data_5WLX # _entry.id 5WLX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5WLX pdb_00005wlx 10.2210/pdb5wlx/pdb WWPDB D_1000229260 ? ? BMRB 30318 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of kappa-theraphotoxin-Aa1a' _pdbx_database_related.db_id 30318 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 5WLX _pdbx_database_status.recvd_initial_deposition_date 2017-07-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chin, Y.K.Y.' 1 ? 'Ma, L.' 2 ? 'King, G.F.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Biochem. Pharmacol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1873-2968 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 158 _citation.language ? _citation.page_first 60 _citation.page_last 72 _citation.title 'Novel venom-derived inhibitors of the human EAG channel, a putative antiepileptic drug target.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bcp.2018.08.038 _citation.pdbx_database_id_PubMed 30149017 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ma, L.' 1 ? primary 'Chin, Y.K.Y.' 2 ? primary 'Dekan, Z.' 3 ? primary 'Herzig, V.' 4 ? primary 'Chow, C.Y.' 5 ? primary 'Heighway, J.' 6 ? primary 'Lam, S.W.' 7 ? primary 'Guillemin, G.J.' 8 ? primary 'Alewood, P.F.' 9 ? primary 'King, G.F.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description Kappa-theraphotoxin-Aa1a _entity.formula_weight 4163.811 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'GDCHKFLGWCRGEKDPCCEHLTCHVKHGWCVWDGTI(NH2)' _entity_poly.pdbx_seq_one_letter_code_can GDCHKFLGWCRGEKDPCCEHLTCHVKHGWCVWDGTIX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASP n 1 3 CYS n 1 4 HIS n 1 5 LYS n 1 6 PHE n 1 7 LEU n 1 8 GLY n 1 9 TRP n 1 10 CYS n 1 11 ARG n 1 12 GLY n 1 13 GLU n 1 14 LYS n 1 15 ASP n 1 16 PRO n 1 17 CYS n 1 18 CYS n 1 19 GLU n 1 20 HIS n 1 21 LEU n 1 22 THR n 1 23 CYS n 1 24 HIS n 1 25 VAL n 1 26 LYS n 1 27 HIS n 1 28 GLY n 1 29 TRP n 1 30 CYS n 1 31 VAL n 1 32 TRP n 1 33 ASP n 1 34 GLY n 1 35 THR n 1 36 ILE n 1 37 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 37 _pdbx_entity_src_syn.organism_scientific Avicularia _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 446523 _pdbx_entity_src_syn.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 5WLX _struct_ref.pdbx_db_accession 5WLX _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5WLX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 37 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5WLX _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 37 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 37 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 anisotropic 2 1 1 '2D 1H-13C HSQC' 1 anisotropic 3 1 1 '2D 1H-1H TOCSY' 1 anisotropic 4 1 1 '2D 1H-1H NOESY' 1 anisotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label p31 _pdbx_nmr_exptl_sample_conditions.pH_err 0.05 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM Kappa-theraphotoxin-Aa1a, 20 mM sodium phosphate, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label p31 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model B _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 5WLX _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 5WLX _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'Best stereochemical properties as judged by Molprobity' # _pdbx_nmr_representative.entry_id 5WLX _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CYANA ? 'Guntert, Mumenthaler and Wuthrich' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' Analysis ? CCPN 4 'peak picking' Analysis ? CCPN 5 collection TopSpin ? 'Bruker Biospin' 6 processing TopSpin ? 'Bruker Biospin' 7 'chemical shift assignment' CYANA ? 'Guntert, Mumenthaler and Wuthrich' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5WLX _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 5WLX _struct.title 'Solution structure of kappa-theraphotoxin-Aa1a' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5WLX _struct_keywords.text 'Spider toxins; Inhibitor cystine knot; Theraphotoxin, TOXIN' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 18 SG ? ? A CYS 3 A CYS 18 1_555 ? ? ? ? ? ? ? 2.000 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 23 SG ? ? A CYS 10 A CYS 23 1_555 ? ? ? ? ? ? ? 2.000 ? ? disulf3 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 17 A CYS 30 1_555 ? ? ? ? ? ? ? 1.999 ? ? covale1 covale both ? A ILE 36 C ? ? ? 1_555 A NH2 37 N ? ? A ILE 36 A NH2 37 1_555 ? ? ? ? ? ? ? 1.329 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 21 ? THR A 22 ? LEU A 21 THR A 22 AA1 2 VAL A 31 ? TRP A 32 ? VAL A 31 TRP A 32 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id THR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 22 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id THR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 22 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 31 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 31 # _atom_sites.entry_id 5WLX _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 TRP 9 9 9 TRP TRP A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 NH2 37 37 37 NH2 NH2 A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 100 ? 1 MORE 0 ? 1 'SSA (A^2)' 3150 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2018-08-01 2 'Structure model' 1 1 2019-02-27 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 3 'Structure model' pdbx_nmr_software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' 11 2 'Structure model' '_citation_author.name' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' 14 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 15 3 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 Kappa-theraphotoxin-Aa1a 1 ? mM 'natural abundance' 1 'sodium phosphate' 20 ? mM 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 18 ? ? -69.91 -175.28 2 1 CYS A 23 ? ? -53.15 104.72 3 1 TRP A 29 ? ? -171.12 141.48 4 2 CYS A 18 ? ? -69.80 -175.17 5 2 CYS A 23 ? ? -52.99 104.65 6 2 TRP A 29 ? ? -171.60 141.45 7 3 PRO A 16 ? ? -69.77 -171.62 8 3 CYS A 18 ? ? -69.82 -174.97 9 3 CYS A 23 ? ? -51.92 104.68 10 3 TRP A 29 ? ? -170.63 142.17 11 4 PRO A 16 ? ? -69.72 -173.77 12 4 CYS A 18 ? ? -69.95 -174.69 13 4 CYS A 23 ? ? -51.80 104.69 14 4 TRP A 29 ? ? -171.60 141.86 15 5 PRO A 16 ? ? -69.76 -174.46 16 5 CYS A 18 ? ? -69.98 -174.62 17 5 CYS A 23 ? ? -52.17 104.73 18 5 TRP A 29 ? ? -170.86 141.52 19 6 PRO A 16 ? ? -69.72 -174.07 20 6 CYS A 18 ? ? -69.97 -174.68 21 6 CYS A 23 ? ? -51.96 104.71 22 6 TRP A 29 ? ? -171.19 141.55 23 7 PRO A 16 ? ? -69.71 -171.13 24 7 CYS A 18 ? ? -69.88 -174.63 25 7 CYS A 23 ? ? -51.94 104.78 26 7 TRP A 29 ? ? -171.72 141.83 27 8 LYS A 14 ? ? -99.05 56.35 28 8 CYS A 18 ? ? -69.89 -175.37 29 8 CYS A 23 ? ? -53.85 104.61 30 8 TRP A 29 ? ? -170.58 141.52 31 9 PRO A 16 ? ? -69.78 -173.68 32 9 CYS A 18 ? ? -69.95 -174.74 33 9 CYS A 23 ? ? -51.81 104.66 34 9 TRP A 29 ? ? -171.72 141.57 35 10 PRO A 16 ? ? -69.68 -174.25 36 10 CYS A 23 ? ? -51.83 104.73 37 10 TRP A 29 ? ? -170.91 141.07 38 11 PRO A 16 ? ? -69.82 -173.23 39 11 CYS A 18 ? ? -69.92 -174.86 40 11 CYS A 23 ? ? -51.89 104.69 41 11 TRP A 29 ? ? -171.14 142.02 42 12 LYS A 14 ? ? -99.17 48.36 43 12 PRO A 16 ? ? -69.68 -176.88 44 12 CYS A 18 ? ? -69.93 -175.40 45 12 CYS A 23 ? ? -54.23 104.78 46 12 TRP A 29 ? ? -171.65 141.62 47 12 ASP A 33 ? ? -170.72 129.51 48 13 PRO A 16 ? ? -69.72 -174.53 49 13 CYS A 18 ? ? -69.95 -174.73 50 13 CYS A 23 ? ? -51.86 104.71 51 13 TRP A 29 ? ? -171.77 142.01 52 14 PRO A 16 ? ? -69.78 -173.06 53 14 CYS A 18 ? ? -69.89 -169.48 54 14 CYS A 23 ? ? -51.99 104.76 55 14 TRP A 29 ? ? -171.71 142.48 56 15 LYS A 14 ? ? -102.78 63.15 57 15 CYS A 18 ? ? -69.92 -175.26 58 15 CYS A 23 ? ? -53.07 104.75 59 15 TRP A 29 ? ? -171.83 141.65 60 16 LYS A 14 ? ? -101.82 55.14 61 16 CYS A 18 ? ? -69.83 -174.44 62 16 CYS A 23 ? ? -54.82 104.75 63 16 TRP A 29 ? ? -171.17 142.09 64 17 PRO A 16 ? ? -69.73 -174.84 65 17 CYS A 18 ? ? -69.92 -174.78 66 17 CYS A 23 ? ? -51.93 104.73 67 17 TRP A 29 ? ? -171.88 141.86 68 18 LYS A 14 ? ? -103.04 56.10 69 18 CYS A 18 ? ? -69.87 -174.34 70 18 CYS A 23 ? ? -53.84 104.60 71 18 TRP A 29 ? ? -171.69 142.29 72 19 PRO A 16 ? ? -69.85 -171.27 73 19 CYS A 23 ? ? -54.17 104.74 74 19 TRP A 29 ? ? -170.89 141.52 75 19 ASP A 33 ? ? -128.24 -57.07 76 20 LYS A 14 ? ? -108.13 67.44 77 20 CYS A 18 ? ? -69.90 -174.37 78 20 CYS A 23 ? ? -51.77 104.70 79 20 TRP A 29 ? ? -171.81 141.36 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #