 0.0000000000 0.0000000000 -1.0000000000 14.5635000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-08-09 2 'Structure model' 1 1 2017-09-27 3 'Structure model' 1 2 2017-12-27 4 'Structure model' 1 3 2019-12-04 5 'Structure model' 1 4 2023-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_audit_support 2 3 'Structure model' citation 3 4 'Structure model' pdbx_audit_support 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond 6 5 'Structure model' database_2 7 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_audit_support.funding_organization' 2 3 'Structure model' '_citation.journal_volume' 3 3 'Structure model' '_citation.page_first' 4 3 'Structure model' '_citation.page_last' 5 3 'Structure model' '_citation.title' 6 4 'Structure model' '_pdbx_audit_support.funding_organization' 7 5 'Structure model' '_database_2.pdbx_DOI' 8 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -5.2225 70.5541 8.6576 0.4669 0.2519 0.1879 -0.1886 -0.0495 -0.0025 7.2102 8.0127 3.0751 0.8689 -0.5878 -0.1697 0.2970 -0.1053 -0.8911 0.1945 -0.1652 -0.1406 0.7090 -0.6440 -0.1249 'X-RAY DIFFRACTION' 2 ? refined -51.0452 53.9197 6.0724 0.2888 0.5664 0.2743 -0.3327 0.0154 -0.0177 5.2854 1.9253 0.1467 3.2507 -0.9237 -0.5747 -0.1786 0.3372 0.1211 -0.1138 0.2294 0.1104 0.0361 -0.1291 0.0278 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 0 through 21 ) ; 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 22 through 1731 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.11.1_2575)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 1679 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -67.71 _pdbx_validate_torsion.psi 4.90 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A GLY -1 ? A GLY 2 3 1 Y 1 A ALA 1732 ? A ALA 107 4 1 Y 1 A ASP 1733 ? A ASP 108 5 1 Y 1 A LEU 1734 ? A LEU 109 6 1 Y 1 A SER 1735 ? A SER 110 7 1 Y 1 A GLN 1736 ? A GLN 111 8 1 Y 1 A LEU 1737 ? A LEU 112 9 1 Y 1 A GLN 1738 ? A GLN 113 10 1 Y 1 A THR 1739 ? A THR 114 11 1 Y 1 A GLU 1740 ? A GLU 115 12 1 Y 1 A VAL 1741 ? A VAL 116 13 1 Y 1 A GLU 1742 ? A GLU 117 14 1 Y 1 A GLU 1743 ? A GLU 118 15 1 Y 1 A ALA 1744 ? A ALA 119 16 1 Y 1 A VAL 1745 ? A VAL 120 17 1 Y 1 A GLN 1746 ? A GLN 121 18 1 Y 1 A GLU 1747 ? A GLU 122 19 1 Y 1 A CYS 1748 ? A CYS 123 20 1 Y 1 A ARG 1749 ? A ARG 124 21 1 Y 1 A ASN 1750 ? A ASN 125 22 1 Y 1 A ALA 1751 ? A ALA 126 23 1 Y 1 A GLU 1752 ? A GLU 127 24 1 Y 1 A GLU 1753 ? A GLU 128 25 1 Y 1 A LYS 1754 ? A LYS 129 26 1 Y 1 A ALA 1755 ? A ALA 130 27 1 Y 1 A GLU 1756 ? A GLU 131 28 1 Y 1 A ASP 1757 ? A ASP 132 29 1 Y 1 A LEU 1758 ? A LEU 133 30 1 Y 1 A GLU 1759 ? A GLU 134 31 1 Y 1 A LYS 1760 ? A LYS 135 32 1 Y 1 A GLU 1761 ? A GLU 136 33 1 Y 1 A ARG 1762 ? A ARG 137 34 1 Y 1 A ASP 1763 ? A ASP 138 35 1 Y 1 A PHE 1764 ? A PHE 139 36 1 Y 1 A TYR 1765 ? A TYR 140 37 1 Y 1 A PHE 1766 ? A PHE 141 38 1 Y 1 A GLY 1767 ? A GLY 142 39 1 Y 1 A LYS 1768 ? A LYS 143 40 1 Y 1 A LEU 1769 ? A LEU 144 41 1 Y 1 A ARG 1770 ? A ARG 145 42 1 Y 1 A ASN 1771 ? A ASN 146 43 1 Y 1 A ILE 1772 ? A ILE 147 44 1 Y 1 A GLU 1773 ? A GLU 148 45 1 Y 1 A LEU 1774 ? A LEU 149 46 1 Y 1 A ILE 1775 ? A ILE 150 47 1 Y 1 A CYS 1776 ? A CYS 151 48 1 Y 1 A GLN 1777 ? A GLN 152 49 1 Y 1 A GLU 1778 ? A GLU 153 50 1 Y 1 A ASN 1779 ? A ASN 154 51 1 Y 1 A GLU 1780 ? A GLU 155 52 1 Y 1 A GLY 1781 ? A GLY 156 53 1 Y 1 A GLU 1782 ? A GLU 157 54 1 Y 1 A ASN 1783 ? A ASN 158 55 1 Y 1 A ASP 1784 ? A ASP 159 56 1 Y 1 A PRO 1785 ? A PRO 160 57 1 Y 1 A VAL 1786 ? A VAL 161 58 1 Y 1 A LEU 1787 ? A LEU 162 59 1 Y 1 A GLN 1788 ? A GLN 163 60 1 Y 1 A ARG 1789 ? A ARG 164 61 1 Y 1 A ILE 1790 ? A ILE 165 62 1 Y 1 A VAL 1791 ? A VAL 166 63 1 Y 1 A ASP 1792 ? A ASP 167 64 1 Y 1 A ILE 1793 ? A ILE 168 65 1 Y 1 A LEU 1794 ? A LEU 169 66 1 Y 1 A TYR 1795 ? A TYR 170 67 1 Y 1 A ALA 1796 ? A ALA 171 68 1 Y 1 A THR 1797 ? A THR 172 69 1 Y 1 A ASP 1798 ? A ASP 173 70 1 Y 1 A GLU 1799 ? A GLU 174 71 1 Y 1 A GLY 1800 ? A GLY 175 72 1 Y 1 A PHE 1801 ? A PHE 176 73 1 Y 1 A VAL 1802 ? A VAL 177 74 1 Y 1 A ILE 1803 ? A ILE 178 75 1 Y 1 A PRO 1804 ? A PRO 179 76 1 Y 1 A ASP 1805 ? A ASP 180 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 SO4 S S N N 304 SO4 O1 O N N 305 SO4 O2 O N N 306 SO4 O3 O N N 307 SO4 O4 O N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TMO CAA C N N 326 TMO NAC N N N 327 TMO CAD C N N 328 TMO CAB C N N 329 TMO OAE O N N 330 TMO HAA H N N 331 TMO HAAA H N N 332 TMO HAAB H N N 333 TMO HAD H N N 334 TMO HADA H N N 335 TMO HADB H N N 336 TMO HAB H N N 337 TMO HABA H N N 338 TMO HABB H N N 339 TYR N N N N 340 TYR CA C N S 341 TYR C C N N 342 TYR O O N N 343 TYR CB C N N 344 TYR CG C Y N 345 TYR CD1 C Y N 346 TYR CD2 C Y N 347 TYR CE1 C Y N 348 TYR CE2 C Y N 349 TYR CZ C Y N 350 TYR OH O N N 351 TYR OXT O N N 352 TYR H H N N 353 TYR H2 H N N 354 TYR HA H N N 355 TYR HB2 H N N 356 TYR HB3 H N N 357 TYR HD1 H N N 358 TYR HD2 H N N 359 TYR HE1 H N N 360 TYR HE2 H N N 361 TYR HH H N N 362 TYR HXT H N N 363 VAL N N N N 364 VAL CA C N S 365 VAL C C N N 366 VAL O O N N 367 VAL CB C N N 368 VAL CG1 C N N 369 VAL CG2 C N N 370 VAL OXT O N N 371 VAL H H N N 372 VAL H2 H N N 373 VAL HA H N N 374 VAL HB H N N 375 VAL HG11 H N N 376 VAL HG12 H N N 377 VAL HG13 H N N 378 VAL HG21 H N N 379 VAL HG22 H N N 380 VAL HG23 H N N 381 VAL HXT H N N 382 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TMO CAA NAC sing N N 310 TMO CAA HAA sing N N 311 TMO CAA HAAA sing N N 312 TMO CAA HAAB sing N N 313 TMO NAC CAD sing N N 314 TMO NAC CAB sing N N 315 TMO NAC OAE sing N N 316 TMO CAD HAD sing N N 317 TMO CAD HADA sing N N 318 TMO CAD HADB sing N N 319 TMO CAB HAB sing N N 320 TMO CAB HABA sing N N 321 TMO CAB HABB sing N N 322 TYR N CA sing N N 323 TYR N H sing N N 324 TYR N H2 sing N N 325 TYR CA C sing N N 326 TYR CA CB sing N N 327 TYR CA HA sing N N 328 TYR C O doub N N 329 TYR C OXT sing N N 330 TYR CB CG sing N N 331 TYR CB HB2 sing N N 332 TYR CB HB3 sing N N 333 TYR CG CD1 doub Y N 334 TYR CG CD2 sing Y N 335 TYR CD1 CE1 sing Y N 336 TYR CD1 HD1 sing N N 337 TYR CD2 CE2 doub Y N 338 TYR CD2 HD2 sing N N 339 TYR CE1 CZ doub Y N 340 TYR CE1 HE1 sing N N 341 TYR CE2 CZ sing Y N 342 TYR CE2 HE2 sing N N 343 TYR CZ OH sing N N 344 TYR OH HH sing N N 345 TYR OXT HXT sing N N 346 VAL N CA sing N N 347 VAL N H sing N N 348 VAL N H2 sing N N 349 VAL CA C sing N N 350 VAL CA CB sing N N 351 VAL CA HA sing N N 352 VAL C O doub N N 353 VAL C OXT sing N N 354 VAL CB CG1 sing N N 355 VAL CB CG2 sing N N 356 VAL CB HB sing N N 357 VAL CG1 HG11 sing N N 358 VAL CG1 HG12 sing N N 359 VAL CG1 HG13 sing N N 360 VAL CG2 HG21 sing N N 361 VAL CG2 HG22 sing N N 362 VAL CG2 HG23 sing N N 363 VAL OXT HXT sing N N 364 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Heart, Lung, and Blood Institute (NIH/NHLBI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'R21 HL111237' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'trimethylamine oxide' TMO 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1IK9 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #